2W8BC

Crystal structure of processed tolb in complex with pal
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
104
Chain Sequence
NNIVYFDLDKYDIRSDFAQMLDAHANFLRSSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/membrane protein
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
total genus 34
structure length 104
sequence length 106
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2w8bC00
3CYPB 4B62A 4PWTA 2LBTA 2MQEA 3S02A 2ZOVA 3WPWA 1R1MA 3S0YA 4ZHYB 1OAPA 3OONA 4G4VA 2ZVZA 3CYQA 4ZHWA 3S03A 4B5CA 3KHNA 2HQSC 2LCAA 4G88A 4RHAA 4R40B 4G4ZA 3TD5A 2AIZP 5EB0A 3TD3A 4G4YA 5EAZA 3S0WA 2KGWA 3S0HA 2K1SA 2N48A 2ZF8A 3TD4A 4ERHA 3S06A 2L26A 3LDTA 2W8BC 3IMPA 4G4WA 5EB1B 3WPXA 2ZVYA 4G4XA 4ZHVA
chains in the Genus database with same CATH superfamily
5CA0A 5JVDA 4B62A 4M8IA 5GONB 3CXCF 1KQSF 3E20B 2Z1EA 1UFYA 5CB4A 1IPAA 2AMTA 4B5CA 3HKEA 1K9MH 4LNUA 3FFMA 5JH7B 2QTPA 3LWRC 1PF5A 4G4YA 5GIPC 3B6NA 2CVLA 2P6YA 2RHOA 1NJIH 2Z1UA 2OTLF 5LYJB 1UI9A 1W5AA 3ZP7A 1Q81H 4G4WA 3PAFA 1VQVA 5J2UA 4PWTA 4BVQA 1W55A 3M4SA 2JNBA 1KNJA 4X1YA 2Z1TA 4BT4A 3VO8A 4ZHYB 1Q86H 3HJWC 3GTZA 4NQ3A 1H48A 2UYNB 1U3PA 2ZVZA 5JVDB 5CA0B 2H8CA 5BMVA 4KWEA 2UYJA 4FFBA 1RQ7A 3KJKA 2OHWA 2K1SA 4ERHA 5IYZA 4LNUB 3KJJA 5FJ4C 3Q8HA 3JARA 5HXZA 5EIBD 4B46A 3NVIB 2ZOVA 2DT4A 3SIUA 5MN4A 3F0EA 2KTUA 2RHHA 2IAFA 2VAWA 1VQ7F 1Q8RA 4ZHWA 5HXUA 1VQLF 5HWEA 3GYQA 5EZYA 4X1YB 1RLGA 3VCZA 2H8EA 1YI2F 3LFOA 3F6MA 3R0PA 1ONIA 2N48A 2R6R1 1SDSA 1X7PA 1Z5WA 4O2AA 5BMVB 3RA6A 1PXWA 3C8LA 1JN1A 4EI7A 3FD5A 3LWQC 5LP6A 4FFBB 2ZODA 4ZI7B 1W42A 3IEWA 3FBAA 3LWPC 2DYYA 2PMPA 2RB9A 5CA1A 3JARB 1N8RH 3RYHA 1W5FA 3AGKA 2LCAA 4ZOLB 3IKEA 4WBNA 1YJ9F 1W2BF 1J7HA 5EB0A 3OW2F 4BT2A 5KX5A 2HS3A 4NUTA 1RQ2A 3HKCB 5GIOC 3L7QA 3G4SF 3CCEF 3V3TA 4G4XA 3JASB 4X3LA 3QHDA 1FSZA 3S02A 5JCOC 2VXYA 3J7AR 2HRUA 5HP8A 2OZBA 1W57A 3NK6A 3F0GA 3E22B 2CSLA 4IIJB 3IKFA 3JATA 1NMUB 3FD6A 1T0AA 1VQOF 3VIUA 2RHJA 1GZ0A 3OBWA 1JJ2F 2OTMA 3KE1A 1FNKA 3MQWA 5CA1B 2KGWA 2ZF8A 2FGYA 4O4HA 1CN7A 3LDTA 1QD9A 2WALA 2UZHA 2UYNA 5KX5B 3LWOC 1VQPF 1IV3A 5C8YA 3RYCA 2CWJA 2VGMA 1QAHA 1NQ3A 1RLUA 4BT3A 3CYQA 2NMUA 2YXZA 1YIJF 3NMUC 5J2TB 3N2KA 4G4ZA 1QVFF 2VAMA 5GANK 3OBYA 3WXMB 3F0DA 2BTOA 3K2XA 1XRGA 3JATB 2LBXA 4BT5A 3LWVC 5EB1B 3WGNA 5JQGA 1CK2A 1CLIA 4B45A 1H7MA 3HTNA 1W40A 2KTVA 4O4HB 3P10A 3ZP4A 5HP7A 1S72F 4O4IB 5HY2A 4TV8A 3VYUC 3S03A 4I55B 3J80M 4G88A 5C8YB 3RYCB 2HX0A 3HAXD 3CD6F 4BVSA 3SIVA 3CG6A 3TD3A 3S0WA 3I55F 1IV4A 3JVHA 5LXTB 2L26A 4ZI7A 3I3FA 3KIZA 3N2KB 1DBFA 1U43A 1M1KH 3VI6A 1W41A 3HKBA 1TUBA 3WGKA 4ZOLA 3WPWA 3D00A 3E1YA 3T80A 1JFFA 2GVIA 5JQGB 2VAPA 3WGJA 1TVKB 3EORA 4G4VA 3HKCA 1W3EX 3ELCA 5G4UC 1IV1A 3TD5A 3D01A 1FNJA 2HS4A 3JASA 3K12A 4TV8B 3J81M 4I50B 1KD1H 2CZWA 3FPIA 1M90H 1VH8A 4X1IA 1VQ5F 4ZHQA 2LBTA 1KNKA 2G9IA 4TUYB 3RA5A 3E22A 4IIJA 3VOBA 3K0TA 3MCQA 3CC7F 3N2GB 1W581 2ZAUA 2V9YA 3HKBB 4NWOB 1VHAA 1TUBB 1ODEA 4DRXA 1X25A 1W59A 2AIZP 5EYPA 3VOAA 1JFFB 4C8IA 3CCUF 4IHJA 3M1XA 5ITZA 2Q1XA 5LOVB 3ON1A 4I4TB 1DT9A 4X1KB 1Q82H 3IR9A 3JAKB 2UYPA 3CB2A 1R1MA 5J2TA 5B8FA 3NVKE 2IQQA 3WGMA 4EI8A 5AVMA 3V7EA 2H6LA 2HRYA 4X1IB 3N4YA 1GX1A 4BW0B 4ZHQB 3C9RA 2B33A 3O85A 2HP0A 1YQNA 4O2BB 3HKDA 3S0HA 1SA0A 3CCVF 2EWCA 2RHLA 3I56F 3S06A 2I6DA 1ZWZA 1VQ6F 2I6RA 3CPQA 4O4IA 3ZOPA 4DRXB 4F6RA 4YJ2A 2ZVYA 3ZO8A 4C82A 5EYPB 4HNAB 4DXDA 2QEXF 4I55A 4IHJB 4X3MA 1VQKF 2YYEA 3VYSC 5ITZB 3WJPA 5FLXM 5A2QM 1XBIA 5IJ9A 4TV9B 4U3JB 5LXTA 2BTQB 3M84A 5GAPK 4R40B 3VTIC 1YHQF 5DCVA 3V7QA 3U0OA 2HP3A 3TD4A 3JAWB 2KG4A 3K14A 2HS0A 1X52A 4X20A 5LA6B 3V4DA 2HP0B 1VQ9F 3D54A 1TVKA 3C9TA 4EB6B 1QVGF 1QU9A 3HKDB 5EO3A 5EIBC 1SA0B 2VGNA 5EWRA 1VQMF 3MCAB 1VQ4F 4YJ2B 5JCOA 5HY1A 4F6RB 1OFUA 4I50A 3I7TA 3CCRF 5FNVA 1E7KA 3CCLF 4BY9D 4RHAA 2LBWA 1X7OA 1COMA 3JALB 4TUYA 1KC8H 3VYTC 1XHOA 5IJ9B 4XCQA 5LP6C 3N2GA 5IJ0A 4C4WC 3QUWA 3LYBA 1U40A 1T0KB 2MQEA 4C8GA 3GHZA 5GINC 3RE3A 4X20B 3OONA 3HWUA 5HY0A 3JAMM 4TZZA 4BVTA 5CB4B 4O4JA 1U3LA 5LOVA 2CHTA 5EAZA 4I4TA 4X1KA 3HKEB 4LCKA 3JAKA 5FNVB 4BT7A 3BYQA 3IMPA 1XV2A 5IT9M 3C9SA 4ZHVA 1W5BA 1VQ8F 2Z01A 2FC3A 4YJ3A 4U39A 1YGYA 1VK3A 3N4ZA 2AIFA 3CCJF 3ESJA 4RQOA 5IJ0B 4O2BA 5J2UB 3G71F 4O4LA 2QA4F 1YITF 2ALEA 3KHNA 1JD1A 1GO0A 3NK7A 3UT5A 2QI2A 4HNAA 3PLAC 1Z5VA 2Z1FA 4BVRA 3CCSF 3WGLA 3DC2A 2Q1YA 2PHNA 2GLZA 2W8BC 2CW4A 5KMGA 3RYIA 5HY4A 1JY8A 1FFXA 3CYPB 4O4JB 4TV9A 4U3JA 1VQNF 5IYZB 3S0YA 2BO1A 2F9ZC 1OAPA 1W5EA 2BTUA 3LMEA 3P0ZA 1YJWF 3JAWA 1Q7YH 3MDOA 2HQSC 4YJ3B 5LA6A 3RYFA 3IEQA 3WJQA 2GZLA 4C8EA 5GONA 3G6EF 2CHSA 1YJNF 4EB6A 3CC2F 3CCMF 4O4LB 3JCMM 5G4VC 5EZYB 2IG8A 3P4EA 3ERNA 2OTJF 3CC4F 3WJRA 3UT5B 1K73H 4C81A 4EI9A 3CPWF 5JH7A 3VMFB 4O2AB 3MBMA 3C9UA 5KMGB 3DDNA 3RYIB 5MN5A 1IV2A 5LP6B 3JALA 1FFXB 2HVYD 5LYJA 1GO1A 3CCQF 3QTYA 3F0FA 3CMEF 4ZK7A 4E6EA 5MN6A 3RYHB 3CMAF 2R751 1H47A 2UYKA 1RA4A 1SZQA 4BT6A 4WBNB 3WPXA 1K8AH 3RYFB
chains in the Genus database with same CATH topology
3CYPB 4B62A 4PWTA 2LBTA 2MQEA 3S02A 2ZOVA 3WPWA 1R1MA 3S0YA 4ZHYB 1OAPA 3OONA 4G4VA 2ZVZA 3CYQA 4ZHWA 3S03A 4B5CA 3KHNA 2HQSC 2LCAA 4G88A 4RHAA 4R40B 4G4ZA 3TD5A 2AIZP 5EB0A 3TD3A 4G4YA 5EAZA 3S0WA 2KGWA 3S0HA 2K1SA 2N48A 2ZF8A 3TD4A 4ERHA 3S06A 2L26A 3LDTA 2W8BC 3IMPA 4G4WA 5EB1B 3WPXA 2ZVYA 4G4XA 4ZHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYP B;  4B62 A;  4PWT A;  2LBT A;  2MQE A;  3S02 A;  2ZOV A;  3WPW A;  1R1M A;  3S0Y A;  4ZHY B;  1OAP A;  3OON A;  4G4V A;  2ZVZ A;  3CYQ A;  4ZHW A;  3S03 A;  4B5C A;  3KHN A;  2HQS C;  2LCA A;  4G88 A;  4RHA A;  4R40 B;  4G4Z A;  3TD5 A;  2AIZ P;  5EB0 A;  3TD3 A;  4G4Y A;  5EAZ A;  3S0W A;  2KGW A;  3S0H A;  2K1S A;  2N48 A;  2ZF8 A;  3TD4 A;  4ERH A;  3S06 A;  2L26 A;  3LDT A;  2W8B C;  3IMP A;  4G4W A;  5EB1 B;  3WPX A;  2ZVY A;  4G4X A;  4ZHV A; 
#chains in the Genus database with same CATH topology
 5CA0 A;  5JVD A;  4B62 A;  4M8I A;  5GON B;  3CXC F;  1KQS F;  3E20 B;  2Z1E A;  1UFY A;  5CB4 A;  1IPA A;  2AMT A;  4B5C A;  3HKE A;  1K9M H;  4LNU A;  3FFM A;  5JH7 B;  2QTP A;  3LWR C;  1PF5 A;  4G4Y A;  5GIP C;  3B6N A;  2CVL A;  2P6Y A;  2RHO A;  1NJI H;  2Z1U A;  2OTL F;  5LYJ B;  1UI9 A;  1W5A A;  3ZP7 A;  1Q81 H;  4G4W A;  3PAF A;  1VQV A;  5J2U A;  4PWT A;  4BVQ A;  1W55 A;  3M4S A;  2JNB A;  1KNJ A;  4X1Y A;  2Z1T A;  4BT4 A;  3VO8 A;  4ZHY B;  1Q86 H;  3HJW C;  3GTZ A;  4NQ3 A;  1H48 A;  2UYN B;  1U3P A;  2ZVZ A;  5JVD B;  5CA0 B;  2H8C A;  5BMV A;  4KWE A;  2UYJ A;  4FFB A;  1RQ7 A;  3KJK A;  2OHW A;  2K1S A;  4ERH A;  5IYZ A;  4LNU B;  3KJJ A;  5FJ4 C;  3Q8H A;  3JAR A;  5HXZ A;  5EIB D;  4B46 A;  3NVI B;  2ZOV A;  2DT4 A;  3SIU A;  5MN4 A;  3F0E A;  2KTU A;  2RHH A;  2IAF A;  2VAW A;  1VQ7 F;  1Q8R A;  4ZHW A;  5HXU A;  1VQL F;  5HWE A;  3GYQ A;  5EZY A;  4X1Y B;  1RLG A;  3VCZ A;  2H8E A;  1YI2 F;  3LFO A;  3F6M A;  3R0P A;  1ONI A;  2N48 A;  2R6R 1;  1SDS A;  1X7P A;  1Z5W A;  4O2A A;  5BMV B;  3RA6 A;  1PXW A;  3C8L A;  1JN1 A;  4EI7 A;  3FD5 A;  3LWQ C;  5LP6 A;  4FFB B;  2ZOD A;  4ZI7 B;  1W42 A;  3IEW A;  3FBA A;  3LWP C;  2DYY A;  2PMP A;  2RB9 A;  5CA1 A;  3JAR B;  1N8R H;  3RYH A;  1W5F A;  3AGK A;  2LCA A;  4ZOL B;  3IKE A;  4WBN A;  1YJ9 F;  1W2B F;  1J7H A;  5EB0 A;  3OW2 F;  4BT2 A;  5KX5 A;  2HS3 A;  4NUT A;  1RQ2 A;  3HKC B;  5GIO C;  3L7Q A;  3G4S F;  3CCE F;  3V3T A;  4G4X A;  3JAS B;  4X3L A;  3QHD A;  1FSZ A;  3S02 A;  5JCO C;  2VXY A;  3J7A R;  2HRU A;  5HP8 A;  2OZB A;  1W57 A;  3NK6 A;  3F0G A;  3E22 B;  2CSL A;  4IIJ B;  3IKF A;  3JAT A;  1NMU B;  3FD6 A;  1T0A A;  1VQO F;  3VIU A;  2RHJ A;  1GZ0 A;  3OBW A;  1JJ2 F;  2OTM A;  3KE1 A;  1FNK A;  3MQW A;  5CA1 B;  2KGW A;  2ZF8 A;  2FGY A;  4O4H A;  1CN7 A;  3LDT A;  1QD9 A;  2WAL A;  2UZH A;  2UYN A;  5KX5 B;  3LWO C;  1VQP F;  1IV3 A;  5C8Y A;  3RYC A;  2CWJ A;  2VGM A;  1QAH A;  1NQ3 A;  1RLU A;  4BT3 A;  3CYQ A;  2NMU A;  2YXZ A;  1YIJ F;  3NMU C;  5J2T B;  3N2K A;  4G4Z A;  1QVF F;  2VAM A;  5GAN K;  3OBY A;  3WXM B;  3F0D A;  2BTO A;  3K2X A;  1XRG A;  3JAT B;  2LBX A;  4BT5 A;  3LWV C;  5EB1 B;  3WGN A;  5JQG A;  1CK2 A;  1CLI A;  4B45 A;  1H7M A;  3HTN A;  1W40 A;  2KTV A;  4O4H B;  3P10 A;  3ZP4 A;  5HP7 A;  1S72 F;  4O4I B;  5HY2 A;  4TV8 A;  3VYU C;  3S03 A;  4I55 B;  3J80 M;  4G88 A;  5C8Y B;  3RYC B;  2HX0 A;  3HAX D;  3CD6 F;  4BVS A;  3SIV A;  3CG6 A;  3TD3 A;  3S0W A;  3I55 F;  1IV4 A;  3JVH A;  5LXT B;  2L26 A;  4ZI7 A;  3I3F A;  3KIZ A;  3N2K B;  1DBF A;  1U43 A;  1M1K H;  3VI6 A;  1W41 A;  3HKB A;  1TUB A;  3WGK A;  4ZOL A;  3WPW A;  3D00 A;  3E1Y A;  3T80 A;  1JFF A;  2GVI A;  5JQG B;  2VAP A;  3WGJ A;  1TVK B;  3EOR A;  4G4V A;  3HKC A;  1W3E X;  3ELC A;  5G4U C;  1IV1 A;  3TD5 A;  3D01 A;  1FNJ A;  2HS4 A;  3JAS A;  3K12 A;  4TV8 B;  3J81 M;  4I50 B;  1KD1 H;  2CZW A;  3FPI A;  1M90 H;  1VH8 A;  4X1I A;  1VQ5 F;  4ZHQ A;  2LBT A;  1KNK A;  2G9I A;  4TUY B;  3RA5 A;  3E22 A;  4IIJ A;  3VOB A;  3K0T A;  3MCQ A;  3CC7 F;  3N2G B;  1W58 1;  2ZAU A;  2V9Y A;  3HKB B;  4NWO B;  1VHA A;  1TUB B;  1ODE A;  4DRX A;  1X25 A;  1W59 A;  2AIZ P;  5EYP A;  3VOA A;  1JFF B;  4C8I A;  3CCU F;  4IHJ A;  3M1X A;  5ITZ A;  2Q1X A;  5LOV B;  3ON1 A;  4I4T B;  1DT9 A;  4X1K B;  1Q82 H;  3IR9 A;  3JAK B;  2UYP A;  3CB2 A;  1R1M A;  5J2T A;  5B8F A;  3NVK E;  2IQQ A;  3WGM A;  4EI8 A;  5AVM A;  3V7E A;  2H6L A;  2HRY A;  4X1I B;  3N4Y A;  1GX1 A;  4BW0 B;  4ZHQ B;  3C9R A;  2B33 A;  3O85 A;  2HP0 A;  1YQN A;  4O2B B;  3HKD A;  3S0H A;  1SA0 A;  3CCV F;  2EWC A;  2RHL A;  3I56 F;  3S06 A;  2I6D A;  1ZWZ A;  1VQ6 F;  2I6R A;  3CPQ A;  4O4I A;  3ZOP A;  4DRX B;  4F6R A;  4YJ2 A;  2ZVY A;  3ZO8 A;  4C82 A;  5EYP B;  4HNA B;  4DXD A;  2QEX F;  4I55 A;  4IHJ B;  4X3M A;  1VQK F;  2YYE A;  3VYS C;  5ITZ B;  3WJP A;  5FLX M;  5A2Q M;  1XBI A;  5IJ9 A;  4TV9 B;  4U3J B;  5LXT A;  2BTQ B;  3M84 A;  5GAP K;  4R40 B;  3VTI C;  1YHQ F;  5DCV A;  3V7Q A;  3U0O A;  2HP3 A;  3TD4 A;  3JAW B;  2KG4 A;  3K14 A;  2HS0 A;  1X52 A;  4X20 A;  5LA6 B;  3V4D A;  2HP0 B;  1VQ9 F;  3D54 A;  1TVK A;  3C9T A;  4EB6 B;  1QVG F;  1QU9 A;  3HKD B;  5EO3 A;  5EIB C;  1SA0 B;  2VGN A;  5EWR A;  1VQM F;  3MCA B;  1VQ4 F;  4YJ2 B;  5JCO A;  5HY1 A;  4F6R B;  1OFU A;  4I50 A;  3I7T A;  3CCR F;  5FNV A;  1E7K A;  3CCL F;  4BY9 D;  4RHA A;  2LBW A;  1X7O A;  1COM A;  3JAL B;  4TUY A;  1KC8 H;  3VYT C;  1XHO A;  5IJ9 B;  4XCQ A;  5LP6 C;  3N2G A;  5IJ0 A;  4C4W C;  3QUW A;  3LYB A;  1U40 A;  1T0K B;  2MQE A;  4C8G A;  3GHZ A;  5GIN C;  3RE3 A;  4X20 B;  3OON A;  3HWU A;  5HY0 A;  3JAM M;  4TZZ A;  4BVT A;  5CB4 B;  4O4J A;  1U3L A;  5LOV A;  2CHT A;  5EAZ A;  4I4T A;  4X1K A;  3HKE B;  4LCK A;  3JAK A;  5FNV B;  4BT7 A;  3BYQ A;  3IMP A;  1XV2 A;  5IT9 M;  3C9S A;  4ZHV A;  1W5B A;  1VQ8 F;  2Z01 A;  2FC3 A;  4YJ3 A;  4U39 A;  1YGY A;  1VK3 A;  3N4Z A;  2AIF A;  3CCJ F;  3ESJ A;  4RQO A;  5IJ0 B;  4O2B A;  5J2U B;  3G71 F;  4O4L A;  2QA4 F;  1YIT F;  2ALE A;  3KHN A;  1JD1 A;  1GO0 A;  3NK7 A;  3UT5 A;  2QI2 A;  4HNA A;  3PLA C;  1Z5V A;  2Z1F A;  4BVR A;  3CCS F;  3WGL A;  3DC2 A;  2Q1Y A;  2PHN A;  2GLZ A;  2W8B C;  2CW4 A;  5KMG A;  3RYI A;  5HY4 A;  1JY8 A;  1FFX A;  3CYP B;  4O4J B;  4TV9 A;  4U3J A;  1VQN F;  5IYZ B;  3S0Y A;  2BO1 A;  2F9Z C;  1OAP A;  1W5E A;  2BTU A;  3LME A;  3P0Z A;  1YJW F;  3JAW A;  1Q7Y H;  3MDO A;  2HQS C;  4YJ3 B;  5LA6 A;  3RYF A;  3IEQ A;  3WJQ A;  2GZL A;  4C8E A;  5GON A;  3G6E F;  2CHS A;  1YJN F;  4EB6 A;  3CC2 F;  3CCM F;  4O4L B;  3JCM M;  5G4V C;  5EZY B;  2IG8 A;  3P4E A;  3ERN A;  2OTJ F;  3CC4 F;  3WJR A;  3UT5 B;  1K73 H;  4C81 A;  4EI9 A;  3CPW F;  5JH7 A;  3VMF B;  4O2A B;  3MBM A;  3C9U A;  5KMG B;  3DDN A;  3RYI B;  5MN5 A;  1IV2 A;  5LP6 B;  3JAL A;  1FFX B;  2HVY D;  5LYJ A;  1GO1 A;  3CCQ F;  3QTY A;  3F0F A;  3CME F;  4ZK7 A;  4E6E A;  5MN6 A;  3RYH B;  3CMA F;  2R75 1;  1H47 A;  2UYK A;  1RA4 A;  1SZQ A;  4BT6 A;  4WBN B;  3WPX A;  1K8A H;  3RYF B; 
#chains in the Genus database with same CATH homology
 3CYP B;  4B62 A;  4PWT A;  2LBT A;  2MQE A;  3S02 A;  2ZOV A;  3WPW A;  1R1M A;  3S0Y A;  4ZHY B;  1OAP A;  3OON A;  4G4V A;  2ZVZ A;  3CYQ A;  4ZHW A;  3S03 A;  4B5C A;  3KHN A;  2HQS C;  2LCA A;  4G88 A;  4RHA A;  4R40 B;  4G4Z A;  3TD5 A;  2AIZ P;  5EB0 A;  3TD3 A;  4G4Y A;  5EAZ A;  3S0W A;  2KGW A;  3S0H A;  2K1S A;  2N48 A;  2ZF8 A;  3TD4 A;  4ERH A;  3S06 A;  2L26 A;  3LDT A;  2W8B C;  3IMP A;  4G4W A;  5EB1 B;  3WPX A;  2ZVY A;  4G4X A;  4ZHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...