3N4YA

Crystal structure of wild-type t. celer l30e in low ionic strength condition without precipitant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
VDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3n4yA00
1YJ9F 1K8AH 3GYQA 3E1YA 1ZWZA 4BY9D 3SIUA 3J81M 4BW0B 2FC3A 3G4SF 1KQSF 3CCLF 5GINC 3NVKE 3O85A 1VQ7F 2VGMA 3CC2F 1NJIH 5EWRA 3RA6A 1VQMF 5G4VC 4X3LA 3LWPC 5A2QM 4C4WC 2QI2A 1X7PA 1X7OA 3HAXD 2AIFA 3CC7F 1VQLF 3CPQA 1VQNF 5IT9M 3CPWF 1VQ5F 3LWOC 3CCEF 3N4ZA 5EO3A 1VQPF 3OW2F 3NK7A 3RA5A 3CCSF 1YITF 1Q81H 1E7KA 3NK6A 1YIJF 1Q82H 3NVIB 1SDSA 3G6EF 3AGKA 4X3MA 1XBIA 3CG6A 3J80M 3CCUF 3OBYA 1GZ0A 3CD6F 1W2BF 1GO0A 1W40A 3CC4F 1DT9A 2I6DA 3HJWC 1YJNF 2LBWA 2HVYD 3CXCF 1Q7YH 1X52A 2KTVA 1QVFF 1CN7A 2KTUA 5GIPC 1JJ2F 5G4UC 2QA4F 1KC8H 3SIVA 1PXWA 1M1KH 3J7AR 1IPAA 1YJWF 3LWVC 1KD1H 4TZZA 1YHQF 3CCMF 3N4YA 1VQOF 3CCQF 1S72F 3V7EA 2ALEA 1W3EX 5GAPK 1NMUB 1M90H 5DCVA 3V7QA 1VQ9F 2QEXF 2WALA 3PAFA 1VQKF 3FFMA 3E20B 3OBWA 2LBXA 3IR9A 5FJ4C 3LWRC 5GIOC 1K73H 3LWQC 1Q86H 5FLXM 1YI2F 3CMAF 1VQ6F 1VQ8F 1N8RH 1GO1A 2OHWA 1W42A 3VI6A 1T0KB 3WXMB 1RLGA 4LCKA 3LFOA 1H7MA 2CZWA 2KG4A 3G71F 3CMEF 3CCRF 3JAMM 1QVGF 4NUTA 1W41A 3NMUC 3CCJF 2OTLF 2BO1A 1CK2A 3CCVF 3PLAC 3VMFB 3ON1A 2OTJF 3MCAB 3JCMM 3I56F 1RA4A 5GANK 2JNBA 1VQ4F 2OZBA 2VGNA 3I55F 1K9MH
chains in the Genus database with same CATH superfamily
3HKEB 2CSLA 5LOVA 1YJ9F 3E1YA 2Z1UA 3SIUA 4DRXB 1GX1A 2UYNB 2FC3A 1H47A 4BW0B 3UT5B 5GINC 3NVKE 3CYPB 2RHLA 2ZVYA 2HX0A 2VGMA 1NJIH 1KNKA 3RYIB 4ZOLB 2ZVZA 5G4VC 5LA6A 2Z1FA 4X3LA 3VTIC 3F0GA 4EI9A 5MN5A 2HS4A 4U3JB 2H6LA 2CVLA 4LNUB 4RQOA 3CPWF 2NMUA 3LWOC 3CCEF 1YITF 3WGMA 3IEWA 2UYJA 3S03A 5CB4B 3OW2F 1JFFB 3HKEA 2HQSC 2Q1YA 3EORA 1OFUA 4G4ZA 1YIJF 1W5EA 5JH7A 2RB9A 1W5FA 3JALB 5HP7A 4DRXA 2UYNA 3QUWA 1GZ0A 4TUYB 5HXUA 3N2KB 3UT5A 4WBNA 1DT9A 4TV8A 4F6RB 5JQGA 1YJNF 5IJ9A 3RYIA 4ZOLA 3HWUA 3B6NA 3C9SA 3MCQA 1JN1A 3QTYA 3KE1A 3VYSC 2QA4F 1VQVA 3SIVA 1OAPA 5J2TB 2N48A 4BT5A 3KJKA 4TZZA 5EYPB 1JFFA 1VQOF 5B8FA 3E22A 3CCQF 1FNKA 1W3EX 5GAPK 2RHOA 1NMUB 5HY0A 1M90H 1IV2A 3N2GB 3N2KA 3MQWA 3K12A 3FFMA 4C81A 3E20B 2BTUA 3WPWA 5LYJA 3IR9A 3GTZA 1K73H 3OONA 2ZODA 3GHZA 3F6MA 1YI2F 3KIZA 1VQ8F 2OHWA 3WXMB 2ZAUA 2I6RA 3JASB 2PMPA 2KG4A 3K2XA 5J2TA 3RYCB 3JAMM 5EYPA 5KX5B 4IIJB 2OTLF 4O2AA 4IHJA 5KMGB 3CCVF 4O4LA 4C8EA 3C8LA 2IG8A 2VAPA 3MCAB 1QU9A 1VH8A 4PWTA 4BVSA 3JCMM 5CA1A 3JAKB 3N2GA 2VXYA 4U39A 1K8AH 3WGJA 5HP8A 1W5BA 1U40A 4BY9D 3G4SF 2YXZA 2ZOVA 3KJJA 2G9IA 1IV3A 5J2UB 3CC2F 3DDNA 5EWRA 3RYCA 5EZYB 1VQMF 5HY2A 5KX5A 3JATA 5HXZA 5KMGA 3F0DA 3JARB 1IV1A 4C4WC 3F0FA 4O4HB 2AIFA 4ERHA 1FSZA 3VOAA 3HKBB 4YJ3B 5BMVB 3N4ZA 5EO3A 4BT2A 1W57A 5EB1B 5C8YA 2BTOA 2GLZA 3NK6A 1TUBB 2BTQB 2H8CA 3AGKA 1SZQA 4X3MA 5IYZB 1H48A 4XCQA 3J80M 3CCUF 4G4WA 4BVTA 1W2BF 3CD6F 1W40A 2HRYA 1GO0A 2UYPA 1YQNA 4KWEA 2EWCA 1W5AA 4BVQA 4ZI7B 2HRUA 5EZYA 5ITZA 2HVYD 4BT4A 2HS0A 2HS3A 5HY4A 3JARA 4B46A 4O4HA 1PXWA 3RYHB 1IPAA 4X1YA 4YJ3A 2V9YA 5BMVA 4O4JB 3S0WA 3N4YA 5EIBC 1PF5A 2FGYA 5GONB 3K14A 1NQ3A 2QEXF 3PAFA 3D01A 1VQKF 3OBWA 1JY8A 4ZI7A 3LWRC 5GIOC 5FJ4C 5EAZA 4TV9B 3LDTA 1UI9A 3M4SA 3KHNA 3RYFB 3LWQC 3CMAF 5LXTB 3ZOPA 3V3TA 1N8RH 4U3JA 1J7HA 1XHOA 3ELCA 2B33A 4LNUA 1H7MA 3RYHA 3CB2A 1IV4A 3FD6A 4FFBB 5CB4A 3G71F 3HKCB 3WJPA 1QVGF 4R40B 3JAWB 3S02A 1QAHA 2BO1A 1CK2A 4E6EA 3VMFB 4NQ3A 3JALA 4X1IB 4TUYA 4YJ2B 2Z1EA 5GANK 4BT7A 4F6RA 2VGNA 5JVDB 3L7QA 3NMUC 1K9MH 4O4IB 4X1KB 4TV9A 5EIBD 3RYFA 3VYUC 2K1SA 1FNJA 5LXTA 3R0PA 3RE3A 3S06A 4X20B 1KQSF 1VQ7F 3WJQA 4FFBA 3HKCA 3D54A 2OTMA 5JCOA 1RLUA 2Z01A 1R1MA 2IAFA 1X25A 4C82A 5A2QM 2DYYA 2AIZP 1DBFA 3TD3A 3HAXD 3FD5A 4BVRA 1VHAA 3T80A 2KGWA 5IT9M 1Z5WA 1Z5VA 1VQ5F 1JD1A 1SA0B 5JVDA 1VQPF 3WPXA 3RA5A 1Q81H 4O4IA 2MQEA 4G4YA 2DT4A 1U3PA 4X1KA 2F9ZC 2RHJA 3NVIB 5CA0B 1XBIA 3CG6A 3JASA 1W581 3OBYA 4I4TB 3ZO8A 1Q8RA 3JVHA 3S0HA 3FPIA 2UZHA 2I6DA 3HJWC 4IIJA 2LBWA 4ZHQB 5LOVB 3VOBA 3CXCF 1Q7YH 1X52A 1CN7A 4I50B 2KTUA 5GIPC 1KC8H 3JAKA 3VCZA 1M1KH 1COMA 1W59A 3LWVC 1KD1H 1SA0A 1TVKB 3F0EA 2GZLA 1S72F 3V7EA 2ALEA 5EB0A 2VAWA 3MDOA 5LA6B 2W8BC 2IQQA 2ZF8A 3P0ZA 5CA0A 3IEQA 4DXDA 3V7QA 5DCVA 2CWJA 3IMPA 5J2UA 4I4TA 5JCOC 4EB6B 4ZHQA 2LBTA 3Q8HA 1VQ6F 3P10A 1GO1A 3HTNA 3LYBA 3VI6A 4I50A 5JH7B 1T0KB 4LCKA 3HKBA 3LFOA 4G4XA 1QD9A 4G88A 3V4DA 4EI8A 5AVMA 4WBNB 3VYTC 4TV8B 5JQGB 4B62A 1W41A 1TVKA 1TUBA 5HWEA 3IKEA 4HNAB 5IJ9B 5IYZA 4ZK7A 2OTJF 3BYQA 5FNVB 4BT6A 2JNBA 1RQ2A 1W55A 5LP6B 1XV2A 2PHNA 1XRGA 3M84A 4NWOB 3VIUA 4C8GA 4EB6A 3GYQA 3ESJA 3ZP7A 3E22B 1ZWZA 3J81M 1FFXB 2Z1TA 1RQ7A 3ZP4A 3CCLF 4B45A 3O85A 4O4JA 2QTPA 1ODEA 3K0TA 3MBMA 3IKFA 3RA6A 3WJRA 5LYJB 5MN6A 3C9UA 5GONA 4HNAA 3S0YA 3LWPC 3FBAA 2QI2A 1X7PA 1X7OA 3LMEA 5FNVA 3C9RA 3CC7F 1VQLF 3CPQA 1VQNF 5LP6A 2H8EA 3NK7A 3CCSF 1E7KA 3CYQA 1CLIA 1Q82H 2CW4A 2UYKA 3QHDA 3G6EF 1SDSA 4O2AB 3ERNA 3I3FA 4IHJB 4O4LB 1FFXA 1ONIA 1YGYA 3HKDB 3CC4F 5CA1B 2AMTA 3P4EA 3D00A 2LCAA 2R6R1 3JAWA 3WGKA 4G4VA 4ZHWA 2RHHA 2KTVA 1QVFF 2CHSA 2HP0B 4X1IA 4C8IA 4YJ2A 2L26A 3M1XA 5G4UC 1JJ2F 4EI7A 3J7AR 2P6YA 1YJWF 3C9TA 1YHQF 3CCMF 4I55B 4O2BB 4RHAA 2YYEA 2CHTA 3JATB 1U43A 2R751 2VAMA 1KNJA 4X20A 2Q1XA 1T0AA 1VQ9F 2WALA 3HKDA 3I7TA 5IJ0B 2LBXA 1VK3A 4ZHYB 3TD5A 3VO8A 3TD4A 5C8YB 1Q86H 5FLXM 2GVIA 4ZHVA 3U0OA 1W42A 2HP0A 1RLGA 5LP6C 5HY1A 3DC2A 2HP3A 1UFYA 1U3LA 2CZWA 4BT3A 3CMEF 3WGLA 3CCRF 4B5CA 4NUTA 4M8IA 3WGNA 3CCJF 4I55A 5ITZB 4O2BA 3PLAC 3ON1A 5MN4A 3I56F 1RA4A 1VQ4F 2OZBA 3I55F 5IJ0A 4X1YB
chains in the Genus database with same CATH topology
1YJ9F 1K8AH 3GYQA 3E1YA 1ZWZA 4BY9D 3SIUA 3J81M 4BW0B 2FC3A 3G4SF 1KQSF 3CCLF 5GINC 3NVKE 3O85A 1VQ7F 2VGMA 3CC2F 1NJIH 5EWRA 3RA6A 1VQMF 5HY2A 5G4VC 5HXZA 4X3LA 3LWPC 4EI9A 5A2QM 2QI2A 1X7PA 1X7OA 3HAXD 4C4WC 2AIFA 4BVRA 3CC7F 1VQLF 3CPQA 1VQNF 5IT9M 3CPWF 1VQ5F 3LWOC 3CCEF 3N4ZA 5EO3A 1VQPF 3OW2F 3NK7A 3RA5A 3CCSF 1YITF 1Q81H 1E7KA 3NK6A 2GLZA 2F9ZC 1YIJF 1Q82H 3NVIB 1SDSA 3G6EF 3AGKA 4X3MA 4XCQA 1XBIA 3CG6A 3J80M 3CCUF 3OBYA 5HXUA 1GZ0A 3CD6F 4BVTA 1W2BF 1GO0A 1W40A 3CC4F 1DT9A 3D00A 4BVQA 2I6DA 3HJWC 1YJNF 2LBWA 2HVYD 3CXCF 1Q7YH 1X52A 2KTVA 1QVFF 5HY4A 1CN7A 2KTUA 5GIPC 1JJ2F 5G4UC 2QA4F 1KC8H 3SIVA 4EI7A 1PXWA 1M1KH 3J7AR 1IPAA 1YJWF 3LWVC 1KD1H 4TZZA 1YHQF 3CCMF 3N4YA 1VQOF 3CCQF 1S72F 3V7EA 2ALEA 1W3EX 5GAPK 2FGYA 1NMUB 5HY0A 1M90H 5DCVA 3V7QA 1VQ9F 2QEXF 2WALA 3PAFA 1VQKF 3FFMA 3E20B 3OBWA 2LBXA 3IR9A 5FJ4C 3LWRC 5GIOC 1K73H 3LWQC 1Q86H 5FLXM 1YI2F 3CMAF 1VQ6F 3V3TA 1VQ8F 1N8RH 1GO1A 2OHWA 1W42A 3VI6A 1T0KB 3WXMB 1RLGA 5HY1A 3LFOA 4LCKA 1H7MA 4EI8A 2CZWA 2KG4A 3G71F 3CMEF 3CCRF 3JAMM 1QVGF 4NUTA 1W41A 5HWEA 3NMUC 3CCJF 2OTLF 2BO1A 1CK2A 3CCVF 3PLAC 3VMFB 4NQ3A 3ON1A 2OTJF 3MCAB 4BVSA 3JCMM 3I56F 1RA4A 5GANK 2JNBA 1VQ4F 2OZBA 2VGNA 3I55F 1K9MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 F;  1K8A H;  3GYQ A;  3E1Y A;  1ZWZ A;  4BY9 D;  3SIU A;  3J81 M;  4BW0 B;  2FC3 A;  3G4S F;  1KQS F;  3CCL F;  5GIN C;  3NVK E;  3O85 A;  1VQ7 F;  2VGM A;  3CC2 F;  1NJI H;  5EWR A;  3RA6 A;  1VQM F;  5G4V C;  4X3L A;  3LWP C;  5A2Q M;  4C4W C;  2QI2 A;  1X7P A;  1X7O A;  3HAX D;  2AIF A;  3CC7 F;  1VQL F;  3CPQ A;  1VQN F;  5IT9 M;  3CPW F;  1VQ5 F;  3LWO C;  3CCE F;  3N4Z A;  5EO3 A;  1VQP F;  3OW2 F;  3NK7 A;  3RA5 A;  3CCS F;  1YIT F;  1Q81 H;  1E7K A;  3NK6 A;  1YIJ F;  1Q82 H;  3NVI B;  1SDS A;  3G6E F;  3AGK A;  4X3M A;  1XBI A;  3CG6 A;  3J80 M;  3CCU F;  3OBY A;  1GZ0 A;  3CD6 F;  1W2B F;  1GO0 A;  1W40 A;  3CC4 F;  1DT9 A;  2I6D A;  3HJW C;  1YJN F;  2LBW A;  2HVY D;  3CXC F;  1Q7Y H;  1X52 A;  2KTV A;  1QVF F;  1CN7 A;  2KTU A;  5GIP C;  1JJ2 F;  5G4U C;  2QA4 F;  1KC8 H;  3SIV A;  1PXW A;  1M1K H;  3J7A R;  1IPA A;  1YJW F;  3LWV C;  1KD1 H;  4TZZ A;  1YHQ F;  3CCM F;  3N4Y A;  1VQO F;  3CCQ F;  1S72 F;  3V7E A;  2ALE A;  1W3E X;  5GAP K;  1NMU B;  1M90 H;  5DCV A;  3V7Q A;  1VQ9 F;  2QEX F;  2WAL A;  3PAF A;  1VQK F;  3FFM A;  3E20 B;  3OBW A;  2LBX A;  3IR9 A;  5FJ4 C;  3LWR C;  5GIO C;  1K73 H;  3LWQ C;  1Q86 H;  5FLX M;  1YI2 F;  3CMA F;  1VQ6 F;  1VQ8 F;  1N8R H;  1GO1 A;  2OHW A;  1W42 A;  3VI6 A;  1T0K B;  3WXM B;  1RLG A;  4LCK A;  3LFO A;  1H7M A;  2CZW A;  2KG4 A;  3G71 F;  3CME F;  3CCR F;  3JAM M;  1QVG F;  4NUT A;  1W41 A;  3NMU C;  3CCJ F;  2OTL F;  2BO1 A;  1CK2 A;  3CCV F;  3PLA C;  3VMF B;  3ON1 A;  2OTJ F;  3MCA B;  3JCM M;  3I56 F;  1RA4 A;  5GAN K;  2JNB A;  1VQ4 F;  2OZB A;  2VGN A;  3I55 F;  1K9M H; 
#chains in the Genus database with same CATH topology
 3HKE B;  2CSL A;  5LOV A;  1YJ9 F;  3E1Y A;  2Z1U A;  3SIU A;  4DRX B;  1GX1 A;  2UYN B;  2FC3 A;  1H47 A;  4BW0 B;  3UT5 B;  5GIN C;  3NVK E;  3CYP B;  2RHL A;  2ZVY A;  2HX0 A;  2VGM A;  1NJI H;  1KNK A;  3RYI B;  4ZOL B;  2ZVZ A;  5G4V C;  5LA6 A;  2Z1F A;  4X3L A;  3VTI C;  3F0G A;  4EI9 A;  5MN5 A;  2HS4 A;  4U3J B;  2H6L A;  2CVL A;  4LNU B;  4RQO A;  3CPW F;  2NMU A;  3LWO C;  3CCE F;  1YIT F;  3WGM A;  3IEW A;  2UYJ A;  3S03 A;  5CB4 B;  3OW2 F;  1JFF B;  3HKE A;  2HQS C;  2Q1Y A;  3EOR A;  1OFU A;  4G4Z A;  1YIJ F;  1W5E A;  5JH7 A;  2RB9 A;  1W5F A;  3JAL B;  5HP7 A;  4DRX A;  2UYN A;  3QUW A;  1GZ0 A;  4TUY B;  5HXU A;  3N2K B;  3UT5 A;  4WBN A;  1DT9 A;  4TV8 A;  4F6R B;  5JQG A;  1YJN F;  5IJ9 A;  3RYI A;  4ZOL A;  3HWU A;  3B6N A;  3C9S A;  3MCQ A;  1JN1 A;  3QTY A;  3KE1 A;  3VYS C;  2QA4 F;  1VQV A;  3SIV A;  1OAP A;  5J2T B;  2N48 A;  4BT5 A;  3KJK A;  4TZZ A;  5EYP B;  1JFF A;  1VQO F;  5B8F A;  3E22 A;  3CCQ F;  1FNK A;  1W3E X;  5GAP K;  2RHO A;  1NMU B;  5HY0 A;  1M90 H;  1IV2 A;  3N2G B;  3N2K A;  3MQW A;  3K12 A;  3FFM A;  4C81 A;  3E20 B;  2BTU A;  3WPW A;  5LYJ A;  3IR9 A;  3GTZ A;  1K73 H;  3OON A;  2ZOD A;  3GHZ A;  3F6M A;  1YI2 F;  3KIZ A;  1VQ8 F;  2OHW A;  3WXM B;  2ZAU A;  2I6R A;  3JAS B;  2PMP A;  2KG4 A;  3K2X A;  5J2T A;  3RYC B;  3JAM M;  5EYP A;  5KX5 B;  4IIJ B;  2OTL F;  4O2A A;  4IHJ A;  5KMG B;  3CCV F;  4O4L A;  4C8E A;  3C8L A;  2IG8 A;  2VAP A;  3MCA B;  1QU9 A;  1VH8 A;  4PWT A;  4BVS A;  3JCM M;  5CA1 A;  3JAK B;  3N2G A;  2VXY A;  4U39 A;  1K8A H;  3WGJ A;  5HP8 A;  1W5B A;  1U40 A;  4BY9 D;  3G4S F;  2YXZ A;  2ZOV A;  3KJJ A;  2G9I A;  1IV3 A;  5J2U B;  3CC2 F;  3DDN A;  5EWR A;  3RYC A;  5EZY B;  1VQM F;  5HY2 A;  5KX5 A;  3JAT A;  5HXZ A;  5KMG A;  3F0D A;  3JAR B;  1IV1 A;  4C4W C;  3F0F A;  4O4H B;  2AIF A;  4ERH A;  1FSZ A;  3VOA A;  3HKB B;  4YJ3 B;  5BMV B;  3N4Z A;  5EO3 A;  4BT2 A;  1W57 A;  5EB1 B;  5C8Y A;  2BTO A;  2GLZ A;  3NK6 A;  1TUB B;  2BTQ B;  2H8C A;  3AGK A;  1SZQ A;  4X3M A;  5IYZ B;  1H48 A;  4XCQ A;  3J80 M;  3CCU F;  4G4W A;  4BVT A;  1W2B F;  3CD6 F;  1W40 A;  2HRY A;  1GO0 A;  2UYP A;  1YQN A;  4KWE A;  2EWC A;  1W5A A;  4BVQ A;  4ZI7 B;  2HRU A;  5EZY A;  5ITZ A;  2HVY D;  4BT4 A;  2HS0 A;  2HS3 A;  5HY4 A;  3JAR A;  4B46 A;  4O4H A;  1PXW A;  3RYH B;  1IPA A;  4X1Y A;  4YJ3 A;  2V9Y A;  5BMV A;  4O4J B;  3S0W A;  3N4Y A;  5EIB C;  1PF5 A;  2FGY A;  5GON B;  3K14 A;  1NQ3 A;  2QEX F;  3PAF A;  3D01 A;  1VQK F;  3OBW A;  1JY8 A;  4ZI7 A;  3LWR C;  5GIO C;  5FJ4 C;  5EAZ A;  4TV9 B;  3LDT A;  1UI9 A;  3M4S A;  3KHN A;  3RYF B;  3LWQ C;  3CMA F;  5LXT B;  3ZOP A;  3V3T A;  1N8R H;  4U3J A;  1J7H A;  1XHO A;  3ELC A;  2B33 A;  4LNU A;  1H7M A;  3RYH A;  3CB2 A;  1IV4 A;  3FD6 A;  4FFB B;  5CB4 A;  3G71 F;  3HKC B;  3WJP A;  1QVG F;  4R40 B;  3JAW B;  3S02 A;  1QAH A;  2BO1 A;  1CK2 A;  4E6E A;  3VMF B;  4NQ3 A;  3JAL A;  4X1I B;  4TUY A;  4YJ2 B;  2Z1E A;  5GAN K;  4BT7 A;  4F6R A;  2VGN A;  5JVD B;  3L7Q A;  3NMU C;  1K9M H;  4O4I B;  4X1K B;  4TV9 A;  5EIB D;  3RYF A;  3VYU C;  2K1S A;  1FNJ A;  5LXT A;  3R0P A;  3RE3 A;  3S06 A;  4X20 B;  1KQS F;  1VQ7 F;  3WJQ A;  4FFB A;  3HKC A;  3D54 A;  2OTM A;  5JCO A;  1RLU A;  2Z01 A;  1R1M A;  2IAF A;  1X25 A;  4C82 A;  5A2Q M;  2DYY A;  2AIZ P;  1DBF A;  3TD3 A;  3HAX D;  3FD5 A;  4BVR A;  1VHA A;  3T80 A;  2KGW A;  5IT9 M;  1Z5W A;  1Z5V A;  1VQ5 F;  1JD1 A;  1SA0 B;  5JVD A;  1VQP F;  3WPX A;  3RA5 A;  1Q81 H;  4O4I A;  2MQE A;  4G4Y A;  2DT4 A;  1U3P A;  4X1K A;  2F9Z C;  2RHJ A;  3NVI B;  5CA0 B;  1XBI A;  3CG6 A;  3JAS A;  1W58 1;  3OBY A;  4I4T B;  3ZO8 A;  1Q8R A;  3JVH A;  3S0H A;  3FPI A;  2UZH A;  2I6D A;  3HJW C;  4IIJ A;  2LBW A;  4ZHQ B;  5LOV B;  3VOB A;  3CXC F;  1Q7Y H;  1X52 A;  1CN7 A;  4I50 B;  2KTU A;  5GIP C;  1KC8 H;  3JAK A;  3VCZ A;  1M1K H;  1COM A;  1W59 A;  3LWV C;  1KD1 H;  1SA0 A;  1TVK B;  3F0E A;  2GZL A;  1S72 F;  3V7E A;  2ALE A;  5EB0 A;  2VAW A;  3MDO A;  5LA6 B;  2W8B C;  2IQQ A;  2ZF8 A;  3P0Z A;  5CA0 A;  3IEQ A;  4DXD A;  3V7Q A;  5DCV A;  2CWJ A;  3IMP A;  5J2U A;  4I4T A;  5JCO C;  4EB6 B;  4ZHQ A;  2LBT A;  3Q8H A;  1VQ6 F;  3P10 A;  1GO1 A;  3HTN A;  3LYB A;  3VI6 A;  4I50 A;  5JH7 B;  1T0K B;  4LCK A;  3HKB A;  3LFO A;  4G4X A;  1QD9 A;  4G88 A;  3V4D A;  4EI8 A;  5AVM A;  4WBN B;  3VYT C;  4TV8 B;  5JQG B;  4B62 A;  1W41 A;  1TVK A;  1TUB A;  5HWE A;  3IKE A;  4HNA B;  5IJ9 B;  5IYZ A;  4ZK7 A;  2OTJ F;  3BYQ A;  5FNV B;  4BT6 A;  2JNB A;  1RQ2 A;  1W55 A;  5LP6 B;  1XV2 A;  2PHN A;  1XRG A;  3M84 A;  4NWO B;  3VIU A;  4C8G A;  4EB6 A;  3GYQ A;  3ESJ A;  3ZP7 A;  3E22 B;  1ZWZ A;  3J81 M;  1FFX B;  2Z1T A;  1RQ7 A;  3ZP4 A;  3CCL F;  4B45 A;  3O85 A;  4O4J A;  2QTP A;  1ODE A;  3K0T A;  3MBM A;  3IKF A;  3RA6 A;  3WJR A;  5LYJ B;  5MN6 A;  3C9U A;  5GON A;  4HNA A;  3S0Y A;  3LWP C;  3FBA A;  2QI2 A;  1X7P A;  1X7O A;  3LME A;  5FNV A;  3C9R A;  3CC7 F;  1VQL F;  3CPQ A;  1VQN F;  5LP6 A;  2H8E A;  3NK7 A;  3CCS F;  1E7K A;  3CYQ A;  1CLI A;  1Q82 H;  2CW4 A;  2UYK A;  3QHD A;  3G6E F;  1SDS A;  4O2A B;  3ERN A;  3I3F A;  4IHJ B;  4O4L B;  1FFX A;  1ONI A;  1YGY A;  3HKD B;  3CC4 F;  5CA1 B;  2AMT A;  3P4E A;  3D00 A;  2LCA A;  2R6R 1;  3JAW A;  3WGK A;  4G4V A;  4ZHW A;  2RHH A;  2KTV A;  1QVF F;  2CHS A;  2HP0 B;  4X1I A;  4C8I A;  4YJ2 A;  2L26 A;  3M1X A;  5G4U C;  1JJ2 F;  4EI7 A;  3J7A R;  2P6Y A;  1YJW F;  3C9T A;  1YHQ F;  3CCM F;  4I55 B;  4O2B B;  4RHA A;  2YYE A;  2CHT A;  3JAT B;  1U43 A;  2R75 1;  2VAM A;  1KNJ A;  4X20 A;  2Q1X A;  1T0A A;  1VQ9 F;  2WAL A;  3HKD A;  3I7T A;  5IJ0 B;  2LBX A;  1VK3 A;  4ZHY B;  3TD5 A;  3VO8 A;  3TD4 A;  5C8Y B;  1Q86 H;  5FLX M;  2GVI A;  4ZHV A;  3U0O A;  1W42 A;  2HP0 A;  1RLG A;  5LP6 C;  5HY1 A;  3DC2 A;  2HP3 A;  1UFY A;  1U3L A;  2CZW A;  4BT3 A;  3CME F;  3WGL A;  3CCR F;  4B5C A;  4NUT A;  4M8I A;  3WGN A;  3CCJ F;  4I55 A;  5ITZ B;  4O2B A;  3PLA C;  3ON1 A;  5MN4 A;  3I56 F;  1RA4 A;  1VQ4 F;  2OZB A;  3I55 F;  5IJ0 A;  4X1Y B; 
#chains in the Genus database with same CATH homology
 1YJ9 F;  1K8A H;  3GYQ A;  3E1Y A;  1ZWZ A;  4BY9 D;  3SIU A;  3J81 M;  4BW0 B;  2FC3 A;  3G4S F;  1KQS F;  3CCL F;  5GIN C;  3NVK E;  3O85 A;  1VQ7 F;  2VGM A;  3CC2 F;  1NJI H;  5EWR A;  3RA6 A;  1VQM F;  5HY2 A;  5G4V C;  5HXZ A;  4X3L A;  3LWP C;  4EI9 A;  5A2Q M;  2QI2 A;  1X7P A;  1X7O A;  3HAX D;  4C4W C;  2AIF A;  4BVR A;  3CC7 F;  1VQL F;  3CPQ A;  1VQN F;  5IT9 M;  3CPW F;  1VQ5 F;  3LWO C;  3CCE F;  3N4Z A;  5EO3 A;  1VQP F;  3OW2 F;  3NK7 A;  3RA5 A;  3CCS F;  1YIT F;  1Q81 H;  1E7K A;  3NK6 A;  2GLZ A;  2F9Z C;  1YIJ F;  1Q82 H;  3NVI B;  1SDS A;  3G6E F;  3AGK A;  4X3M A;  4XCQ A;  1XBI A;  3CG6 A;  3J80 M;  3CCU F;  3OBY A;  5HXU A;  1GZ0 A;  3CD6 F;  4BVT A;  1W2B F;  1GO0 A;  1W40 A;  3CC4 F;  1DT9 A;  3D00 A;  4BVQ A;  2I6D A;  3HJW C;  1YJN F;  2LBW A;  2HVY D;  3CXC F;  1Q7Y H;  1X52 A;  2KTV A;  1QVF F;  5HY4 A;  1CN7 A;  2KTU A;  5GIP C;  1JJ2 F;  5G4U C;  2QA4 F;  1KC8 H;  3SIV A;  4EI7 A;  1PXW A;  1M1K H;  3J7A R;  1IPA A;  1YJW F;  3LWV C;  1KD1 H;  4TZZ A;  1YHQ F;  3CCM F;  3N4Y A;  1VQO F;  3CCQ F;  1S72 F;  3V7E A;  2ALE A;  1W3E X;  5GAP K;  2FGY A;  1NMU B;  5HY0 A;  1M90 H;  5DCV A;  3V7Q A;  1VQ9 F;  2QEX F;  2WAL A;  3PAF A;  1VQK F;  3FFM A;  3E20 B;  3OBW A;  2LBX A;  3IR9 A;  5FJ4 C;  3LWR C;  5GIO C;  1K73 H;  3LWQ C;  1Q86 H;  5FLX M;  1YI2 F;  3CMA F;  1VQ6 F;  3V3T A;  1VQ8 F;  1N8R H;  1GO1 A;  2OHW A;  1W42 A;  3VI6 A;  1T0K B;  3WXM B;  1RLG A;  5HY1 A;  3LFO A;  4LCK A;  1H7M A;  4EI8 A;  2CZW A;  2KG4 A;  3G71 F;  3CME F;  3CCR F;  3JAM M;  1QVG F;  4NUT A;  1W41 A;  5HWE A;  3NMU C;  3CCJ F;  2OTL F;  2BO1 A;  1CK2 A;  3CCV F;  3PLA C;  3VMF B;  4NQ3 A;  3ON1 A;  2OTJ F;  3MCA B;  4BVS A;  3JCM M;  3I56 F;  1RA4 A;  5GAN K;  2JNB A;  1VQ4 F;  2OZB A;  2VGN A;  3I55 F;  1K9M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...