2HP0A

Crystal structure of iminodisuccinate epimerase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
447
structure length
447
Chain Sequence
HMFTTKLAEKVVSAWKAKISQPALKAAQDGVIDTVAAALGGVTEHSVQVALKYVAATGGSGDSKLWGVNQRSNMFDAAFVNGMAAHAIDFDDSFPVMRGHPSSSLVPAIFAVGEHVGANGHNCLKSYVLGIEVVATLGRAVGKGHYLAGWHPTSTLGVFGATTAAALLLGADEEQLRNAWGIAASNSCGIIKNFGTMTKPMHTGSAARNGVLSAWLSMQSFTGCQTVFDDAEGILAMYGAQPGPELFNAMQKFGTPWAIIAPGLYKKSWPSCYANHKPLAGLFAIMKEHGLTGQDISHVDVGFLPGVEKPLLYMDPRTTEEAKFSIEANIGAALLDGEVSLASFEIEHLDRPAMRAAMKKVTRFDMPSETTFSGTTGYTDIVVHTADGKIERRIEATPGSLEDPMDDAHLERKFKDCTAWMPFGESGLLFDRLRSLTADQGIKTVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDS-epimerase
publication title Three-dimensional Structure of Iminodisuccinate Epimerase Defines the Fold of the MmgE/PrpD Protein Family.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 156
structure length 447
sequence length 447
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03972 MmgE_PrpD MmgE/PrpD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4100.10 Mainly Alpha Orthogonal Bundle 2-methylcitrate dehydratase PrpD 2-methylcitrate dehydratase PrpD 2hp0A01
3.30.1330.120 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-methylcitrate dehydratase PrpD 2hp0A02
2HP0B 1SZQA 2HP3A 2HP0A
chains in the Genus database with same CATH superfamily
3LDTA 1KC8H 1JFFB 1ONIA 3N2GA 3IEWA 4O4JB 5CB4A 3HAXD 3VYUC 3CCQF 1H47A 3D54A 5EIBD 3M84A 2CZWA 4B62A 5IYZA 3E1YA 3MQWA 5HXZA 3Q8HA 4ERHA 2IG8A 5LXTB 2K1SA 1W59A 5MN5A 3RYCA 5IJ9A 2QI2A 4YJ2A 3QUWA 5EYPA 5GONA 2BTQB 2IQQA 2CVLA 3K12A 4ZI7B 3FD6A 4R40B 3B6NA 3MBMA 2UZHA 3WJPA 4X1YB 3ZP7A 3NMUC 3JARB 2HS4A 3D00A 2RHJA 1W5AA 3DC2A 5CA1A 4X1IA 1CLIA 1W57A 2BTOA 3F0GA 4FFBB 2LBXA 2BO1A 3SIUA 2H6LA 2GZLA 2CHSA 4EB6B 3JASA 3J7AR 3VIUA 2LBWA 2L26A 4X1KA 3VYSC 1Q82H 5MN6A 1RLGA 5J2UB 3G4SF 4G88A 2LBTA 5LXTA 1DT9A 3RA5A 5JQGB 1VQLF 3C9UA 1TVKB 3VI6A 4ZHVA 3IKEA 4ZI7A 3C9TA 2YXZA 2KTUA 4BW0B 3FD5A 5GIPC 3TD4A 4B5CA 2H8CA 4G4VA 5LA6B 2ZOVA 1CK2A 3I3FA 3CG6A 4BT4A 1U43A 4NQ3A 1XV2A 1YITF 4KWEA 5LP6C 3WGKA 5IT9M 4BT5A 4FFBA 3JAWB 5AVMA 3FPIA 3OBWA 2KG4A 4EB6A 3JVHA 2HRYA 5JVDB 1JJ2F 5J2UA 1W41A 2Z01A 3HJWC 2OZBA 3K0TA 3NK7A 3RYFA 1U3LA 5JQGA 1Q7YH 3HKCB 4TV8B 4C8EA 3VYTC 3WGNA 3GTZA 1TVKA 5HY4A 3CC2F 4ZK7A 1IV1A 5HXUA 1VQOF 3BYQA 2AMTA 3LWPC 5CB4B 3L7QA 3CCVF 3G6EF 5LA6A 1VQNF 1X7OA 5IYZB 1W42A 5LP6B 4G4YA 3JALA 4EI7A 1NMUB 2Q1XA 1FNJA 4WBNB 1YJWF 5EWRA 3RYCB 3E20B 1W40A 4YJ2B 1Q8RA 4PWTA 5EYPB 5GONB 5IJ9B 1VQKF 2UYNA 2Z1UA 1OFUA 2FGYA 1IV2A 4I55B 3P0ZA 3I55F 3WGLA 2Z1FA 3IKFA 1NQ3A 3M4SA 1SZQA 3HKCA 3HKEA 3VTIC 4O2BA 3LWVC 3S03A 4F6RA 3MCAB 4U3JB 4O4HB 2RHHA 4BT7A 4DRXA 1K8AH 1VQ9F 3KHNA 5CA1B 2DYYA 4X1IB 2VAPA 3CMEF 3O85A 5GINC 1Q81H 3WJQA 3JASB 3N2KA 4X1KB 5LP6A 3ESJA 1M90H 3GHZA 4WBNA 1VQVA 1IV4A 1DBFA 5EZYA 3D01A 1W55A 3J81M 5KMGB 4C4WC 3HTNA 4I55A 4NUTA 2QA4F 3IEQA 3S02A 2PHNA 3S0HA 1YHQF 1RQ7A 4YJ3B 1ODEA 3C9SA 5EB0A 2PMPA 4O4HA 4U3JA 5C8YB 3C9RA 2OTMA 1Z5WA 1NJIH 3CCSF 3LWRC 2Z1EA 1JD1A 3VOBA 3G71F 3OBYA 5CA0A 1KQSF 3N4ZA 2ZVZA 1FFXA 2IAFA 2R751 2UYKA 3CMAF 2CHTA 3RYFB 3JCMM 3M1XA 5BMVB 3CCLF 1JY8A 3LMEA 3VMFB 1VQ6F 2ZVYA 1W3EX 1W581 4ZOLA 5KMGA 4B46A 1XBIA 3JAKA 4XCQA 1FNKA 3S0WA 4BVQA 5GANK 4YJ3A 1KNKA 4BT2A 4BVSA 5C8YA 3JALB 1JN1A 4B45A 1W2BF 2CW4A 1X52A 5G4VC 3GYQA 3U0OA 1U40A 3EORA 4TZZA 3QHDA 2I6DA 4BY9D 5FLXM 2UYNB 3WPWA 4X3LA 2WALA 4IHJB 1VK3A 3F0DA 4EI8A 1Q86H 1T0KB 1SA0A 4X20A 5B8FA 1CN7A 3CYQA 3K14A 5HWEA 2NMUA 4O4LA 5G4UC 3WGJA 1T0AA 4M8IA 1K73H 5BMVA 3OONA 3HKEB 2HP0B 4O2BB 2HVYD 4ZHWA 4F6RB 3PAFA 3ERNA 2VGMA 5EB1B 5JH7B 4DRXB 1X7PA 2HP3A 2CSLA 3UT5B 5MN4A 1UI9A 4LNUB 5EAZA 3V7EA 1VQ8F 3JATB 3N2KB 4O4IB 1U3PA 1QVGF 2YYEA 2VAMA 3CC7F 1IPAA 1TUBA 1S72F 2HX0A 3RYIB 4BT3A 3LFOA 3E22A 5EO3A 5EZYB 1IV3A 4IHJA 3MCQA 2ALEA 3HWUA 2ZODA 1KNJA 3R0PA 3NK6A 4U39A 2HRUA 2W8BC 2AIFA 2HP0A 2ZF8A 3OW2F 1QAHA 4ZHYB 4ZHQB 3WGMA 4BVTA 4HNAB 3T80A 5JH7A 2GLZA 2OTLF 2VGNA 5KX5B 3RYHA 4TV9A 3S06A 3MDOA 4O2AA 3UT5A 2JNBA 3J80M 3JAMM 4LNUA 5FNVA 2RHOA 3JATA 2B33A 4O4IA 5CA0B 1YIJF 1FFXB 1VHAA 2MQEA 5FJ4C 3RA6A 2RHLA 3V7QA 1GX1A 2BTUA 3IR9A 1XHOA 3RYIA 5A2QM 1VH8A 1RA4A 3NVIB 5J2TA 3VOAA 2N48A 3ELCA 1QVFF 1GZ0A 4ZOLB 2UYPA 3RE3A 2I6RA 4C8GA 3JAKB 5HY1A 1YI2F 4I50B 5HP7A 3DDNA 2HS0A 3F0EA 2EWCA 4NWOB 1RLUA 2FC3A 3QTYA 4TUYA 5GIOC 2HQSC 4I4TA 3LYBA 4LCKA 5DCVA 4ZHQA 1FSZA 3P10A 4HNAA 2DT4A 2F9ZC 1VQ5F 4RHAA 2CWJA 3C8LA 4BT6A 1K9MH 3CXCF 5KX5A 3NVKE 3CCEF 1H7MA 1QD9A 3AGKA 2LCAA 3CD6F 5LYJA 5ITZA 1SA0B 4X20B 2G9IA 3WJRA 3K2XA 4O4LB 2OTJF 3SIVA 3CYPB 3CC4F 1W5FA 3CCUF 1VQMF 1W5BA 2OHWA 1PXWA 1Z5VA 3CPWF 3KE1A 3IMPA 5GAPK 1JFFA 3ZO8A 1H48A 4O4JA 5HP8A 3LWOC 1OAPA 2KGWA 2QEXF 5IJ0B 1KD1H 4I50A 5JCOC 1COMA 3V3TA 1YJNF 1ZWZA 1R1MA 3CCJF 4EI9A 4G4ZA 2P6YA 3HKDB 1TUBB 3PLAC 3F0FA 3E22B 4IIJB 3F6MA 3ON1A 2Q1YA 2H8EA 2V9YA 4DXDA 3TD3A 4G4WA 1J7HA 3WXMB 4X1YA 5HY0A 2RB9A 3HKBB 1GO1A 3ZOPA 1PF5A 3VCZA 1X25A 3JARA 2R6R1 3I7TA 1N8RH 3WPXA 3VO8A 2AIZP 2KTVA 5IJ0A 3RYHB 4TV9B 3V4DA 4O2AB 2UYJA 5FNVB 1VQPF 3KJKA 4G4XA 3CCRF 1VQ7F 4C81A 2VXYA 3CPQA 5LOVB 3HKDA 1UFYA 2QTPA 1RQ2A 4IIJA 5J2TB 3LWQC 1QU9A 5HY2A 3KIZA 1VQ4F 3N2GB 1YJ9F 1M1KH 1GO0A 4C82A 3ZP4A 1W5EA 3HKBA 2VAWA 3P4EA 4RQOA 4E6EA 3FFMA 4TUYB 4I4TB 2GVIA 3I56F 5JCOA 3JAWA 1YQNA 3CB2A 1YGYA 4BVRA 5EIBC 5LYJB 5ITZB 5JVDA 3CCMF 1SDSA 3S0YA 3N4YA 2HS3A 4X3MA 3KJJA 3TD5A 3FBAA 5LOVA 1XRGA 4TV8A 2Z1TA 4C8IA 2ZAUA 1E7KA
chains in the Genus database with same CATH topology
2HP0B 1SZQA 2HP3A 2HP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP0 B;  1SZQ A;  2HP3 A;  2HP0 A; 
#chains in the Genus database with same CATH topology
 3LDT A;  1KC8 H;  1JFF B;  1ONI A;  3N2G A;  3IEW A;  4O4J B;  5CB4 A;  3HAX D;  3VYU C;  3CCQ F;  1H47 A;  3D54 A;  5EIB D;  3M84 A;  2CZW A;  4B62 A;  5IYZ A;  3E1Y A;  3MQW A;  5HXZ A;  3Q8H A;  4ERH A;  2IG8 A;  5LXT B;  2K1S A;  1W59 A;  5MN5 A;  3RYC A;  5IJ9 A;  2QI2 A;  4YJ2 A;  3QUW A;  5EYP A;  5GON A;  2BTQ B;  2IQQ A;  2CVL A;  3K12 A;  4ZI7 B;  3FD6 A;  4R40 B;  3B6N A;  3MBM A;  2UZH A;  3WJP A;  4X1Y B;  3ZP7 A;  3NMU C;  3JAR B;  2HS4 A;  3D00 A;  2RHJ A;  1W5A A;  3DC2 A;  5CA1 A;  4X1I A;  1CLI A;  1W57 A;  2BTO A;  3F0G A;  4FFB B;  2LBX A;  2BO1 A;  3SIU A;  2H6L A;  2GZL A;  2CHS A;  4EB6 B;  3JAS A;  3J7A R;  3VIU A;  2LBW A;  2L26 A;  4X1K A;  3VYS C;  1Q82 H;  5MN6 A;  1RLG A;  5J2U B;  3G4S F;  4G88 A;  2LBT A;  5LXT A;  1DT9 A;  3RA5 A;  5JQG B;  1VQL F;  3C9U A;  1TVK B;  3VI6 A;  4ZHV A;  3IKE A;  4ZI7 A;  3C9T A;  2YXZ A;  2KTU A;  4BW0 B;  3FD5 A;  5GIP C;  3TD4 A;  4B5C A;  2H8C A;  4G4V A;  5LA6 B;  2ZOV A;  1CK2 A;  3I3F A;  3CG6 A;  4BT4 A;  1U43 A;  4NQ3 A;  1XV2 A;  1YIT F;  4KWE A;  5LP6 C;  3WGK A;  5IT9 M;  4BT5 A;  4FFB A;  3JAW B;  5AVM A;  3FPI A;  3OBW A;  2KG4 A;  4EB6 A;  3JVH A;  2HRY A;  5JVD B;  1JJ2 F;  5J2U A;  1W41 A;  2Z01 A;  3HJW C;  2OZB A;  3K0T A;  3NK7 A;  3RYF A;  1U3L A;  5JQG A;  1Q7Y H;  3HKC B;  4TV8 B;  4C8E A;  3VYT C;  3WGN A;  3GTZ A;  1TVK A;  5HY4 A;  3CC2 F;  4ZK7 A;  1IV1 A;  5HXU A;  1VQO F;  3BYQ A;  2AMT A;  3LWP C;  5CB4 B;  3L7Q A;  3CCV F;  3G6E F;  5LA6 A;  1VQN F;  1X7O A;  5IYZ B;  1W42 A;  5LP6 B;  4G4Y A;  3JAL A;  4EI7 A;  1NMU B;  2Q1X A;  1FNJ A;  4WBN B;  1YJW F;  5EWR A;  3RYC B;  3E20 B;  1W40 A;  4YJ2 B;  1Q8R A;  4PWT A;  5EYP B;  5GON B;  5IJ9 B;  1VQK F;  2UYN A;  2Z1U A;  1OFU A;  2FGY A;  1IV2 A;  4I55 B;  3P0Z A;  3I55 F;  3WGL A;  2Z1F A;  3IKF A;  1NQ3 A;  3M4S A;  1SZQ A;  3HKC A;  3HKE A;  3VTI C;  4O2B A;  3LWV C;  3S03 A;  4F6R A;  3MCA B;  4U3J B;  4O4H B;  2RHH A;  4BT7 A;  4DRX A;  1K8A H;  1VQ9 F;  3KHN A;  5CA1 B;  2DYY A;  4X1I B;  2VAP A;  3CME F;  3O85 A;  5GIN C;  1Q81 H;  3WJQ A;  3JAS B;  3N2K A;  4X1K B;  5LP6 A;  3ESJ A;  1M90 H;  3GHZ A;  4WBN A;  1VQV A;  1IV4 A;  1DBF A;  5EZY A;  3D01 A;  1W55 A;  3J81 M;  5KMG B;  4C4W C;  3HTN A;  4I55 A;  4NUT A;  2QA4 F;  3IEQ A;  3S02 A;  2PHN A;  3S0H A;  1YHQ F;  1RQ7 A;  4YJ3 B;  1ODE A;  3C9S A;  5EB0 A;  2PMP A;  4O4H A;  4U3J A;  5C8Y B;  3C9R A;  2OTM A;  1Z5W A;  1NJI H;  3CCS F;  3LWR C;  2Z1E A;  1JD1 A;  3VOB A;  3G71 F;  3OBY A;  5CA0 A;  1KQS F;  3N4Z A;  2ZVZ A;  1FFX A;  2IAF A;  2R75 1;  2UYK A;  3CMA F;  2CHT A;  3RYF B;  3JCM M;  3M1X A;  5BMV B;  3CCL F;  1JY8 A;  3LME A;  3VMF B;  1VQ6 F;  2ZVY A;  1W3E X;  1W58 1;  4ZOL A;  5KMG A;  4B46 A;  1XBI A;  3JAK A;  4XCQ A;  1FNK A;  3S0W A;  4BVQ A;  5GAN K;  4YJ3 A;  1KNK A;  4BT2 A;  4BVS A;  5C8Y A;  3JAL B;  1JN1 A;  4B45 A;  1W2B F;  2CW4 A;  1X52 A;  5G4V C;  3GYQ A;  3U0O A;  1U40 A;  3EOR A;  4TZZ A;  3QHD A;  2I6D A;  4BY9 D;  5FLX M;  2UYN B;  3WPW A;  4X3L A;  2WAL A;  4IHJ B;  1VK3 A;  3F0D A;  4EI8 A;  1Q86 H;  1T0K B;  1SA0 A;  4X20 A;  5B8F A;  1CN7 A;  3CYQ A;  3K14 A;  5HWE A;  2NMU A;  4O4L A;  5G4U C;  3WGJ A;  1T0A A;  4M8I A;  1K73 H;  5BMV A;  3OON A;  3HKE B;  2HP0 B;  4O2B B;  2HVY D;  4ZHW A;  4F6R B;  3PAF A;  3ERN A;  2VGM A;  5EB1 B;  5JH7 B;  4DRX B;  1X7P A;  2HP3 A;  2CSL A;  3UT5 B;  5MN4 A;  1UI9 A;  4LNU B;  5EAZ A;  3V7E A;  1VQ8 F;  3JAT B;  3N2K B;  4O4I B;  1U3P A;  1QVG F;  2YYE A;  2VAM A;  3CC7 F;  1IPA A;  1TUB A;  1S72 F;  2HX0 A;  3RYI B;  4BT3 A;  3LFO A;  3E22 A;  5EO3 A;  5EZY B;  1IV3 A;  4IHJ A;  3MCQ A;  2ALE A;  3HWU A;  2ZOD A;  1KNJ A;  3R0P A;  3NK6 A;  4U39 A;  2HRU A;  2W8B C;  2AIF A;  2HP0 A;  2ZF8 A;  3OW2 F;  1QAH A;  4ZHY B;  4ZHQ B;  3WGM A;  4BVT A;  4HNA B;  3T80 A;  5JH7 A;  2GLZ A;  2OTL F;  2VGN A;  5KX5 B;  3RYH A;  4TV9 A;  3S06 A;  3MDO A;  4O2A A;  3UT5 A;  2JNB A;  3J80 M;  3JAM M;  4LNU A;  5FNV A;  2RHO A;  3JAT A;  2B33 A;  4O4I A;  5CA0 B;  1YIJ F;  1FFX B;  1VHA A;  2MQE A;  5FJ4 C;  3RA6 A;  2RHL A;  3V7Q A;  1GX1 A;  2BTU A;  3IR9 A;  1XHO A;  3RYI A;  5A2Q M;  1VH8 A;  1RA4 A;  3NVI B;  5J2T A;  3VOA A;  2N48 A;  3ELC A;  1QVF F;  1GZ0 A;  4ZOL B;  2UYP A;  3RE3 A;  2I6R A;  4C8G A;  3JAK B;  5HY1 A;  1YI2 F;  4I50 B;  5HP7 A;  3DDN A;  2HS0 A;  3F0E A;  2EWC A;  4NWO B;  1RLU A;  2FC3 A;  3QTY A;  4TUY A;  5GIO C;  2HQS C;  4I4T A;  3LYB A;  4LCK A;  5DCV A;  4ZHQ A;  1FSZ A;  3P10 A;  4HNA A;  2DT4 A;  2F9Z C;  1VQ5 F;  4RHA A;  2CWJ A;  3C8L A;  4BT6 A;  1K9M H;  3CXC F;  5KX5 A;  3NVK E;  3CCE F;  1H7M A;  1QD9 A;  3AGK A;  2LCA A;  3CD6 F;  5LYJ A;  5ITZ A;  1SA0 B;  4X20 B;  2G9I A;  3WJR A;  3K2X A;  4O4L B;  2OTJ F;  3SIV A;  3CYP B;  3CC4 F;  1W5F A;  3CCU F;  1VQM F;  1W5B A;  2OHW A;  1PXW A;  1Z5V A;  3CPW F;  3KE1 A;  3IMP A;  5GAP K;  1JFF A;  3ZO8 A;  1H48 A;  4O4J A;  5HP8 A;  3LWO C;  1OAP A;  2KGW A;  2QEX F;  5IJ0 B;  1KD1 H;  4I50 A;  5JCO C;  1COM A;  3V3T A;  1YJN F;  1ZWZ A;  1R1M A;  3CCJ F;  4EI9 A;  4G4Z A;  2P6Y A;  3HKD B;  1TUB B;  3PLA C;  3F0F A;  3E22 B;  4IIJ B;  3F6M A;  3ON1 A;  2Q1Y A;  2H8E A;  2V9Y A;  4DXD A;  3TD3 A;  4G4W A;  1J7H A;  3WXM B;  4X1Y A;  5HY0 A;  2RB9 A;  3HKB B;  1GO1 A;  3ZOP A;  1PF5 A;  3VCZ A;  1X25 A;  3JAR A;  2R6R 1;  3I7T A;  1N8R H;  3WPX A;  3VO8 A;  2AIZ P;  2KTV A;  5IJ0 A;  3RYH B;  4TV9 B;  3V4D A;  4O2A B;  2UYJ A;  5FNV B;  1VQP F;  3KJK A;  4G4X A;  3CCR F;  1VQ7 F;  4C81 A;  2VXY A;  3CPQ A;  5LOV B;  3HKD A;  1UFY A;  2QTP A;  1RQ2 A;  4IIJ A;  5J2T B;  3LWQ C;  1QU9 A;  5HY2 A;  3KIZ A;  1VQ4 F;  3N2G B;  1YJ9 F;  1M1K H;  1GO0 A;  4C82 A;  3ZP4 A;  1W5E A;  3HKB A;  2VAW A;  3P4E A;  4RQO A;  4E6E A;  3FFM A;  4TUY B;  4I4T B;  2GVI A;  3I56 F;  5JCO A;  3JAW A;  1YQN A;  3CB2 A;  1YGY A;  4BVR A;  5EIB C;  5LYJ B;  5ITZ B;  5JVD A;  3CCM F;  1SDS A;  3S0Y A;  3N4Y A;  2HS3 A;  4X3M A;  3KJJ A;  3TD5 A;  3FBA A;  5LOV A;  1XRG A;  4TV8 A;  2Z1T A;  4C8I A;  2ZAU A;  1E7K A; 
#chains in the Genus database with same CATH homology
 2HP0 B;  1SZQ A;  2HP3 A;  2HP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...