3N4YA

Crystal structure of wild-type t. celer l30e in low ionic strength condition without precipitant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
VDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L30e
publication title Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values
pubmed doi rcsb
source organism Thermococcus celer
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3n4yA00
2OZBA 2OTJF 1RA4A 5A2QM 3J80M 5GIPC 3VI6A 1VQ4F 4BY9D 2BO1A 1YJNF 1CN7A 1VQ9F 3E1YA 2HVYD 1Q7YH 3I55F 2OTLF 2AIFA 1SDSA 3CC2F 5G4UC 1XBIA 3CMAF 4TZZA 1KQSF 1KD1H 1Q86H 5FLXM 4C4WC 3LWRC 5GAPK 1YHQF 3V7QA 3LFOA 3WXMB 5EO3A 1W41A 1YI2F 2FC3A 2QA4F 3LWOC 3CD6F 3N4ZA 1NJIH 3G6EF 2QEXF 3CCEF 2LBXA 3CCQF 2I6DA 2JNBA 2LBWA 3LWQC 3IR9A 3OBWA 1K9MH 1W40A 1YITF 4NUTA 2VGMA 1N8RH 4X3MA 3CCRF 3OBYA 1KC8H 1DT9A 3N4YA 3OW2F 1X52A 1E7KA 3J7AR 3NVKE 1VQ5F 2ALEA 1VQ6F 1IPAA 3NVIB 5FJ4C 3ON1A 1X7OA 1QVGF 1GZ0A 3CG6A 3CCMF 3GYQA 1S72F 1X7PA 3CCUF 3I56F 1ZWZA 5EWRA 1VQNF 2KTVA 3V7EA 1M1KH 5G4VC 3PLAC 3JCMM 3O85A 5GANK 3G4SF 1NMUB 3AGKA 3CMEF 1PXWA 3NK6A 3G71F 4LCKA 1VQLF 1YIJF 1Q81H 3HAXD 3CCJF 1VQOF 1JJ2F 1YJWF 1H7MA 3CPWF 5GINC 3VMFB 3CPQA 1K73H 3NMUC 1W2BF 1QVFF 3JAMM 3SIUA 3RA6A 3LWPC 3CC7F 1VQPF 1GO1A 3LWVC 2WALA 1VQMF 5DCVA 3E20B 3NK7A 1K8AH 3HJWC 5IT9M 1CK2A 3MCAB 1W3EX 3CXCF 2CZWA 3PAFA 2OHWA 2VGNA 4X3LA 1M90H 3J81M 1VQ8F 1VQKF 3SIVA 1Q82H 2QI2A 1W42A 5GIOC 3CCSF 1VQ7F 3CCLF 3RA5A 2KG4A 3CC4F 1T0KB 1GO0A 3CCVF 3FFMA 4BW0B 1YJ9F 1RLGA 2KTUA
chains in the Genus database with same CATH superfamily
2OTJF 1RA4A 2ZVYA 2AIZP 1JY8A 3HKCB 1ODEA 3ESJA 3CB2A 3ZP4A 1VQ9F 3WJQA 1SA0B 2HRUA 5CA0B 4O4HA 1Q7YH 3ERNA 3WGNA 1DBFA 4FFBB 4BVQA 2FGYA 5LA6A 4IIJA 4TZZA 3CMAF 3TD4A 1Q86H 4ZOLA 4O4JB 4DRXA 1KQSF 3U0OA 4C4WC 5IJ0B 2UYNB 4G4ZA 3RYFA 5EO3A 4B5CA 2FC3A 5LOVB 4F6RA 4EB6A 3K14A 2I6DA 1XV2A 4ZHQB 2BTOA 1TUBA 1U3LA 1VHAA 3HWUA 5IJ9A 3WJRA 5GONB 4M8IA 1PF5A 1YITF 3HTNA 2GZLA 1SZQA 1W5AA 4X3MA 5JQGA 3RYIA 3K12A 4X20B 3CCRF 1DT9A 2CSLA 1JFFA 1KNJA 2F9ZC 2V9YA 3MBMA 5J2TA 1XRGA 3LMEA 1VQ6F 2BTUA 5EB1B 5FJ4C 3ON1A 1X7OA 1QVGF 1GZ0A 3CCMF 5AVMA 2RB9A 1IV1A 2RHLA 3WPXA 5LA6B 4IIJB 1ZWZA 4O4IB 4BT2A 4IHJA 5EZYA 3RYFB 4C8EA 3ELCA 3T80A 5EIBD 4HNAB 2DT4A 3C9SA 3OONA 2CW4A 1PXWA 3S0HA 3F0FA 1VQLF 3VOAA 1VQOF 1TUBB 4RQOA 2RHOA 3VMFB 1J7HA 4X1IA 2IQQA 4ZHVA 1W2BF 2H8CA 3HKEA 5EIBC 3E22A 3JALB 3RYIB 1GO1A 3HKDB 3M1XA 3LWVC 2OTMA 3KJJA 2IG8A 5DCVA 4YJ3A 3I3FA 3E20B 3NK7A 3JAWA 4PWTA 4RHAA 4ZHYB 4C8IA 1K8AH 3HJWC 1YGYA 3MCAB 3IKFA 1W3EX 3CXCF 3PAFA 4ZHWA 4X3LA 3IMPA 3SIVA 1RLUA 2HS3A 3RYCA 5JCOA 5IYZA 5BMVA 3EORA 3JAKA 2AMTA 3JASA 4NWOB 5LP6A 3CCSF 1T0KB 4O2BA 3CCVF 2HP0B 4IHJB 4G4YA 5A2QM 3J80M 5GIPC 3N2KB 1UI9A 3WGLA 4BY9D 3QUWA 2BO1A 5JVDA 3Q8HA 2W8BC 2Z01A 4ZI7A 5JH7A 4TV8B 2YXZA 2AIFA 1SDSA 4U3JA 2UZHA 1FFXA 5KX5B 2ZVZA 5FLXM 3C9UA 3KHNA 3F0EA 3IKEA 3LFOA 3WXMB 2I6RA 3JARA 1YI2F 3CD6F 2IAFA 3N4ZA 4YJ3B 1NJIH 5HXUA 2QEXF 3CCQF 4I4TA 2Z1UA 2LBTA 2LBWA 5EYPA 3OBWA 1K9MH 1R1MA 5IYZB 3JASB 2VGMA 1N8RH 1RQ2A 3VYUC 4EI9A 5MN5A 3VO8A 4B46A 1E7KA 3NVKE 1VQ5F 5J2UA 1W581 4WBNB 4NQ3A 2ZAUA 3NVIB 1VQVA 4G88A 2R751 5C8YB 3I7TA 5ITZA 5LXTB 4ZI7B 4LNUB 3GYQA 2ZODA 3DDNA 5LYJA 4U3JB 1S72F 3CCUF 3TD5A 1TVKB 1VQNF 2KTVA 4BT5A 1M1KH 2G9IA 3JARB 3JCMM 3O85A 1UFYA 5GANK 4U39A 2GVIA 3G4SF 5CB4A 5HP7A 4BT4A 2HP3A 3RE3A 3TD3A 5CA1A 1FSZA 4BT7A 1YIJF 1Q81H 3HAXD 1T0AA 3LYBA 3N2GA 5EYPB 4BVSA 1YJWF 3CPQA 1K73H 1W5BA 1YQNA 3RA6A 4O4HB 4G4WA 1VQPF 3ZO8A 3FD5A 2UYKA 1QAHA 3FD6A 4ZOLB 4DRXB 3HKBA 4BT6A 3BYQA 5IT9M 1IV4A 1QD9A 4X1YA 2VGNA 3J81M 1CLIA 3M4SA 1Q82H 3L7QA 4F6RB 5ITZB 4EB6B 1JN1A 2KG4A 5LYJB 3D01A 1QU9A 4I55A 2ZF8A 3QTYA 4TV9A 1OFUA 4ERHA 3D54A 5IJ9B 3VI6A 1VK3A 4C8GA 1VQ4F 4E6EA 3WGJA 1YJNF 3JATA 5JQGB 1CN7A 2HVYD 1KNKA 4O4LA 1JFFB 3S02A 3I55F 5G4UC 2ZOVA 3UT5A 5J2TB 3S03A 3LWRC 5GAPK 1YHQF 1W41A 3F0GA 3FPIA 1COMA 3HKBB 3K2XA 2RHHA 2B33A 3CCEF 5EZYB 3VCZA 3LWQC 3IR9A 4X1YB 2BTQB 3CYQA 5KMGA 2K1SA 4NUTA 1Q8RA 2Q1YA 3HKCA 3OBYA 1KC8H 5CA0A 3P10A 4O2AA 4X1KA 2QTPA 1NQ3A 2DYYA 4X1IB 1H47A 2VXYA 4FFBA 3J7AR 1W5FA 2CHSA 1U40A 3HKEB 3WGKA 5HY1A 3E22B 3MDOA 3WJPA 1W5EA 2L26A 5IJ0A 2UYNA 2YYEA 3CG6A 4TUYA 3VYSC 3S0YA 3JAWB 3UT5B 3WPWA 5LOVA 1X7PA 3R0PA 5EWRA 3RYCB 3GTZA 5BMVB 5MN4A 3JAKB 4ZHQA 4C81A 2Q1XA 5LP6B 5G4VC 3PLAC 3K0TA 5FNVA 4O2BB 4BVTA 3F0DA 1Z5WA 5GONA 4B62A 3CMEF 1W59A 3NK6A 2GLZA 4X20A 3VIUA 5JVDB 3NMUC 1FNJA 1QVFF 3VTIC 3QHDA 5KMGB 5MN6A 5JH7B 3CC7F 1W55A 3F6MA 3ZOPA 2VAPA 3WGMA 3MQWA 4O2AB 4X1KB 1FFXB 2HQSC 2VAMA 4O4IA 2P6YA 5HY0A 2UYPA 2PHNA 3D00A 2PMPA 4C82A 4TUYB 5GIOC 1VQ7F 2KGWA 3V4DA 4HNAA 1GO0A 3KJKA 4I4TB 3VYTC 3FFMA 4BW0B 1YJ9F 1W57A 2HRYA 2CWJA 4I50A 5HY4A 1JD1A 2OZBA 2CHTA 1OAPA 3CYPB 5FNVB 3E1YA 5HXZA 3LDTA 1VH8A 2Z1FA 3FBAA 3JALA 3CC2F 2OTLF 3C8LA 3HKDA 5J2UB 3RYHA 2UYJA 1XBIA 3GHZA 3S0WA 4BT3A 1KD1H 2EWCA 3V7QA 2Z1TA 1Z5VA 3C9TA 2QA4F 1U43A 3LWOC 3G6EF 3VOBA 2LBXA 4R40B 3C9RA 2JNBA 5JCOC 3IEWA 1IV3A 2HX0A 2CVLA 2HP0A 3KE1A 5LP6C 1W40A 5EAZA 4EI7A 3N2KA 5CB4B 4KWEA 5CA1B 3MCQA 4BVRA 3N4YA 3N2GB 3OW2F 4XCQA 4I50B 3KIZA 4TV8A 1GX1A 4YJ2A 1X52A 5HWEA 1IV2A 2ALEA 2LCAA 1IPAA 5KX5A 3S06A 2MQEA 4G4XA 3ZP7A 3RYHB 3I56F 4G4VA 1XHOA 3DC2A 3V7EA 3IEQA 3P0ZA 3V3TA 4DXDA 4EI8A 4I55B 1SA0A 1NMUB 3AGKA 4TV9B 2RHJA 3G71F 5HP8A 2VAWA 2HS0A 4LCKA 2HS4A 1RQ7A 2R6R1 3CCJF 1JJ2F 1H48A 1H7MA 3CPWF 5GINC 3JATB 4O4JA 3JAMM 3SIUA 4WBNA 3JVHA 3P4EA 3LWPC 2H6LA 4O4LB 5EB0A 2WALA 5C8YA 1VQMF 5B8FA 5LXTA 4LNUA 2H8EA 4YJ2B 2NMUA 1FNKA 1CK2A 2CZWA 2OHWA 1ONIA 1M90H 1TVKA 1U3PA 1X25A 1VQ8F 1VQKF 2Z1EA 2QI2A 3B6NA 5HY2A 1W42A 3CCLF 3RA5A 2N48A 3CC4F 4B45A 1RLGA 2KTUA 4ZK7A 3M84A
chains in the Genus database with same CATH topology
5HY4A 2OZBA 2OTJF 1RA4A 5A2QM 3J80M 5GIPC 3VI6A 1VQ4F 4BY9D 2BO1A 1YJNF 1CN7A 1VQ9F 3E1YA 5HXZA 2HVYD 1Q7YH 3I55F 2OTLF 2AIFA 1SDSA 3CC2F 5G4UC 4BVQA 2FGYA 1XBIA 3CMAF 4TZZA 1KQSF 1KD1H 1Q86H 5FLXM 4C4WC 3LWRC 5GAPK 1YHQF 3V7QA 3LFOA 3WXMB 5EO3A 1W41A 1YI2F 2FC3A 2QA4F 3LWOC 3CD6F 3N4ZA 1NJIH 5HXUA 3G6EF 2QEXF 3CCEF 2LBXA 3CCQF 2I6DA 2JNBA 2LBWA 3LWQC 3IR9A 3OBWA 1K9MH 1W40A 4EI7A 1YITF 4NUTA 2VGMA 1N8RH 4X3MA 4BVRA 3CCRF 3OBYA 1KC8H 4EI9A 1DT9A 3N4YA 3OW2F 4XCQA 2F9ZC 1X52A 5HWEA 1E7KA 3J7AR 3NVKE 1VQ5F 5HY1A 2ALEA 1VQ6F 4NQ3A 1IPAA 3NVIB 5FJ4C 3ON1A 1X7OA 1QVGF 1GZ0A 3CG6A 3CCMF 3GYQA 1S72F 1X7PA 3CCUF 3I56F 1ZWZA 5EWRA 1VQNF 2KTVA 3V7EA 3V3TA 1M1KH 5G4VC 3PLAC 3JCMM 3O85A 4EI8A 5GANK 4BVTA 3G4SF 1NMUB 3AGKA 3CMEF 1PXWA 3NK6A 3G71F 4LCKA 1VQLF 2GLZA 1YIJF 1Q81H 3HAXD 3CCJF 1VQOF 4BVSA 1JJ2F 1YJWF 1H7MA 3CPWF 5GINC 3VMFB 3CPQA 1K73H 3NMUC 1W2BF 1QVFF 3JAMM 3SIUA 3RA6A 3LWPC 3CC7F 1VQPF 1GO1A 3LWVC 2WALA 1VQMF 5DCVA 3E20B 3NK7A 1K8AH 3HJWC 5IT9M 1CK2A 3MCAB 1W3EX 3CXCF 2CZWA 3PAFA 2OHWA 2VGNA 4X3LA 5HY0A 3J81M 1M90H 1VQ8F 1VQKF 1Q82H 3SIVA 3D00A 2QI2A 5HY2A 1W42A 5GIOC 3CCSF 1VQ7F 3CCLF 3RA5A 2KG4A 3CC4F 1T0KB 1GO0A 3CCVF 3FFMA 4BW0B 1YJ9F 1RLGA 2KTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZB A;  2OTJ F;  1RA4 A;  5A2Q M;  3J80 M;  5GIP C;  3VI6 A;  1VQ4 F;  4BY9 D;  2BO1 A;  1YJN F;  1CN7 A;  1VQ9 F;  3E1Y A;  2HVY D;  1Q7Y H;  3I55 F;  2OTL F;  2AIF A;  1SDS A;  3CC2 F;  5G4U C;  1XBI A;  3CMA F;  4TZZ A;  1KQS F;  1KD1 H;  1Q86 H;  5FLX M;  4C4W C;  3LWR C;  5GAP K;  1YHQ F;  3V7Q A;  3LFO A;  3WXM B;  5EO3 A;  1W41 A;  1YI2 F;  2FC3 A;  2QA4 F;  3LWO C;  3CD6 F;  3N4Z A;  1NJI H;  3G6E F;  2QEX F;  3CCE F;  2LBX A;  3CCQ F;  2I6D A;  2JNB A;  2LBW A;  3LWQ C;  3IR9 A;  3OBW A;  1K9M H;  1W40 A;  1YIT F;  4NUT A;  2VGM A;  1N8R H;  4X3M A;  3CCR F;  3OBY A;  1KC8 H;  1DT9 A;  3N4Y A;  3OW2 F;  1X52 A;  1E7K A;  3J7A R;  3NVK E;  1VQ5 F;  2ALE A;  1VQ6 F;  1IPA A;  3NVI B;  5FJ4 C;  3ON1 A;  1X7O A;  1QVG F;  1GZ0 A;  3CG6 A;  3CCM F;  3GYQ A;  1S72 F;  1X7P A;  3CCU F;  3I56 F;  1ZWZ A;  5EWR A;  1VQN F;  2KTV A;  3V7E A;  1M1K H;  5G4V C;  3PLA C;  3JCM M;  3O85 A;  5GAN K;  3G4S F;  1NMU B;  3AGK A;  3CME F;  1PXW A;  3NK6 A;  3G71 F;  4LCK A;  1VQL F;  1YIJ F;  1Q81 H;  3HAX D;  3CCJ F;  1VQO F;  1JJ2 F;  1YJW F;  1H7M A;  3CPW F;  5GIN C;  3VMF B;  3CPQ A;  1K73 H;  3NMU C;  1W2B F;  1QVF F;  3JAM M;  3SIU A;  3RA6 A;  3LWP C;  3CC7 F;  1VQP F;  1GO1 A;  3LWV C;  2WAL A;  1VQM F;  5DCV A;  3E20 B;  3NK7 A;  1K8A H;  3HJW C;  5IT9 M;  1CK2 A;  3MCA B;  1W3E X;  3CXC F;  2CZW A;  3PAF A;  2OHW A;  2VGN A;  4X3L A;  1M90 H;  3J81 M;  1VQ8 F;  1VQK F;  3SIV A;  1Q82 H;  2QI2 A;  1W42 A;  5GIO C;  3CCS F;  1VQ7 F;  3CCL F;  3RA5 A;  2KG4 A;  3CC4 F;  1T0K B;  1GO0 A;  3CCV F;  3FFM A;  4BW0 B;  1YJ9 F;  1RLG A;  2KTU A; 
#chains in the Genus database with same CATH topology
 2OTJ F;  1RA4 A;  2ZVY A;  2AIZ P;  1JY8 A;  3HKC B;  1ODE A;  3ESJ A;  3CB2 A;  3ZP4 A;  1VQ9 F;  3WJQ A;  1SA0 B;  2HRU A;  5CA0 B;  4O4H A;  1Q7Y H;  3ERN A;  3WGN A;  1DBF A;  4FFB B;  4BVQ A;  2FGY A;  5LA6 A;  4IIJ A;  4TZZ A;  3CMA F;  3TD4 A;  1Q86 H;  4ZOL A;  4O4J B;  4DRX A;  1KQS F;  3U0O A;  4C4W C;  5IJ0 B;  2UYN B;  4G4Z A;  3RYF A;  5EO3 A;  4B5C A;  2FC3 A;  5LOV B;  4F6R A;  4EB6 A;  3K14 A;  2I6D A;  1XV2 A;  4ZHQ B;  2BTO A;  1TUB A;  1U3L A;  1VHA A;  3HWU A;  5IJ9 A;  3WJR A;  5GON B;  4M8I A;  1PF5 A;  1YIT F;  3HTN A;  2GZL A;  1SZQ A;  1W5A A;  4X3M A;  5JQG A;  3RYI A;  3K12 A;  4X20 B;  3CCR F;  1DT9 A;  2CSL A;  1JFF A;  1KNJ A;  2F9Z C;  2V9Y A;  3MBM A;  5J2T A;  1XRG A;  3LME A;  1VQ6 F;  2BTU A;  5EB1 B;  5FJ4 C;  3ON1 A;  1X7O A;  1QVG F;  1GZ0 A;  3CCM F;  5AVM A;  2RB9 A;  1IV1 A;  2RHL A;  3WPX A;  5LA6 B;  4IIJ B;  1ZWZ A;  4O4I B;  4BT2 A;  4IHJ A;  5EZY A;  3RYF B;  4C8E A;  3ELC A;  3T80 A;  5EIB D;  4HNA B;  2DT4 A;  3C9S A;  3OON A;  2CW4 A;  1PXW A;  3S0H A;  3F0F A;  1VQL F;  3VOA A;  1VQO F;  1TUB B;  4RQO A;  2RHO A;  3VMF B;  1J7H A;  4X1I A;  2IQQ A;  4ZHV A;  1W2B F;  2H8C A;  3HKE A;  5EIB C;  3E22 A;  3JAL B;  3RYI B;  1GO1 A;  3HKD B;  3M1X A;  3LWV C;  2OTM A;  3KJJ A;  2IG8 A;  5DCV A;  4YJ3 A;  3I3F A;  3E20 B;  3NK7 A;  3JAW A;  4PWT A;  4RHA A;  4ZHY B;  4C8I A;  1K8A H;  3HJW C;  1YGY A;  3MCA B;  3IKF A;  1W3E X;  3CXC F;  3PAF A;  4ZHW A;  4X3L A;  3IMP A;  3SIV A;  1RLU A;  2HS3 A;  3RYC A;  5JCO A;  5IYZ A;  5BMV A;  3EOR A;  3JAK A;  2AMT A;  3JAS A;  4NWO B;  5LP6 A;  3CCS F;  1T0K B;  4O2B A;  3CCV F;  2HP0 B;  4IHJ B;  4G4Y A;  5A2Q M;  3J80 M;  5GIP C;  3N2K B;  1UI9 A;  3WGL A;  4BY9 D;  3QUW A;  2BO1 A;  5JVD A;  3Q8H A;  2W8B C;  2Z01 A;  4ZI7 A;  5JH7 A;  4TV8 B;  2YXZ A;  2AIF A;  1SDS A;  4U3J A;  2UZH A;  1FFX A;  5KX5 B;  2ZVZ A;  5FLX M;  3C9U A;  3KHN A;  3F0E A;  3IKE A;  3LFO A;  3WXM B;  2I6R A;  3JAR A;  1YI2 F;  3CD6 F;  2IAF A;  3N4Z A;  4YJ3 B;  1NJI H;  5HXU A;  2QEX F;  3CCQ F;  4I4T A;  2Z1U A;  2LBT A;  2LBW A;  5EYP A;  3OBW A;  1K9M H;  1R1M A;  5IYZ B;  3JAS B;  2VGM A;  1N8R H;  1RQ2 A;  3VYU C;  4EI9 A;  5MN5 A;  3VO8 A;  4B46 A;  1E7K A;  3NVK E;  1VQ5 F;  5J2U A;  1W58 1;  4WBN B;  4NQ3 A;  2ZAU A;  3NVI B;  1VQV A;  4G88 A;  2R75 1;  5C8Y B;  3I7T A;  5ITZ A;  5LXT B;  4ZI7 B;  4LNU B;  3GYQ A;  2ZOD A;  3DDN A;  5LYJ A;  4U3J B;  1S72 F;  3CCU F;  3TD5 A;  1TVK B;  1VQN F;  2KTV A;  4BT5 A;  1M1K H;  2G9I A;  3JAR B;  3JCM M;  3O85 A;  1UFY A;  5GAN K;  4U39 A;  2GVI A;  3G4S F;  5CB4 A;  5HP7 A;  4BT4 A;  2HP3 A;  3RE3 A;  3TD3 A;  5CA1 A;  1FSZ A;  4BT7 A;  1YIJ F;  1Q81 H;  3HAX D;  1T0A A;  3LYB A;  3N2G A;  5EYP B;  4BVS A;  1YJW F;  3CPQ A;  1K73 H;  1W5B A;  1YQN A;  3RA6 A;  4O4H B;  4G4W A;  1VQP F;  3ZO8 A;  3FD5 A;  2UYK A;  1QAH A;  3FD6 A;  4ZOL B;  4DRX B;  3HKB A;  4BT6 A;  3BYQ A;  5IT9 M;  1IV4 A;  1QD9 A;  4X1Y A;  2VGN A;  3J81 M;  1CLI A;  3M4S A;  1Q82 H;  3L7Q A;  4F6R B;  5ITZ B;  4EB6 B;  1JN1 A;  2KG4 A;  5LYJ B;  3D01 A;  1QU9 A;  4I55 A;  2ZF8 A;  3QTY A;  4TV9 A;  1OFU A;  4ERH A;  3D54 A;  5IJ9 B;  3VI6 A;  1VK3 A;  4C8G A;  1VQ4 F;  4E6E A;  3WGJ A;  1YJN F;  3JAT A;  5JQG B;  1CN7 A;  2HVY D;  1KNK A;  4O4L A;  1JFF B;  3S02 A;  3I55 F;  5G4U C;  2ZOV A;  3UT5 A;  5J2T B;  3S03 A;  3LWR C;  5GAP K;  1YHQ F;  1W41 A;  3F0G A;  3FPI A;  1COM A;  3HKB B;  3K2X A;  2RHH A;  2B33 A;  3CCE F;  5EZY B;  3VCZ A;  3LWQ C;  3IR9 A;  4X1Y B;  2BTQ B;  3CYQ A;  5KMG A;  2K1S A;  4NUT A;  1Q8R A;  2Q1Y A;  3HKC A;  3OBY A;  1KC8 H;  5CA0 A;  3P10 A;  4O2A A;  4X1K A;  2QTP A;  1NQ3 A;  2DYY A;  4X1I B;  1H47 A;  2VXY A;  4FFB A;  3J7A R;  1W5F A;  2CHS A;  1U40 A;  3HKE B;  3WGK A;  5HY1 A;  3E22 B;  3MDO A;  3WJP A;  1W5E A;  2L26 A;  5IJ0 A;  2UYN A;  2YYE A;  3CG6 A;  4TUY A;  3VYS C;  3S0Y A;  3JAW B;  3UT5 B;  3WPW A;  5LOV A;  1X7P A;  3R0P A;  5EWR A;  3RYC B;  3GTZ A;  5BMV B;  5MN4 A;  3JAK B;  4ZHQ A;  4C81 A;  2Q1X A;  5LP6 B;  5G4V C;  3PLA C;  3K0T A;  5FNV A;  4O2B B;  4BVT A;  3F0D A;  1Z5W A;  5GON A;  4B62 A;  3CME F;  1W59 A;  3NK6 A;  2GLZ A;  4X20 A;  3VIU A;  5JVD B;  3NMU C;  1FNJ A;  1QVF F;  3VTI C;  3QHD A;  5KMG B;  5MN6 A;  5JH7 B;  3CC7 F;  1W55 A;  3F6M A;  3ZOP A;  2VAP A;  3WGM A;  3MQW A;  4O2A B;  4X1K B;  1FFX B;  2HQS C;  2VAM A;  4O4I A;  2P6Y A;  5HY0 A;  2UYP A;  2PHN A;  3D00 A;  2PMP A;  4C82 A;  4TUY B;  5GIO C;  1VQ7 F;  2KGW A;  3V4D A;  4HNA A;  1GO0 A;  3KJK A;  4I4T B;  3VYT C;  3FFM A;  4BW0 B;  1YJ9 F;  1W57 A;  2HRY A;  2CWJ A;  4I50 A;  5HY4 A;  1JD1 A;  2OZB A;  2CHT A;  1OAP A;  3CYP B;  5FNV B;  3E1Y A;  5HXZ A;  3LDT A;  1VH8 A;  2Z1F A;  3FBA A;  3JAL A;  3CC2 F;  2OTL F;  3C8L A;  3HKD A;  5J2U B;  3RYH A;  2UYJ A;  1XBI A;  3GHZ A;  3S0W A;  4BT3 A;  1KD1 H;  2EWC A;  3V7Q A;  2Z1T A;  1Z5V A;  3C9T A;  2QA4 F;  1U43 A;  3LWO C;  3G6E F;  3VOB A;  2LBX A;  4R40 B;  3C9R A;  2JNB A;  5JCO C;  3IEW A;  1IV3 A;  2HX0 A;  2CVL A;  2HP0 A;  3KE1 A;  5LP6 C;  1W40 A;  5EAZ A;  4EI7 A;  3N2K A;  5CB4 B;  4KWE A;  5CA1 B;  3MCQ A;  4BVR A;  3N4Y A;  3N2G B;  3OW2 F;  4XCQ A;  4I50 B;  3KIZ A;  4TV8 A;  1GX1 A;  4YJ2 A;  1X52 A;  5HWE A;  1IV2 A;  2ALE A;  2LCA A;  1IPA A;  5KX5 A;  3S06 A;  2MQE A;  4G4X A;  3ZP7 A;  3RYH B;  3I56 F;  4G4V A;  1XHO A;  3DC2 A;  3V7E A;  3IEQ A;  3P0Z A;  3V3T A;  4DXD A;  4EI8 A;  4I55 B;  1SA0 A;  1NMU B;  3AGK A;  4TV9 B;  2RHJ A;  3G71 F;  5HP8 A;  2VAW A;  2HS0 A;  4LCK A;  2HS4 A;  1RQ7 A;  2R6R 1;  3CCJ F;  1JJ2 F;  1H48 A;  1H7M A;  3CPW F;  5GIN C;  3JAT B;  4O4J A;  3JAM M;  3SIU A;  4WBN A;  3JVH A;  3P4E A;  3LWP C;  2H6L A;  4O4L B;  5EB0 A;  2WAL A;  5C8Y A;  1VQM F;  5B8F A;  5LXT A;  4LNU A;  2H8E A;  4YJ2 B;  2NMU A;  1FNK A;  1CK2 A;  2CZW A;  2OHW A;  1ONI A;  1M90 H;  1TVK A;  1U3P A;  1X25 A;  1VQ8 F;  1VQK F;  2Z1E A;  2QI2 A;  3B6N A;  5HY2 A;  1W42 A;  3CCL F;  3RA5 A;  2N48 A;  3CC4 F;  4B45 A;  1RLG A;  2KTU A;  4ZK7 A;  3M84 A; 
#chains in the Genus database with same CATH homology
 5HY4 A;  2OZB A;  2OTJ F;  1RA4 A;  5A2Q M;  3J80 M;  5GIP C;  3VI6 A;  1VQ4 F;  4BY9 D;  2BO1 A;  1YJN F;  1CN7 A;  1VQ9 F;  3E1Y A;  5HXZ A;  2HVY D;  1Q7Y H;  3I55 F;  2OTL F;  2AIF A;  1SDS A;  3CC2 F;  5G4U C;  4BVQ A;  2FGY A;  1XBI A;  3CMA F;  4TZZ A;  1KQS F;  1KD1 H;  1Q86 H;  5FLX M;  4C4W C;  3LWR C;  5GAP K;  1YHQ F;  3V7Q A;  3LFO A;  3WXM B;  5EO3 A;  1W41 A;  1YI2 F;  2FC3 A;  2QA4 F;  3LWO C;  3CD6 F;  3N4Z A;  1NJI H;  5HXU A;  3G6E F;  2QEX F;  3CCE F;  2LBX A;  3CCQ F;  2I6D A;  2JNB A;  2LBW A;  3LWQ C;  3IR9 A;  3OBW A;  1K9M H;  1W40 A;  4EI7 A;  1YIT F;  4NUT A;  2VGM A;  1N8R H;  4X3M A;  4BVR A;  3CCR F;  3OBY A;  1KC8 H;  4EI9 A;  1DT9 A;  3N4Y A;  3OW2 F;  4XCQ A;  2F9Z C;  1X52 A;  5HWE A;  1E7K A;  3J7A R;  3NVK E;  1VQ5 F;  5HY1 A;  2ALE A;  1VQ6 F;  4NQ3 A;  1IPA A;  3NVI B;  5FJ4 C;  3ON1 A;  1X7O A;  1QVG F;  1GZ0 A;  3CG6 A;  3CCM F;  3GYQ A;  1S72 F;  1X7P A;  3CCU F;  3I56 F;  1ZWZ A;  5EWR A;  1VQN F;  2KTV A;  3V7E A;  3V3T A;  1M1K H;  5G4V C;  3PLA C;  3JCM M;  3O85 A;  4EI8 A;  5GAN K;  4BVT A;  3G4S F;  1NMU B;  3AGK A;  3CME F;  1PXW A;  3NK6 A;  3G71 F;  4LCK A;  1VQL F;  2GLZ A;  1YIJ F;  1Q81 H;  3HAX D;  3CCJ F;  1VQO F;  4BVS A;  1JJ2 F;  1YJW F;  1H7M A;  3CPW F;  5GIN C;  3VMF B;  3CPQ A;  1K73 H;  3NMU C;  1W2B F;  1QVF F;  3JAM M;  3SIU A;  3RA6 A;  3LWP C;  3CC7 F;  1VQP F;  1GO1 A;  3LWV C;  2WAL A;  1VQM F;  5DCV A;  3E20 B;  3NK7 A;  1K8A H;  3HJW C;  5IT9 M;  1CK2 A;  3MCA B;  1W3E X;  3CXC F;  2CZW A;  3PAF A;  2OHW A;  2VGN A;  4X3L A;  5HY0 A;  3J81 M;  1M90 H;  1VQ8 F;  1VQK F;  1Q82 H;  3SIV A;  3D00 A;  2QI2 A;  5HY2 A;  1W42 A;  5GIO C;  3CCS F;  1VQ7 F;  3CCL F;  3RA5 A;  2KG4 A;  3CC4 F;  1T0K B;  1GO0 A;  3CCV F;  3FFM A;  4BW0 B;  1YJ9 F;  1RLG A;  2KTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...