3N4YA

Crystal structure of wild-type t. celer l30e in low ionic strength condition without precipitant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
VDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3n4yA00
2ALEA 2OHWA 2VGNA 1CK2A 1Q86H 3FFMA 1K73H 3CCVF 1CN7A 3SIUA 2BO1A 2LBXA 3VI6A 3OW2F 3HAXD 1VQ9F 1VQOF 1NMUB 4C4WC 1JJ2F 3LWVC 1YJ9F 1VQNF 1PXWA 4NUTA 2KG4A 3LFOA 1QVFF 2QEXF 1W3EX 2FC3A 3NVIB 1N8RH 3SIVA 3G4SF 1YJNF 3GYQA 3V7EA 1VQ6F 1XBIA 5EWRA 1Q81H 2OZBA 1NJIH 1H7MA 1S72F 2CZWA 1DT9A 4TZZA 1M1KH 1QVGF 4LCKA 4X3MA 5IT9M 3CCMF 3PLAC 5GIOC 3JAMM 3HJWC 3CCJF 1X7PA 3RA5A 1GO0A 5FLXM 3V7QA 3N4YA 2QA4F 5G4UC 1W42A 3CC4F 3CPQA 5EO3A 1X7OA 3CCRF 3CD6F 1VQ5F 3OBYA 2KTUA 2JNBA 2I6DA 1GZ0A 2LBWA 3I56F 3J7AR 2AIFA 3NVKE 3CPWF 1YITF 3PAFA 2QI2A 1VQMF 1YI2F 3CC7F 1ZWZA 3G71F 1E7KA 5DCVA 3LWQC 4BY9D 5FJ4C 5G4VC 3NK6A 1W2BF 3J81M 3CMAF 3IR9A 3RA6A 5GAPK 3CCQF 5GINC 3CC2F 3CCLF 3E1YA 1SDSA 3O85A 1VQ7F 1RLGA 3CCSF 1YHQF 1K8AH 3CMEF 3CCUF 3AGKA 3NMUC 3JCMM 1GO1A 2VGMA 1VQPF 3J80M 5A2QM 1KD1H 2HVYD 2OTJF 1VQ4F 2WALA 4BW0B 3MCAB 1W40A 3OBWA 1YJWF 2OTLF 1IPAA 3LWRC 1Q82H 1K9MH 1M90H 1Q7YH 5GIPC 1KC8H 1VQ8F 3VMFB 1VQKF 1X52A 1T0KB 1VQLF 3E20B 1RA4A 3I55F 3CXCF 4X3LA 3NK7A 1YIJF 5GANK 3WXMB 3G6EF 3ON1A 1W41A 3N4ZA 1KQSF 2KTVA 3LWPC 3CCEF 3CG6A 3LWOC
chains in the Genus database with same CATH superfamily
3RYCA 5IYZA 3K2XA 2VAWA 5HWEA 2GZLA 1CK2A 1Q86H 3CCVF 3UT5A 2BO1A 1U43A 2L26A 1IV2A 3M84A 3F0GA 5LA6B 1PXWA 4O4JB 4U39A 4BT7A 4X1IB 1H48A 4O4HA 3T80A 3NVIB 1Z5WA 1TVKB 3GYQA 5BMVA 5IJ9A 1XBIA 3EORA 2Q1YA 5J2UA 1H7MA 2LCAA 1NQ3A 1DT9A 3KE1A 3C8LA 5EIBC 4R40B 3DC2A 3FD6A 4I4TA 5LOVA 4YJ2B 4F6RA 3RA5A 1GX1A 5KMGB 1QAHA 5JVDA 3DDNA 5G4UC 4ERHA 3S03A 4ZI7B 3F0FA 4KWEA 3OBYA 2KTUA 1W5BA 1DBFA 5LYJA 2LBWA 3WJRA 2Z1TA 3GHZA 4EI9A 4TUYB 4O2BB 3KJKA 5DCVA 4IHJB 5FJ4C 5HY1A 2ZVZA 1W2BF 5GONB 3HKCA 4O4LB 1QU9A 3VCZA 5MN6A 1FSZA 1YQNA 2BTUA 3S02A 3E1YA 2K1SA 4G4YA 4LNUA 2HRUA 3O85A 3RYHB 5KX5B 1VQ7F 4BVSA 1K8AH 3V4DA 3D54A 3JCMM 3HKDA 4ZHYB 1VQPF 3C9TA 2P6YA 2HS0A 2N48A 4BT3A 4G4XA 4O4IA 2KGWA 5CB4B 5EZYA 4C8EA 3M1XA 1VQ4F 2WALA 2OTLF 3MCAB 3E22B 1VQ8F 4DRXB 2CHSA 1VQLF 3RYIB 4RQOA 2BTQB 3I55F 2HS3A 4X3LA 4X20A 5JCOC 4EB6A 5HP7A 3G6EF 3ON1A 2DT4A 5JH7B 2KTVA 1PF5A 4TV8B 3F0DA 1UFYA 3JATB 5C8YB 3IEQA 2ALEA 2UYKA 1R1MA 3IKFA 1JD1A 3S06A 3VI6A 5CA1B 3N2KA 5FNVA 1VQOF 2HS4A 1NMUB 2H6LA 1SZQA 2HP0A 3LWVC 2RHJA 2KG4A 3FPIA 2UZHA 2QEXF 1W3EX 2EWCA 4NWOB 4ZHQB 1Z5VA 3JAWB 3SIVA 3G4SF 3V7EA 1Q81H 3CYQA 1M1KH 4LCKA 1QVGF 2RHHA 3ZOPA 3K0TA 3JAMM 4IIJA 1GO0A 1ONIA 2W8BC 3KJJA 3N4YA 3RYFB 2QA4F 3ELCA 1H47A 3LYBA 3CC4F 3WGKA 5JQGB 3CCRF 3N2GA 4YJ3A 5MN4A 1RQ2A 4C8GA 2UYNA 2UYPA 1TUBA 2JNBA 4FFBA 2CSLA 2YXZA 3S0YA 3J7AR 2UYJA 4BVQA 3WPWA 3KHNA 3NVKE 4HNAA 2LBTA 3CPWF 2G9IA 1XHOA 2AIZP 4EI8A 5LXTA 3LDTA 1E7KA 2F9ZC 3IEWA 3TD3A 3VYTC 4BY9D 5G4VC 5CA0A 5EYPB 3NK6A 3JALA 3RYCB 5IYZB 2GVIA 2IAFA 3I3FA 4WBNA 3RA6A 2H8CA 5ITZA 1CLIA 3UT5B 5GAPK 3ERNA 1JFFA 1SDSA 3QUWA 4O2AA 3K12A 4PWTA 1VH8A 2CHTA 1OAPA 1GO1A 4X1YA 4O4HB 1KD1H 3B6NA 2HVYD 5BMVB 3QHDA 4E6EA 5IJ9B 2OTJF 5J2UB 1Q8RA 2V9YA 5HP8A 3WJPA 4ZK7A 3QTYA 1YJWF 1IPAA 5EAZA 1K9MH 1FNKA 1M90H 1FFXA 4I4TB 5LOVB 3VMFB 3JAKA 2CVLA 4F6RB 1X52A 3IKEA 2ZODA 3K14A 3CXCF 3JARA 3WJQA 5JVDB 5GANK 3WXMB 2GLZA 3N4ZA 3U0OA 1SA0A 5LYJB 3LWPC 3HWUA 2PHNA 4TV9A 4I50A 1JY8A 4BT2A 3LWOC 3JASA 1UI9A 2OHWA 2VGNA 2ZF8A 3MDOA 3FFMA 4U3JA 4BT4A 3HKBA 1XRGA 2LBXA 3OW2F 3MCQA 3HKCB 5EB0A 1VQ9F 3WPXA 1KNKA 3OONA 1VQNF 4BT6A 3LFOA 4ZHWA 3L7QA 4LNUB 1QVFF 1W5AA 2HRYA 3HKEA 2FC3A 4X1KA 4ZOLA 1YJNF 1VQ6F 4I55A 3BYQA 3HKDB 1NJIH 1S72F 1CN7A 2CZWA 2QTPA 4RHAA 2IG8A 3RE3A 2CWJA 4O4IB 3S0WA 3HJWC 5EZYB 2VAPA 1X7PA 5FLXM 5LP6A 3FBAA 4C82A 5IJ0A 3Q8HA 3CB2A 3CD6F 1VQ5F 2IQQA 5J2TA 2I6DA 5AVMA 3VYSC 4X20B 3R0PA 3HTNA 1U3LA 3P10A 5EIBD 4EB6B 3I56F 2AMTA 1U40A 4BVTA 2AIFA 5HY2A 2HX0A 3MQWA 2FGYA 2QI2A 1J7HA 1YI2F 3CC7F 3G71F 3LWQC 1YGYA 3VO8A 3F6MA 4ZHVA 2YYEA 5LA6A 4O4JA 4B62A 5GINC 2B33A 3N2KB 5FNVB 1W59A 2HP0B 4X1IA 3I7TA 2VAMA 3CYPB 1TVKA 3CCUF 5HY0A 3FD5A 2VGMA 4BT5A 3TD4A 2Z01A 3V3TA 4YJ2A 1W5EA 4BW0B 2R751 5KMGA 1Q82H 3LWRC 5B8FA 1KC8H 4ZI7A 1COMA 4C8IA 1VQKF 4IIJB 5HXUA 1RA4A 3D01A 3P4EA 3N2GB 4YJ3B 3ZO8A 1YIJF 4EI7A 2OTMA 2UYNB 1W41A 4FFBB 1TUBB 4C81A 4TUYA 4O2BA 1QD9A 1W581 3CCEF 3C9SA 4IHJA 2ZVYA 3C9UA 3P0ZA 4HNAB 5GONA 4O4LA 3ZP7A 5LXTB 3F0EA 3VIUA 1K73H 2H8EA 1W57A 5CA0B 3SIUA 1RQ7A 4B46A 3JALB 3HAXD 2Z1FA 1IV4A 4NQ3A 4XCQA 3RYHA 4WBNB 5KX5A 4B45A 4C4WC 1JJ2F 5ITZB 1YJ9F 3D00A 4NUTA 4G4ZA 1JFFB 2R6R1 4O2AB 3GTZA 1N8RH 1U3PA 5HY4A 2Z1EA 5EWRA 5CB4A 2OZBA 4X1YB 1IV1A 4TZZA 3E22A 5IT9M 2Z1UA 4X3MA 4DRXA 2VXYA 3VOAA 3CCMF 3PLAC 5GIOC 3MBMA 3CCJF 1VK3A 3RYIA 3V7QA 5JCOA 3VTIC 1FFXB 1W42A 4G88A 3JAKB 1OFUA 3CPQA 5EO3A 1X7OA 2DYYA 2BTOA 2RHLA 3WGLA 4DXDA 4B5CA 5JH7A 1GZ0A 3JARB 1FNJA 2RB9A 4TV8A 2MQEA 3VYUC 3JATA 5C8YA 1RLUA 1YITF 3PAFA 1VQMF 1SA0B 1ZWZA 5EB1B 2PMPA 4TV9B 3ESJA 4I50B 5MN5A 3ZP4A 1KNJA 5CA1A 3JASB 3J81M 3LMEA 3CMAF 3IR9A 4U3JB 1T0AA 3HKBB 2ZAUA 3CCQF 2ZOVA 3CC2F 5HXZA 1ODEA 3CCLF 2Q1XA 1RLGA 3CCSF 1YHQF 1VHAA 4ZHQA 3CMEF 4G4VA 3JAWA 1XV2A 2I6RA 3AGKA 3S0HA 3NMUC 3WGNA 3J80M 3JVHA 3M4SA 3HKEB 2HP3A 1W5FA 5A2QM 4X1KB 3IMPA 1W55A 4ZOLB 2CW4A 4I55B 2RHOA 3KIZA 3TD5A 1W40A 3OBWA 3RYFA 3WGJA 1Q7YH 3C9RA 5GIPC 5JQGA 1IV3A 1VQVA 1T0KB 1X25A 3WGMA 3E20B 4G4WA 3VOBA 5LP6B 4BVRA 2NMUA 5IJ0B 5LP6C 3NK7A 4M8IA 2HQSC 5J2TB 1KQSF 1JN1A 5EYPA 3CG6A
chains in the Genus database with same CATH topology
2ALEA 2OHWA 2VGNA 5HWEA 1CK2A 1Q86H 3FFMA 1K73H 3CCVF 1CN7A 3SIUA 2BO1A 2LBXA 3VI6A 3OW2F 3HAXD 1VQ9F 4NQ3A 4XCQA 1VQOF 1NMUB 4C4WC 1JJ2F 3LWVC 1YJ9F 1VQNF 3D00A 1PXWA 4NUTA 2KG4A 3LFOA 1QVFF 2QEXF 1W3EX 2FC3A 3NVIB 1N8RH 5HY4A 3SIVA 3G4SF 1YJNF 3GYQA 3V7EA 1VQ6F 1XBIA 5EWRA 1Q81H 2OZBA 1NJIH 1H7MA 1S72F 2CZWA 1DT9A 4TZZA 1M1KH 1QVGF 4LCKA 4X3MA 5IT9M 3CCMF 3PLAC 5GIOC 3JAMM 3HJWC 3CCJF 1X7PA 3RA5A 1GO0A 5FLXM 3V7QA 3N4YA 2QA4F 5G4UC 1W42A 3CC4F 3CPQA 5EO3A 1X7OA 3CCRF 3CD6F 1VQ5F 3OBYA 2KTUA 2JNBA 2I6DA 1GZ0A 2LBWA 3I56F 3J7AR 4BVQA 4BVTA 2AIFA 3NVKE 5HY2A 3CPWF 1YITF 2FGYA 3PAFA 2QI2A 4EI9A 1VQMF 1YI2F 3CC7F 1ZWZA 4EI8A 3G71F 1E7KA 2F9ZC 5DCVA 3LWQC 4BY9D 5FJ4C 5HY1A 5G4VC 3NK6A 1W2BF 3J81M 3CMAF 3IR9A 3RA6A 5GAPK 3CCQF 5GINC 3CC2F 5HXZA 3E1YA 3CCLF 1SDSA 3O85A 1VQ7F 1RLGA 4BVSA 3CCSF 1YHQF 1K8AH 3CMEF 3CCUF 3AGKA 3NMUC 5HY0A 3JCMM 1GO1A 2VGMA 1VQPF 3J80M 5A2QM 3V3TA 1KD1H 2HVYD 2OTJF 1VQ4F 2WALA 4BW0B 3MCAB 1W40A 3OBWA 1YJWF 2OTLF 1IPAA 3LWRC 1Q82H 1K9MH 1M90H 1Q7YH 5GIPC 1KC8H 1VQ8F 3VMFB 1VQKF 1X52A 5HXUA 1T0KB 1VQLF 3E20B 1RA4A 3I55F 3CXCF 4X3LA 4BVRA 3NK7A 1YIJF 5GANK 3WXMB 4EI7A 3G6EF 2GLZA 3ON1A 1W41A 3N4ZA 1KQSF 2KTVA 3LWPC 3CCEF 3CG6A 3LWOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALE A;  2OHW A;  2VGN A;  1CK2 A;  1Q86 H;  3FFM A;  1K73 H;  3CCV F;  1CN7 A;  3SIU A;  2BO1 A;  2LBX A;  3VI6 A;  3OW2 F;  3HAX D;  1VQ9 F;  1VQO F;  1NMU B;  4C4W C;  1JJ2 F;  3LWV C;  1YJ9 F;  1VQN F;  1PXW A;  4NUT A;  2KG4 A;  3LFO A;  1QVF F;  2QEX F;  1W3E X;  2FC3 A;  3NVI B;  1N8R H;  3SIV A;  3G4S F;  1YJN F;  3GYQ A;  3V7E A;  1VQ6 F;  1XBI A;  5EWR A;  1Q81 H;  2OZB A;  1NJI H;  1H7M A;  1S72 F;  2CZW A;  1DT9 A;  4TZZ A;  1M1K H;  1QVG F;  4LCK A;  4X3M A;  5IT9 M;  3CCM F;  3PLA C;  5GIO C;  3JAM M;  3HJW C;  3CCJ F;  1X7P A;  3RA5 A;  1GO0 A;  5FLX M;  3V7Q A;  3N4Y A;  2QA4 F;  5G4U C;  1W42 A;  3CC4 F;  3CPQ A;  5EO3 A;  1X7O A;  3CCR F;  3CD6 F;  1VQ5 F;  3OBY A;  2KTU A;  2JNB A;  2I6D A;  1GZ0 A;  2LBW A;  3I56 F;  3J7A R;  2AIF A;  3NVK E;  3CPW F;  1YIT F;  3PAF A;  2QI2 A;  1VQM F;  1YI2 F;  3CC7 F;  1ZWZ A;  3G71 F;  1E7K A;  5DCV A;  3LWQ C;  4BY9 D;  5FJ4 C;  5G4V C;  3NK6 A;  1W2B F;  3J81 M;  3CMA F;  3IR9 A;  3RA6 A;  5GAP K;  3CCQ F;  5GIN C;  3CC2 F;  3CCL F;  3E1Y A;  1SDS A;  3O85 A;  1VQ7 F;  1RLG A;  3CCS F;  1YHQ F;  1K8A H;  3CME F;  3CCU F;  3AGK A;  3NMU C;  3JCM M;  1GO1 A;  2VGM A;  1VQP F;  3J80 M;  5A2Q M;  1KD1 H;  2HVY D;  2OTJ F;  1VQ4 F;  2WAL A;  4BW0 B;  3MCA B;  1W40 A;  3OBW A;  1YJW F;  2OTL F;  1IPA A;  3LWR C;  1Q82 H;  1K9M H;  1M90 H;  1Q7Y H;  5GIP C;  1KC8 H;  1VQ8 F;  3VMF B;  1VQK F;  1X52 A;  1T0K B;  1VQL F;  3E20 B;  1RA4 A;  3I55 F;  3CXC F;  4X3L A;  3NK7 A;  1YIJ F;  5GAN K;  3WXM B;  3G6E F;  3ON1 A;  1W41 A;  3N4Z A;  1KQS F;  2KTV A;  3LWP C;  3CCE F;  3CG6 A;  3LWO C; 
#chains in the Genus database with same CATH topology
 3RYC A;  5IYZ A;  3K2X A;  2VAW A;  5HWE A;  2GZL A;  1CK2 A;  1Q86 H;  3CCV F;  3UT5 A;  2BO1 A;  1U43 A;  2L26 A;  1IV2 A;  3M84 A;  3F0G A;  5LA6 B;  1PXW A;  4O4J B;  4U39 A;  4BT7 A;  4X1I B;  1H48 A;  4O4H A;  3T80 A;  3NVI B;  1Z5W A;  1TVK B;  3GYQ A;  5BMV A;  5IJ9 A;  1XBI A;  3EOR A;  2Q1Y A;  5J2U A;  1H7M A;  2LCA A;  1NQ3 A;  1DT9 A;  3KE1 A;  3C8L A;  5EIB C;  4R40 B;  3DC2 A;  3FD6 A;  4I4T A;  5LOV A;  4YJ2 B;  4F6R A;  3RA5 A;  1GX1 A;  5KMG B;  1QAH A;  5JVD A;  3DDN A;  5G4U C;  4ERH A;  3S03 A;  4ZI7 B;  3F0F A;  4KWE A;  3OBY A;  2KTU A;  1W5B A;  1DBF A;  5LYJ A;  2LBW A;  3WJR A;  2Z1T A;  3GHZ A;  4EI9 A;  4TUY B;  4O2B B;  3KJK A;  5DCV A;  4IHJ B;  5FJ4 C;  5HY1 A;  2ZVZ A;  1W2B F;  5GON B;  3HKC A;  4O4L B;  1QU9 A;  3VCZ A;  5MN6 A;  1FSZ A;  1YQN A;  2BTU A;  3S02 A;  3E1Y A;  2K1S A;  4G4Y A;  4LNU A;  2HRU A;  3O85 A;  3RYH B;  5KX5 B;  1VQ7 F;  4BVS A;  1K8A H;  3V4D A;  3D54 A;  3JCM M;  3HKD A;  4ZHY B;  1VQP F;  3C9T A;  2P6Y A;  2HS0 A;  2N48 A;  4BT3 A;  4G4X A;  4O4I A;  2KGW A;  5CB4 B;  5EZY A;  4C8E A;  3M1X A;  1VQ4 F;  2WAL A;  2OTL F;  3MCA B;  3E22 B;  1VQ8 F;  4DRX B;  2CHS A;  1VQL F;  3RYI B;  4RQO A;  2BTQ B;  3I55 F;  2HS3 A;  4X3L A;  4X20 A;  5JCO C;  4EB6 A;  5HP7 A;  3G6E F;  3ON1 A;  2DT4 A;  5JH7 B;  2KTV A;  1PF5 A;  4TV8 B;  3F0D A;  1UFY A;  3JAT B;  5C8Y B;  3IEQ A;  2ALE A;  2UYK A;  1R1M A;  3IKF A;  1JD1 A;  3S06 A;  3VI6 A;  5CA1 B;  3N2K A;  5FNV A;  1VQO F;  2HS4 A;  1NMU B;  2H6L A;  1SZQ A;  2HP0 A;  3LWV C;  2RHJ A;  2KG4 A;  3FPI A;  2UZH A;  2QEX F;  1W3E X;  2EWC A;  4NWO B;  4ZHQ B;  1Z5V A;  3JAW B;  3SIV A;  3G4S F;  3V7E A;  1Q81 H;  3CYQ A;  1M1K H;  4LCK A;  1QVG F;  2RHH A;  3ZOP A;  3K0T A;  3JAM M;  4IIJ A;  1GO0 A;  1ONI A;  2W8B C;  3KJJ A;  3N4Y A;  3RYF B;  2QA4 F;  3ELC A;  1H47 A;  3LYB A;  3CC4 F;  3WGK A;  5JQG B;  3CCR F;  3N2G A;  4YJ3 A;  5MN4 A;  1RQ2 A;  4C8G A;  2UYN A;  2UYP A;  1TUB A;  2JNB A;  4FFB A;  2CSL A;  2YXZ A;  3S0Y A;  3J7A R;  2UYJ A;  4BVQ A;  3WPW A;  3KHN A;  3NVK E;  4HNA A;  2LBT A;  3CPW F;  2G9I A;  1XHO A;  2AIZ P;  4EI8 A;  5LXT A;  3LDT A;  1E7K A;  2F9Z C;  3IEW A;  3TD3 A;  3VYT C;  4BY9 D;  5G4V C;  5CA0 A;  5EYP B;  3NK6 A;  3JAL A;  3RYC B;  5IYZ B;  2GVI A;  2IAF A;  3I3F A;  4WBN A;  3RA6 A;  2H8C A;  5ITZ A;  1CLI A;  3UT5 B;  5GAP K;  3ERN A;  1JFF A;  1SDS A;  3QUW A;  4O2A A;  3K12 A;  4PWT A;  1VH8 A;  2CHT A;  1OAP A;  1GO1 A;  4X1Y A;  4O4H B;  1KD1 H;  3B6N A;  2HVY D;  5BMV B;  3QHD A;  4E6E A;  5IJ9 B;  2OTJ F;  5J2U B;  1Q8R A;  2V9Y A;  5HP8 A;  3WJP A;  4ZK7 A;  3QTY A;  1YJW F;  1IPA A;  5EAZ A;  1K9M H;  1FNK A;  1M90 H;  1FFX A;  4I4T B;  5LOV B;  3VMF B;  3JAK A;  2CVL A;  4F6R B;  1X52 A;  3IKE A;  2ZOD A;  3K14 A;  3CXC F;  3JAR A;  3WJQ A;  5JVD B;  5GAN K;  3WXM B;  2GLZ A;  3N4Z A;  3U0O A;  1SA0 A;  5LYJ B;  3LWP C;  3HWU A;  2PHN A;  4TV9 A;  4I50 A;  1JY8 A;  4BT2 A;  3LWO C;  3JAS A;  1UI9 A;  2OHW A;  2VGN A;  2ZF8 A;  3MDO A;  3FFM A;  4U3J A;  4BT4 A;  3HKB A;  1XRG A;  2LBX A;  3OW2 F;  3MCQ A;  3HKC B;  5EB0 A;  1VQ9 F;  3WPX A;  1KNK A;  3OON A;  1VQN F;  4BT6 A;  3LFO A;  4ZHW A;  3L7Q A;  4LNU B;  1QVF F;  1W5A A;  2HRY A;  3HKE A;  2FC3 A;  4X1K A;  4ZOL A;  1YJN F;  1VQ6 F;  4I55 A;  3BYQ A;  3HKD B;  1NJI H;  1S72 F;  1CN7 A;  2CZW A;  2QTP A;  4RHA A;  2IG8 A;  3RE3 A;  2CWJ A;  4O4I B;  3S0W A;  3HJW C;  5EZY B;  2VAP A;  1X7P A;  5FLX M;  5LP6 A;  3FBA A;  4C82 A;  5IJ0 A;  3Q8H A;  3CB2 A;  3CD6 F;  1VQ5 F;  2IQQ A;  5J2T A;  2I6D A;  5AVM A;  3VYS C;  4X20 B;  3R0P A;  3HTN A;  1U3L A;  3P10 A;  5EIB D;  4EB6 B;  3I56 F;  2AMT A;  1U40 A;  4BVT A;  2AIF A;  5HY2 A;  2HX0 A;  3MQW A;  2FGY A;  2QI2 A;  1J7H A;  1YI2 F;  3CC7 F;  3G71 F;  3LWQ C;  1YGY A;  3VO8 A;  3F6M A;  4ZHV A;  2YYE A;  5LA6 A;  4O4J A;  4B62 A;  5GIN C;  2B33 A;  3N2K B;  5FNV B;  1W59 A;  2HP0 B;  4X1I A;  3I7T A;  2VAM A;  3CYP B;  1TVK A;  3CCU F;  5HY0 A;  3FD5 A;  2VGM A;  4BT5 A;  3TD4 A;  2Z01 A;  3V3T A;  4YJ2 A;  1W5E A;  4BW0 B;  2R75 1;  5KMG A;  1Q82 H;  3LWR C;  5B8F A;  1KC8 H;  4ZI7 A;  1COM A;  4C8I A;  1VQK F;  4IIJ B;  5HXU A;  1RA4 A;  3D01 A;  3P4E A;  3N2G B;  4YJ3 B;  3ZO8 A;  1YIJ F;  4EI7 A;  2OTM A;  2UYN B;  1W41 A;  4FFB B;  1TUB B;  4C81 A;  4TUY A;  4O2B A;  1QD9 A;  1W58 1;  3CCE F;  3C9S A;  4IHJ A;  2ZVY A;  3C9U A;  3P0Z A;  4HNA B;  5GON A;  4O4L A;  3ZP7 A;  5LXT B;  3F0E A;  3VIU A;  1K73 H;  2H8E A;  1W57 A;  5CA0 B;  3SIU A;  1RQ7 A;  4B46 A;  3JAL B;  3HAX D;  2Z1F A;  1IV4 A;  4NQ3 A;  4XCQ A;  3RYH A;  4WBN B;  5KX5 A;  4B45 A;  4C4W C;  1JJ2 F;  5ITZ B;  1YJ9 F;  3D00 A;  4NUT A;  4G4Z A;  1JFF B;  2R6R 1;  4O2A B;  3GTZ A;  1N8R H;  1U3P A;  5HY4 A;  2Z1E A;  5EWR A;  5CB4 A;  2OZB A;  4X1Y B;  1IV1 A;  4TZZ A;  3E22 A;  5IT9 M;  2Z1U A;  4X3M A;  4DRX A;  2VXY A;  3VOA A;  3CCM F;  3PLA C;  5GIO C;  3MBM A;  3CCJ F;  1VK3 A;  3RYI A;  3V7Q A;  5JCO A;  3VTI C;  1FFX B;  1W42 A;  4G88 A;  3JAK B;  1OFU A;  3CPQ A;  5EO3 A;  1X7O A;  2DYY A;  2BTO A;  2RHL A;  3WGL A;  4DXD A;  4B5C A;  5JH7 A;  1GZ0 A;  3JAR B;  1FNJ A;  2RB9 A;  4TV8 A;  2MQE A;  3VYU C;  3JAT A;  5C8Y A;  1RLU A;  1YIT F;  3PAF A;  1VQM F;  1SA0 B;  1ZWZ A;  5EB1 B;  2PMP A;  4TV9 B;  3ESJ A;  4I50 B;  5MN5 A;  3ZP4 A;  1KNJ A;  5CA1 A;  3JAS B;  3J81 M;  3LME A;  3CMA F;  3IR9 A;  4U3J B;  1T0A A;  3HKB B;  2ZAU A;  3CCQ F;  2ZOV A;  3CC2 F;  5HXZ A;  1ODE A;  3CCL F;  2Q1X A;  1RLG A;  3CCS F;  1YHQ F;  1VHA A;  4ZHQ A;  3CME F;  4G4V A;  3JAW A;  1XV2 A;  2I6R A;  3AGK A;  3S0H A;  3NMU C;  3WGN A;  3J80 M;  3JVH A;  3M4S A;  3HKE B;  2HP3 A;  1W5F A;  5A2Q M;  4X1K B;  3IMP A;  1W55 A;  4ZOL B;  2CW4 A;  4I55 B;  2RHO A;  3KIZ A;  3TD5 A;  1W40 A;  3OBW A;  3RYF A;  3WGJ A;  1Q7Y H;  3C9R A;  5GIP C;  5JQG A;  1IV3 A;  1VQV A;  1T0K B;  1X25 A;  3WGM A;  3E20 B;  4G4W A;  3VOB A;  5LP6 B;  4BVR A;  2NMU A;  5IJ0 B;  5LP6 C;  3NK7 A;  4M8I A;  2HQS C;  5J2T B;  1KQS F;  1JN1 A;  5EYP A;  3CG6 A; 
#chains in the Genus database with same CATH homology
 2ALE A;  2OHW A;  2VGN A;  5HWE A;  1CK2 A;  1Q86 H;  3FFM A;  1K73 H;  3CCV F;  1CN7 A;  3SIU A;  2BO1 A;  2LBX A;  3VI6 A;  3OW2 F;  3HAX D;  1VQ9 F;  4NQ3 A;  4XCQ A;  1VQO F;  1NMU B;  4C4W C;  1JJ2 F;  3LWV C;  1YJ9 F;  1VQN F;  3D00 A;  1PXW A;  4NUT A;  2KG4 A;  3LFO A;  1QVF F;  2QEX F;  1W3E X;  2FC3 A;  3NVI B;  1N8R H;  5HY4 A;  3SIV A;  3G4S F;  1YJN F;  3GYQ A;  3V7E A;  1VQ6 F;  1XBI A;  5EWR A;  1Q81 H;  2OZB A;  1NJI H;  1H7M A;  1S72 F;  2CZW A;  1DT9 A;  4TZZ A;  1M1K H;  1QVG F;  4LCK A;  4X3M A;  5IT9 M;  3CCM F;  3PLA C;  5GIO C;  3JAM M;  3HJW C;  3CCJ F;  1X7P A;  3RA5 A;  1GO0 A;  5FLX M;  3V7Q A;  3N4Y A;  2QA4 F;  5G4U C;  1W42 A;  3CC4 F;  3CPQ A;  5EO3 A;  1X7O A;  3CCR F;  3CD6 F;  1VQ5 F;  3OBY A;  2KTU A;  2JNB A;  2I6D A;  1GZ0 A;  2LBW A;  3I56 F;  3J7A R;  4BVQ A;  4BVT A;  2AIF A;  3NVK E;  5HY2 A;  3CPW F;  1YIT F;  2FGY A;  3PAF A;  2QI2 A;  4EI9 A;  1VQM F;  1YI2 F;  3CC7 F;  1ZWZ A;  4EI8 A;  3G71 F;  1E7K A;  2F9Z C;  5DCV A;  3LWQ C;  4BY9 D;  5FJ4 C;  5HY1 A;  5G4V C;  3NK6 A;  1W2B F;  3J81 M;  3CMA F;  3IR9 A;  3RA6 A;  5GAP K;  3CCQ F;  5GIN C;  3CC2 F;  5HXZ A;  3E1Y A;  3CCL F;  1SDS A;  3O85 A;  1VQ7 F;  1RLG A;  4BVS A;  3CCS F;  1YHQ F;  1K8A H;  3CME F;  3CCU F;  3AGK A;  3NMU C;  5HY0 A;  3JCM M;  1GO1 A;  2VGM A;  1VQP F;  3J80 M;  5A2Q M;  3V3T A;  1KD1 H;  2HVY D;  2OTJ F;  1VQ4 F;  2WAL A;  4BW0 B;  3MCA B;  1W40 A;  3OBW A;  1YJW F;  2OTL F;  1IPA A;  3LWR C;  1Q82 H;  1K9M H;  1M90 H;  1Q7Y H;  5GIP C;  1KC8 H;  1VQ8 F;  3VMF B;  1VQK F;  1X52 A;  5HXU A;  1T0K B;  1VQL F;  3E20 B;  1RA4 A;  3I55 F;  3CXC F;  4X3L A;  4BVR A;  3NK7 A;  1YIJ F;  5GAN K;  3WXM B;  4EI7 A;  3G6E F;  2GLZ A;  3ON1 A;  1W41 A;  3N4Z A;  1KQS F;  2KTV A;  3LWP C;  3CCE F;  3CG6 A;  3LWO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...