2HP0A

Crystal structure of iminodisuccinate epimerase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
447
structure length
447
Chain Sequence
HMFTTKLAEKVVSAWKAKISQPALKAAQDGVIDTVAAALGGVTEHSVQVALKYVAATGGSGDSKLWGVNQRSNMFDAAFVNGMAAHAIDFDDSFPVMRGHPSSSLVPAIFAVGEHVGANGHNCLKSYVLGIEVVATLGRAVGKGHYLAGWHPTSTLGVFGATTAAALLLGADEEQLRNAWGIAASNSCGIIKNFGTMTKPMHTGSAARNGVLSAWLSMQSFTGCQTVFDDAEGILAMYGAQPGPELFNAMQKFGTPWAIIAPGLYKKSWPSCYANHKPLAGLFAIMKEHGLTGQDISHVDVGFLPGVEKPLLYMDPRTTEEAKFSIEANIGAALLDGEVSLASFEIEHLDRPAMRAAMKKVTRFDMPSETTFSGTTGYTDIVVHTADGKIERRIEATPGSLEDPMDDAHLERKFKDCTAWMPFGESGLLFDRLRSLTADQGIKTVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords IDS-epimerase
publication title Three-dimensional Structure of Iminodisuccinate Epimerase Defines the Fold of the MmgE/PrpD Protein Family.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 156
structure length 447
sequence length 447
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03972 MmgE_PrpD MmgE/PrpD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4100.10 Mainly Alpha Orthogonal Bundle 2-methylcitrate dehydratase PrpD 2-methylcitrate dehydratase PrpD 2hp0A01
3.30.1330.120 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-methylcitrate dehydratase PrpD 2hp0A02
2HP0A 2HP3A 1SZQA 2HP0B
chains in the Genus database with same CATH superfamily
4RQOA 4X20A 2I6RA 2QEXF 4X1IB 5KX5A 5JQGA 5LA6B 3R0PA 3IR9A 4NQ3A 5G4UC 1TVKA 5GAPK 4G4WA 5JVDB 3RA6A 3IKEA 3CCUF 1W5AA 3D01A 4BVQA 1KD1H 1PF5A 2HS4A 3RYFA 4HNAA 2CSLA 3IEWA 3OW2F 3LFOA 2CHSA 4C81A 3HAXD 5GIPC 2IAFA 4O4IA 3MBMA 3LDTA 4LNUB 5HXUA 3WGMA 5EYPA 3ZP4A 3HKDB 2GZLA 5CA0B 5CB4A 1JN1A 2PHNA 3HTNA 3N2GB 1W40A 3ZO8A 4ZHQB 3CG6A 3TD5A 1IPAA 4FFBA 1Q7YH 3S03A 1VQNF 1K8AH 5C8YA 3FBAA 5EO3A 3OONA 4NUTA 1X52A 1QAHA 3JAWB 5LP6B 5MN5A 2UYJA 4X20B 4O4JA 5KX5B 2KG4A 5JQGB 3MCQA 3LWOC 2RHLA 2BTQB 4I55A 3JARA 5JH7A 2GVIA 3WGJA 5FNVA 3KJJA 1W5EA 4PWTA 2H8CA 2UYNA 3CMEF 3RYFB 4HNAB 4ZOLA 2VAMA 3D00A 4DRXA 3FD5A 2GLZA 4O4IB 5GINC 4NWOB 1IV1A 4O2AA 4F6RA 5EYPB 3KE1A 1KNJA 3IKFA 4B46A 3VYSC 5CB4B 3I56F 1VQMF 3KJKA 4X3LA 3LYBA 4FFBB 2BTUA 1VQ5F 1TUBB 2R751 5C8YB 2HP0A 1J7HA 3CCEF 3N4YA 3EORA 5EAZA 3S0YA 5EZYA 4YJ2A 3JASA 3S02A 1OAPA 4BY9D 5JH7B 3JARB 4EI8A 4TV8A 1CK2A 5JCOC 2LBWA 1NQ3A 4C8GA 5GANK 5FNVB 4ZI7A 3FD6A 1VQ6F 1Z5VA 2UYNB 1IV2A 3QTYA 3ELCA 4B62A 2KGWA 1IV4A 4ZOLB 5IJ0A 1N8RH 1YIJF 2Q1YA 2L26A 3HWUA 4U39A 4BT4A 4DRXB 2LBXA 1UI9A 1SA0A 3RA5A 3J7AR 1FNKA 3G4SF 2LCAA 1GZ0A 4O2AB 4F6RB 3U0OA 3LWRC 2BTOA 1H48A 3SIUA 3ZP7A 3F0DA 1W3EX 4R40B 3ESJA 5LYJA 1GX1A 3E22A 1KC8H 3JCMM 5J2UA 4I50A 2H8EA 4IHJA 4EI9A 4ERHA 2HP0B 4TV9A 2Q1XA 4TUYA 2AIFA 1U40A 1YJ9F 5EZYB 4BT3A 2P6YA 4YJ2B 3JASB 1QD9A 1OFUA 2AIZP 3J80M 3JAKA 2ZOVA 4TV8B 1VQPF 3G6EF 1VQ8F 4X3MA 4ZI7B 3NVKE 1YGYA 1NMUB 3BYQA 3I3FA 5B8FA 5IJ0B 1RLUA 5HWEA 2OZBA 1SDSA 4G88A 3VIUA 4C82A 1SA0B 1RA4A 4XCQA 4BT2A 3VOBA 2YYEA 1JFFA 1M1KH 4ZK7A 2HS0A 2W8BC 1PXWA 1U3PA 5IYZA 3LWPC 3HKCA 1E7KA 1FSZA 1XRGA 4LCKA 5HP8A 5LYJB 4X1YA 3E22B 5GONB 3RYIA 1ODEA 5J2UB 1T0KB 4I50B 2AMTA 3CCMF 3S0WA 3CPWF 2RHJA 3F0EA 4IHJB 4O4HA 4BT5A 4TV9B 2R6R1 2ALEA 4TUYB 4BT7A 3WJPA 1NJIH 1VK3A 2B33A 5MN4A 1JY8A 5LOVA 4E6EA 1TVKB 3VYUC 1GO1A 1QVFF 5EIBD 1U3LA 3PAFA 1SZQA 4U3JA 3JAKB 2IQQA 1COMA 2VAWA 1W55A 2HP3A 1JD1A 1X25A 3CCLF 4TZZA 2WALA 3S0HA 3CD6F 3K14A 4EB6A 5DCVA 3VTIC 5FLXM 2NMUA 3V7QA 3RYHA 3VYTC 3HJWC 1YQNA 5A2QM 2Z1UA 2CZWA 1JFFB 3V7EA 1RQ2A 3WJRA 3MCAB 3WPXA 5IYZB 3HKCB 5J2TA 3MQWA 2RB9A 4X1YB 4RHAA 1YHQF 1CN7A 3ZOPA 2Z1TA 3CYQA 3RYIB 4YJ3A 4BVSA 3FPIA 3LWVC 1VQ4F 3CMAF 3CPQA 1U43A 2Z1FA 3C8LA 4O4JB 3C9TA 3NK7A 4O4HB 5HY0A 2LBTA 4IIJA 3CC4F 1FNJA 1XBIA 1W581 2RHHA 5LOVB 4I55B 5ITZA 2KTUA 3UT5A 3G71F 3OBYA 3OBWA 4B45A 3F6MA 5CA1A 4U3JB 3CCJF 2MQEA 3N4ZA 1Q81H 2JNBA 2K1SA 2ZVYA 2HS3A 1KQSF 3CYPB 4EB6B 4BVTA 2HVYD 3RYHB 2PMPA 3K0TA 4DXDA 3F0FA 5HY4A 1CLIA 3DDNA 2EWCA 3WXMB 3NMUC 3I55F 5GIOC 5LXTA 3C9SA 5KMGA 3V3TA 5HP7A 5J2TB 3JALA 1W5BA 3JAMM 3Q8HA 1JJ2F 3C9UA 4O4LA 4YJ3B 1VQ7F 3D54A 1M90H 4ZHYB 3QHDA 3QUWA 4EI7A 4IIJB 1S72F 3WGKA 2YXZA 1DT9A 1Q8RA 2CWJA 3ERNA 3T80A 3WPWA 2OTJF 4G4ZA 1K9MH 2H6LA 1VHAA 1RLGA 3UT5B 4I4TA 1QU9A 2OTLF 5CA1B 2OHWA 4M8IA 3CCSF 2CW4A 3RE3A 1W41A 1YJNF 1X7PA 2V9YA 3GYQA 2UYKA 2N48A 3CC7F 3VI6A 3CCQF 3MDOA 2G9IA 4C8EA 1IV3A 2VGNA 2HQSC 4C8IA 3N2KA 3RYCA 3C9RA 3PLAC 5HXZA 5IT9M 3KHNA 3JVHA 2UZHA 3TD3A 2HRYA 4X1KA 5LXTB 3J81M 2CVLA 5KMGB 5MN6A 2ZODA 1QVGF 3JALB 1VQLF 5AVMA 3GHZA 4O4LB 3TD4A 4BT6A 1Z5WA 3VOAA 1ONIA 1XHOA 4ZHVA 2KTVA 3CB2A 2UYPA 1FFXA 2QI2A 1YITF 1Q82H 3S06A 3VMFB 2Z01A 2OTMA 3B6NA 3I7TA 3P10A 5HY1A 3P4EA 1TUBA 1YI2F 4G4YA 4I4TB 4B5CA 2BO1A 2DYYA 3FFMA 2HRUA 3CCVF 3HKEA 5EB0A 1W59A 5BMVA 3IEQA 1W42A 3HKBA 3F0GA 4C4WC 2I6DA 3E20B 2HX0A 2ZVZA 1YJWF 1XV2A 2ZF8A 3N2KB 1VQVA 4G4VA 1H7MA 3RYCB 1Q86H 3NVIB 1KNKA 3P0ZA 1H47A 1W5FA 4X1KB 4O2BA 3LWQC 4ZHWA 5EB1B 3NK6A 3KIZA 3JATA 3V4DA 1W57A 3CCRF 2CHTA 2VGMA 4KWEA 4WBNA 1FFXB 4BVRA 1VH8A 2VAPA 3LMEA 1ZWZA 3WGNA 5IJ9A 1VQOF 3SIVA 1RQ7A 5G4VC 4G4XA 4X1IA 3HKEB 3IMPA 2VXYA 5LA6A 5BMVB 1W2BF 5FJ4C 2QTPA 3HKBB 3WGLA 1X7OA 5JVDA 3M1XA 2F9ZC 1DBFA 3VO8A 3CXCF 1K73H 1VQKF 2RHOA 3L7QA 3GTZA 2FGYA 3ON1A 4O2BB 4BW0B 4LNUA 5JCOA 3O85A 3JATB 3M4SA 3HKDA 2ZAUA 5CA0A 4ZHQA 3N2GA 3CC2F 1GO0A 1UFYA 3E1YA 5EIBC 3WJQA 2FC3A 5LP6C 3M84A 3K12A 4WBNB 2QA4F 2IG8A 5ITZB 1R1MA 3VCZA 1VQ9F 3AGKA 5HY2A 3K2XA 5GONA 5IJ9B 1T0AA 2DT4A 2Z1EA 3DC2A 5EWRA 3JAWA 5LP6A
chains in the Genus database with same CATH topology
2HP0A 2HP3A 1SZQA 2HP0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP0 A;  2HP3 A;  1SZQ A;  2HP0 B; 
#chains in the Genus database with same CATH topology
 4RQO A;  4X20 A;  2I6R A;  2QEX F;  4X1I B;  5KX5 A;  5JQG A;  5LA6 B;  3R0P A;  3IR9 A;  4NQ3 A;  5G4U C;  1TVK A;  5GAP K;  4G4W A;  5JVD B;  3RA6 A;  3IKE A;  3CCU F;  1W5A A;  3D01 A;  4BVQ A;  1KD1 H;  1PF5 A;  2HS4 A;  3RYF A;  4HNA A;  2CSL A;  3IEW A;  3OW2 F;  3LFO A;  2CHS A;  4C81 A;  3HAX D;  5GIP C;  2IAF A;  4O4I A;  3MBM A;  3LDT A;  4LNU B;  5HXU A;  3WGM A;  5EYP A;  3ZP4 A;  3HKD B;  2GZL A;  5CA0 B;  5CB4 A;  1JN1 A;  2PHN A;  3HTN A;  3N2G B;  1W40 A;  3ZO8 A;  4ZHQ B;  3CG6 A;  3TD5 A;  1IPA A;  4FFB A;  1Q7Y H;  3S03 A;  1VQN F;  1K8A H;  5C8Y A;  3FBA A;  5EO3 A;  3OON A;  4NUT A;  1X52 A;  1QAH A;  3JAW B;  5LP6 B;  5MN5 A;  2UYJ A;  4X20 B;  4O4J A;  5KX5 B;  2KG4 A;  5JQG B;  3MCQ A;  3LWO C;  2RHL A;  2BTQ B;  4I55 A;  3JAR A;  5JH7 A;  2GVI A;  3WGJ A;  5FNV A;  3KJJ A;  1W5E A;  4PWT A;  2H8C A;  2UYN A;  3CME F;  3RYF B;  4HNA B;  4ZOL A;  2VAM A;  3D00 A;  4DRX A;  3FD5 A;  2GLZ A;  4O4I B;  5GIN C;  4NWO B;  1IV1 A;  4O2A A;  4F6R A;  5EYP B;  3KE1 A;  1KNJ A;  3IKF A;  4B46 A;  3VYS C;  5CB4 B;  3I56 F;  1VQM F;  3KJK A;  4X3L A;  3LYB A;  4FFB B;  2BTU A;  1VQ5 F;  1TUB B;  2R75 1;  5C8Y B;  2HP0 A;  1J7H A;  3CCE F;  3N4Y A;  3EOR A;  5EAZ A;  3S0Y A;  5EZY A;  4YJ2 A;  3JAS A;  3S02 A;  1OAP A;  4BY9 D;  5JH7 B;  3JAR B;  4EI8 A;  4TV8 A;  1CK2 A;  5JCO C;  2LBW A;  1NQ3 A;  4C8G A;  5GAN K;  5FNV B;  4ZI7 A;  3FD6 A;  1VQ6 F;  1Z5V A;  2UYN B;  1IV2 A;  3QTY A;  3ELC A;  4B62 A;  2KGW A;  1IV4 A;  4ZOL B;  5IJ0 A;  1N8R H;  1YIJ F;  2Q1Y A;  2L26 A;  3HWU A;  4U39 A;  4BT4 A;  4DRX B;  2LBX A;  1UI9 A;  1SA0 A;  3RA5 A;  3J7A R;  1FNK A;  3G4S F;  2LCA A;  1GZ0 A;  4O2A B;  4F6R B;  3U0O A;  3LWR C;  2BTO A;  1H48 A;  3SIU A;  3ZP7 A;  3F0D A;  1W3E X;  4R40 B;  3ESJ A;  5LYJ A;  1GX1 A;  3E22 A;  1KC8 H;  3JCM M;  5J2U A;  4I50 A;  2H8E A;  4IHJ A;  4EI9 A;  4ERH A;  2HP0 B;  4TV9 A;  2Q1X A;  4TUY A;  2AIF A;  1U40 A;  1YJ9 F;  5EZY B;  4BT3 A;  2P6Y A;  4YJ2 B;  3JAS B;  1QD9 A;  1OFU A;  2AIZ P;  3J80 M;  3JAK A;  2ZOV A;  4TV8 B;  1VQP F;  3G6E F;  1VQ8 F;  4X3M A;  4ZI7 B;  3NVK E;  1YGY A;  1NMU B;  3BYQ A;  3I3F A;  5B8F A;  5IJ0 B;  1RLU A;  5HWE A;  2OZB A;  1SDS A;  4G88 A;  3VIU A;  4C82 A;  1SA0 B;  1RA4 A;  4XCQ A;  4BT2 A;  3VOB A;  2YYE A;  1JFF A;  1M1K H;  4ZK7 A;  2HS0 A;  2W8B C;  1PXW A;  1U3P A;  5IYZ A;  3LWP C;  3HKC A;  1E7K A;  1FSZ A;  1XRG A;  4LCK A;  5HP8 A;  5LYJ B;  4X1Y A;  3E22 B;  5GON B;  3RYI A;  1ODE A;  5J2U B;  1T0K B;  4I50 B;  2AMT A;  3CCM F;  3S0W A;  3CPW F;  2RHJ A;  3F0E A;  4IHJ B;  4O4H A;  4BT5 A;  4TV9 B;  2R6R 1;  2ALE A;  4TUY B;  4BT7 A;  3WJP A;  1NJI H;  1VK3 A;  2B33 A;  5MN4 A;  1JY8 A;  5LOV A;  4E6E A;  1TVK B;  3VYU C;  1GO1 A;  1QVF F;  5EIB D;  1U3L A;  3PAF A;  1SZQ A;  4U3J A;  3JAK B;  2IQQ A;  1COM A;  2VAW A;  1W55 A;  2HP3 A;  1JD1 A;  1X25 A;  3CCL F;  4TZZ A;  2WAL A;  3S0H A;  3CD6 F;  3K14 A;  4EB6 A;  5DCV A;  3VTI C;  5FLX M;  2NMU A;  3V7Q A;  3RYH A;  3VYT C;  3HJW C;  1YQN A;  5A2Q M;  2Z1U A;  2CZW A;  1JFF B;  3V7E A;  1RQ2 A;  3WJR A;  3MCA B;  3WPX A;  5IYZ B;  3HKC B;  5J2T A;  3MQW A;  2RB9 A;  4X1Y B;  4RHA A;  1YHQ F;  1CN7 A;  3ZOP A;  2Z1T A;  3CYQ A;  3RYI B;  4YJ3 A;  4BVS A;  3FPI A;  3LWV C;  1VQ4 F;  3CMA F;  3CPQ A;  1U43 A;  2Z1F A;  3C8L A;  4O4J B;  3C9T A;  3NK7 A;  4O4H B;  5HY0 A;  2LBT A;  4IIJ A;  3CC4 F;  1FNJ A;  1XBI A;  1W58 1;  2RHH A;  5LOV B;  4I55 B;  5ITZ A;  2KTU A;  3UT5 A;  3G71 F;  3OBY A;  3OBW A;  4B45 A;  3F6M A;  5CA1 A;  4U3J B;  3CCJ F;  2MQE A;  3N4Z A;  1Q81 H;  2JNB A;  2K1S A;  2ZVY A;  2HS3 A;  1KQS F;  3CYP B;  4EB6 B;  4BVT A;  2HVY D;  3RYH B;  2PMP A;  3K0T A;  4DXD A;  3F0F A;  5HY4 A;  1CLI A;  3DDN A;  2EWC A;  3WXM B;  3NMU C;  3I55 F;  5GIO C;  5LXT A;  3C9S A;  5KMG A;  3V3T A;  5HP7 A;  5J2T B;  3JAL A;  1W5B A;  3JAM M;  3Q8H A;  1JJ2 F;  3C9U A;  4O4L A;  4YJ3 B;  1VQ7 F;  3D54 A;  1M90 H;  4ZHY B;  3QHD A;  3QUW A;  4EI7 A;  4IIJ B;  1S72 F;  3WGK A;  2YXZ A;  1DT9 A;  1Q8R A;  2CWJ A;  3ERN A;  3T80 A;  3WPW A;  2OTJ F;  4G4Z A;  1K9M H;  2H6L A;  1VHA A;  1RLG A;  3UT5 B;  4I4T A;  1QU9 A;  2OTL F;  5CA1 B;  2OHW A;  4M8I A;  3CCS F;  2CW4 A;  3RE3 A;  1W41 A;  1YJN F;  1X7P A;  2V9Y A;  3GYQ A;  2UYK A;  2N48 A;  3CC7 F;  3VI6 A;  3CCQ F;  3MDO A;  2G9I A;  4C8E A;  1IV3 A;  2VGN A;  2HQS C;  4C8I A;  3N2K A;  3RYC A;  3C9R A;  3PLA C;  5HXZ A;  5IT9 M;  3KHN A;  3JVH A;  2UZH A;  3TD3 A;  2HRY A;  4X1K A;  5LXT B;  3J81 M;  2CVL A;  5KMG B;  5MN6 A;  2ZOD A;  1QVG F;  3JAL B;  1VQL F;  5AVM A;  3GHZ A;  4O4L B;  3TD4 A;  4BT6 A;  1Z5W A;  3VOA A;  1ONI A;  1XHO A;  4ZHV A;  2KTV A;  3CB2 A;  2UYP A;  1FFX A;  2QI2 A;  1YIT F;  1Q82 H;  3S06 A;  3VMF B;  2Z01 A;  2OTM A;  3B6N A;  3I7T A;  3P10 A;  5HY1 A;  3P4E A;  1TUB A;  1YI2 F;  4G4Y A;  4I4T B;  4B5C A;  2BO1 A;  2DYY A;  3FFM A;  2HRU A;  3CCV F;  3HKE A;  5EB0 A;  1W59 A;  5BMV A;  3IEQ A;  1W42 A;  3HKB A;  3F0G A;  4C4W C;  2I6D A;  3E20 B;  2HX0 A;  2ZVZ A;  1YJW F;  1XV2 A;  2ZF8 A;  3N2K B;  1VQV A;  4G4V A;  1H7M A;  3RYC B;  1Q86 H;  3NVI B;  1KNK A;  3P0Z A;  1H47 A;  1W5F A;  4X1K B;  4O2B A;  3LWQ C;  4ZHW A;  5EB1 B;  3NK6 A;  3KIZ A;  3JAT A;  3V4D A;  1W57 A;  3CCR F;  2CHT A;  2VGM A;  4KWE A;  4WBN A;  1FFX B;  4BVR A;  1VH8 A;  2VAP A;  3LME A;  1ZWZ A;  3WGN A;  5IJ9 A;  1VQO F;  3SIV A;  1RQ7 A;  5G4V C;  4G4X A;  4X1I A;  3HKE B;  3IMP A;  2VXY A;  5LA6 A;  5BMV B;  1W2B F;  5FJ4 C;  2QTP A;  3HKB B;  3WGL A;  1X7O A;  5JVD A;  3M1X A;  2F9Z C;  1DBF A;  3VO8 A;  3CXC F;  1K73 H;  1VQK F;  2RHO A;  3L7Q A;  3GTZ A;  2FGY A;  3ON1 A;  4O2B B;  4BW0 B;  4LNU A;  5JCO A;  3O85 A;  3JAT B;  3M4S A;  3HKD A;  2ZAU A;  5CA0 A;  4ZHQ A;  3N2G A;  3CC2 F;  1GO0 A;  1UFY A;  3E1Y A;  5EIB C;  3WJQ A;  2FC3 A;  5LP6 C;  3M84 A;  3K12 A;  4WBN B;  2QA4 F;  2IG8 A;  5ITZ B;  1R1M A;  3VCZ A;  1VQ9 F;  3AGK A;  5HY2 A;  3K2X A;  5GON A;  5IJ9 B;  1T0A A;  2DT4 A;  2Z1E A;  3DC2 A;  5EWR A;  3JAW A;  5LP6 A; 
#chains in the Genus database with same CATH homology
 2HP0 A;  2HP3 A;  1SZQ A;  2HP0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...