2W8BC

Crystal structure of processed tolb in complex with pal
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
104
Chain Sequence
NNIVYFDLDKYDIRSDFAQMLDAHANFLRSSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/membrane protein
total genus 34
structure length 104
sequence length 106
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2w8bC00
4ERHA 3TD3A 2AIZP 1R1MA 4G4ZA 2K1SA 3TD4A 5EB1B 3S0HA 4ZHVA 2N48A 3TD5A 4B62A 4R40B 2LCAA 3LDTA 3CYQA 5EAZA 2LBTA 4PWTA 4ZHYB 3S0YA 2KGWA 2ZOVA 3CYPB 3KHNA 3S06A 4G4YA 3WPXA 3S03A 1OAPA 3IMPA 4G4XA 2MQEA 5EB0A 3S02A 4RHAA 3WPWA 2ZF8A 4ZHWA 4G4VA 4B5CA 4G4WA 2HQSC 2W8BC 4G88A 3S0WA 2L26A 2ZVYA 3OONA 2ZVZA
chains in the Genus database with same CATH superfamily
3QUWA 3RYFB 3WJQA 3VOAA 3F0FA 1JFFA 3UT5B 1VQMF 1JD1A 1YJ9F 3FPIA 3JAKA 3NVKE 3RYHA 3E22B 3ZP7A 2ZOVA 3S06A 1W3EX 3KIZA 3VIUA 2AIFA 5LOVA 1GO0A 1FSZA 5HP7A 1XHOA 2I6RA 3NMUC 2CW4A 4ZHWA 1W5EA 1W581 3F0DA 4G88A 3SIUA 3G71F 2UYNB 5HXZA 3FD6A 5MN4A 1CK2A 1NQ3A 3C9TA 3N4YA 4X20B 2RB9A 3D00A 3HKEB 3JATB 2BTOA 1XBIA 4FFBB 3CYQA 3I7TA 5EAZA 1NJIH 1M1KH 5JH7A 2QEXF 3O85A 2VGMA 5HP8A 2Z01A 5A2QM 4C8EA 4X1IB 3LMEA 4LCKA 5LP6B 3KJKA 2G9IA 3RE3A 4BVSA 1W5FA 3CCMF 3ZO8A 3JAWB 4O4JA 1DBFA 4I4TB 5EO3A 2ZVYA 3C9UA 3TD3A 4IHJA 4G4ZA 5EIBC 2LBWA 5JVDB 4O4LB 2LCAA 1RQ7A 5LYJB 4TZZA 5GANK 3CCSF 2CSLA 4O4HA 1PF5A 3VI6A 3LWPC 3JCMM 5JQGB 4ZHQA 4ZI7A 1CN7A 3S02A 4C4WC 4EI8A 4EI7A 3LWVC 5ITZB 1VQ4F 2OHWA 4G4VA 3FD5A 2HRUA 3JVHA 1W2BF 1VQ7F 3D54A 2DYYA 5LXTB 4F6RB 2OTLF 2GVIA 5AVMA 5G4UC 4C81A 3VO8A 3CPQA 3K12A 5IYZA 5GONA 2YYEA 4YJ2A 3JARB 3RYCB 2OZBA 3WPXA 2VAMA 5JCOA 3FBAA 4BVRA 1Q86H 3ERNA 5EB0A 5CA1B 1YJWF 2AMTA 1JY8A 1IPAA 3JASA 5KMGB 3HKBA 1UFYA 5CB4B 1RA4A 2P6YA 4O2BB 4U3JA 3N2KA 3V7EA 2CVLA 1H7MA 3GHZA 4DRXA 5EZYA 4ZHYB 1Z5WA 2F9ZC 4X1YA 2RHJA 2UYJA 3VYUC 3S03A 1VQKF 1W59A 1N8RH 4BVTA 2IG8A 2HX0A 3WJPA 4TUYB 2ALEA 2V9YA 3CCVF 3WPWA 4O4IA 2Z1EA 1X25A 3VMFB 4BT3A 4TV9A 4C8IA 3G4SF 3G6EF 3CCEF 4G4WA 1FFXB 1W42A 3WGNA 3RYFA 4NWOB 4U39A 4ERHA 3UT5A 3C9RA 2CHSA 1VQ6F 1GZ0A 2HS3A 2HP3A 3E22A 2WALA 2YXZA 3J80M 3CMAF 1IV1A 4I55A 3CD6F 1U3PA 3HTNA 3E20B 5IT9M 3RA5A 5BMVB 1VK3A 3N2GB 3RA6A 3HJWC 4O2AB 5J2TA 3D01A 3QHDA 3IR9A 5GAPK 2UYNA 4EB6B 1SZQA 1YHQF 3OONA 5KX5A 3HKEA 1R1MA 1W5AA 2AIZP 3OBWA 3P0ZA 5J2UB 3OW2F 1YITF 5B8FA 5EB1B 2HRYA 2HS0A 3F0EA 3IEQA 2N48A 1NMUB 3RYIA 2BTQB 3MDOA 4X1IA 3RYHB 5LP6A 1FNKA 1OAPA 1JN1A 4I4TA 2Z1FA 4RHAA 3WGKA 1SA0B 1TUBB 4B5CA 2LBXA 2RHHA 3ZOPA 3I55F 2Z1TA 3FFMA 3ESJA 5JVDA 4I50B 1H48A 4TV8B 2QTPA 4NQ3A 2HS4A 5DCVA 1TVKA 1UI9A 1COMA 2PHNA 3K14A 1ONIA 2CWJA 5JQGA 5LP6C 3NK6A 3PAFA 5C8YB 3S0YA 1K73H 1U3LA 1QD9A 1VQ8F 1T0AA 1VQPF 3U0OA 4G4XA 2RHLA 1U40A 3R0PA 3CC2F 1YI2F 3Q8HA 3LYBA 4WBNB 1XRGA 5IJ0A 1X7OA 1GO1A 2HQSC 2R751 4HNAB 4O4JB 3S0WA 2L26A 4F6RA 5HY0A 2ZVZA 2GZLA 3C8LA 1W57A 1QU9A 1VQ5F 3LWQC 3CG6A 3HKDB 4IHJB 3S0HA 2QA4F 3P10A 3M4SA 4RQOA 3VCZA 3E1YA 4B45A 2KTVA 5GIOC 1CLIA 5EWRA 3MBMA 4ZHQB 2Q1XA 4ZI7B 1K9MH 5KMGA 5IJ9A 4B46A 4LNUB 3M84A 4ZOLB 5CB4A 1X7PA 2B33A 4ZK7A 4O2BA 4X1KA 3HKCA 1ODEA 3JALA 3CXCF 3NK7A 1X52A 5LA6B 1Z5VA 2IQQA 4IIJA 3EORA 1JJ2F 1IV3A 1OFUA 2PMPA 2VAWA 3AGKA 1Q82H 2VXYA 1RQ2A 3WGMA 3KHNA 4X3MA 2GLZA 3K0TA 1IV2A 1FFXA 2HVYD 2H6LA 1W5BA 5FNVB 3CCLF 1T0KB 1VQOF 2I6DA 4YJ3A 4BT2A 2OTMA 3MQWA 5MN6A 2HP0B 4BT7A 1J7HA 5GINC 1ZWZA 5EYPB 5CA0B 3KJJA 3IKFA 1IV4A 2VGNA 3P4EA 3DC2A 4U3JB 3TD5A 3T80A 3VYTC 3N2KB 5BMVA 3CCJF 3MCAB 3ON1A 2R6R1 4O2AA 3J7AR 3WXMB 4DRXB 3IMPA 3CC7F 3LFOA 2H8EA 4X1YB 3IEWA 4EB6A 2BO1A 3M1XA 4BVQA 5FLXM 1GX1A 2UYKA 4TV9B 2JNBA 1VQLF 2RHOA 3IKEA 5EIBD 4BT4A 3MCQA 4X20A 1W40A 2DT4A 3JATA 2KTUA 5HY4A 4FFBA 5MN5A 2UZHA 3LDTA 1JFFB 1YGYA 1M90H 3CYPB 3JAKB 4I55B 2BTUA 1E7KA 3QTYA 1SA0A 3JAWA 1TUBA 1KC8H 3CCQF 3WGLA 5HWEA 1XV2A 5LOVB 5J2TB 1S72F 3F0GA 4I50A 1Q81H 4TV8A 2W8BC 1VQ9F 3V7QA 3BYQA 3CMEF 2ZODA 3JAMM 3L7QA 5KX5B 4O4LA 1K8AH 4E6EA 1Q7YH 5C8YA 5LYJA 3OBYA 1DT9A 4DXDA 3NVIB 3HAXD 2KGWA 3RYIB 3C9SA 1KNKA 3PLAC 4G4YA 4WBNA 5JH7B 5ITZA 3DDNA 5HY2A 3J81M 3VTIC 4HNAA 1RLGA 2CZWA 5G4VC 2VAPA 4BT6A 1QVFF 5LXTA 1VHAA 3HKDA 4X3LA 1SDSA 2CHTA 1VH8A 2K1SA 3CPWF 2H8CA 4NUTA 3ELCA 3HWUA 4ZHVA 3JARA 3RYCA 3SIVA 1TVKB 4M8IA 2LBTA 3CCUF 4PWTA 3LWRC 1RLUA 1YIJF 4BW0B 3VOBA 5CA1A 4C82A 4O4HB 3WJRA 3I56F 4LNUA 1QVGF 5HXUA 4ZOLA 2NMUA 3WGJA 1Q8RA 2FC3A 4BT5A 3K2XA 2QI2A 1KQSF 5IJ0B 3CC4F 2ZF8A 4XCQA 3ZP4A 5LA6A 3I3FA 4C8GA 3V4DA 4B62A 4R40B 2OTJF 5GIPC 2FGYA 5IYZB 1KD1H 5GONB 1YQNA 4BY9D 1PXWA 4TUYA 4YJ2B 3CCRF 2IAFA 5FNVA 2MQEA 1W41A 1QAHA 3LWOC 1VQVA 2HP0A 2KG4A 3N4ZA 5IJ9B 5HY1A 5EYPA 5CA0A 3VYSC 2UYPA 3JASB 4X1KB 3TD4A 3HKCB 3HKBB 4EI9A 3JALB 1FNJA 3V3TA 1KNJA 5JCOC 3CB2A 4IIJB 3N2GA 3GTZA 3KE1A 2Z1UA 5FJ4C 5EZYB 2ZAUA 1H47A 3B6NA 1VQNF 2EWCA 2Q1YA 1U43A 4KWEA 1W55A 3GYQA 3F6MA 4O4IB 1YJNF 5J2UA 4YJ3B
chains in the Genus database with same CATH topology
4ERHA 3TD3A 2AIZP 1R1MA 4G4ZA 2K1SA 3TD4A 5EB1B 3S0HA 4ZHVA 2N48A 3TD5A 4B62A 4R40B 2LCAA 3LDTA 3CYQA 5EAZA 2LBTA 4PWTA 4ZHYB 3S0YA 2KGWA 2ZOVA 3CYPB 3KHNA 3S06A 4G4YA 3WPXA 3S03A 1OAPA 3IMPA 4G4XA 2MQEA 5EB0A 3S02A 4RHAA 3WPWA 2ZF8A 4ZHWA 4G4VA 4B5CA 4G4WA 2HQSC 2W8BC 4G88A 3S0WA 2L26A 2ZVYA 3OONA 2ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERH A;  3TD3 A;  2AIZ P;  1R1M A;  4G4Z A;  2K1S A;  3TD4 A;  5EB1 B;  3S0H A;  4ZHV A;  2N48 A;  3TD5 A;  4B62 A;  4R40 B;  2LCA A;  3LDT A;  3CYQ A;  5EAZ A;  2LBT A;  4PWT A;  4ZHY B;  3S0Y A;  2KGW A;  2ZOV A;  3CYP B;  3KHN A;  3S06 A;  4G4Y A;  3WPX A;  3S03 A;  1OAP A;  3IMP A;  4G4X A;  2MQE A;  5EB0 A;  3S02 A;  4RHA A;  3WPW A;  2ZF8 A;  4ZHW A;  4G4V A;  4B5C A;  4G4W A;  2HQS C;  2W8B C;  4G88 A;  3S0W A;  2L26 A;  2ZVY A;  3OON A;  2ZVZ A; 
#chains in the Genus database with same CATH topology
 3QUW A;  3RYF B;  3WJQ A;  3VOA A;  3F0F A;  1JFF A;  3UT5 B;  1VQM F;  1JD1 A;  1YJ9 F;  3FPI A;  3JAK A;  3NVK E;  3RYH A;  3E22 B;  3ZP7 A;  2ZOV A;  3S06 A;  1W3E X;  3KIZ A;  3VIU A;  2AIF A;  5LOV A;  1GO0 A;  1FSZ A;  5HP7 A;  1XHO A;  2I6R A;  3NMU C;  2CW4 A;  4ZHW A;  1W5E A;  1W58 1;  3F0D A;  4G88 A;  3SIU A;  3G71 F;  2UYN B;  5HXZ A;  3FD6 A;  5MN4 A;  1CK2 A;  1NQ3 A;  3C9T A;  3N4Y A;  4X20 B;  2RB9 A;  3D00 A;  3HKE B;  3JAT B;  2BTO A;  1XBI A;  4FFB B;  3CYQ A;  3I7T A;  5EAZ A;  1NJI H;  1M1K H;  5JH7 A;  2QEX F;  3O85 A;  2VGM A;  5HP8 A;  2Z01 A;  5A2Q M;  4C8E A;  4X1I B;  3LME A;  4LCK A;  5LP6 B;  3KJK A;  2G9I A;  3RE3 A;  4BVS A;  1W5F A;  3CCM F;  3ZO8 A;  3JAW B;  4O4J A;  1DBF A;  4I4T B;  5EO3 A;  2ZVY A;  3C9U A;  3TD3 A;  4IHJ A;  4G4Z A;  5EIB C;  2LBW A;  5JVD B;  4O4L B;  2LCA A;  1RQ7 A;  5LYJ B;  4TZZ A;  5GAN K;  3CCS F;  2CSL A;  4O4H A;  1PF5 A;  3VI6 A;  3LWP C;  3JCM M;  5JQG B;  4ZHQ A;  4ZI7 A;  1CN7 A;  3S02 A;  4C4W C;  4EI8 A;  4EI7 A;  3LWV C;  5ITZ B;  1VQ4 F;  2OHW A;  4G4V A;  3FD5 A;  2HRU A;  3JVH A;  1W2B F;  1VQ7 F;  3D54 A;  2DYY A;  5LXT B;  4F6R B;  2OTL F;  2GVI A;  5AVM A;  5G4U C;  4C81 A;  3VO8 A;  3CPQ A;  3K12 A;  5IYZ A;  5GON A;  2YYE A;  4YJ2 A;  3JAR B;  3RYC B;  2OZB A;  3WPX A;  2VAM A;  5JCO A;  3FBA A;  4BVR A;  1Q86 H;  3ERN A;  5EB0 A;  5CA1 B;  1YJW F;  2AMT A;  1JY8 A;  1IPA A;  3JAS A;  5KMG B;  3HKB A;  1UFY A;  5CB4 B;  1RA4 A;  2P6Y A;  4O2B B;  4U3J A;  3N2K A;  3V7E A;  2CVL A;  1H7M A;  3GHZ A;  4DRX A;  5EZY A;  4ZHY B;  1Z5W A;  2F9Z C;  4X1Y A;  2RHJ A;  2UYJ A;  3VYU C;  3S03 A;  1VQK F;  1W59 A;  1N8R H;  4BVT A;  2IG8 A;  2HX0 A;  3WJP A;  4TUY B;  2ALE A;  2V9Y A;  3CCV F;  3WPW A;  4O4I A;  2Z1E A;  1X25 A;  3VMF B;  4BT3 A;  4TV9 A;  4C8I A;  3G4S F;  3G6E F;  3CCE F;  4G4W A;  1FFX B;  1W42 A;  3WGN A;  3RYF A;  4NWO B;  4U39 A;  4ERH A;  3UT5 A;  3C9R A;  2CHS A;  1VQ6 F;  1GZ0 A;  2HS3 A;  2HP3 A;  3E22 A;  2WAL A;  2YXZ A;  3J80 M;  3CMA F;  1IV1 A;  4I55 A;  3CD6 F;  1U3P A;  3HTN A;  3E20 B;  5IT9 M;  3RA5 A;  5BMV B;  1VK3 A;  3N2G B;  3RA6 A;  3HJW C;  4O2A B;  5J2T A;  3D01 A;  3QHD A;  3IR9 A;  5GAP K;  2UYN A;  4EB6 B;  1SZQ A;  1YHQ F;  3OON A;  5KX5 A;  3HKE A;  1R1M A;  1W5A A;  2AIZ P;  3OBW A;  3P0Z A;  5J2U B;  3OW2 F;  1YIT F;  5B8F A;  5EB1 B;  2HRY A;  2HS0 A;  3F0E A;  3IEQ A;  2N48 A;  1NMU B;  3RYI A;  2BTQ B;  3MDO A;  4X1I A;  3RYH B;  5LP6 A;  1FNK A;  1OAP A;  1JN1 A;  4I4T A;  2Z1F A;  4RHA A;  3WGK A;  1SA0 B;  1TUB B;  4B5C A;  2LBX A;  2RHH A;  3ZOP A;  3I55 F;  2Z1T A;  3FFM A;  3ESJ A;  5JVD A;  4I50 B;  1H48 A;  4TV8 B;  2QTP A;  4NQ3 A;  2HS4 A;  5DCV A;  1TVK A;  1UI9 A;  1COM A;  2PHN A;  3K14 A;  1ONI A;  2CWJ A;  5JQG A;  5LP6 C;  3NK6 A;  3PAF A;  5C8Y B;  3S0Y A;  1K73 H;  1U3L A;  1QD9 A;  1VQ8 F;  1T0A A;  1VQP F;  3U0O A;  4G4X A;  2RHL A;  1U40 A;  3R0P A;  3CC2 F;  1YI2 F;  3Q8H A;  3LYB A;  4WBN B;  1XRG A;  5IJ0 A;  1X7O A;  1GO1 A;  2HQS C;  2R75 1;  4HNA B;  4O4J B;  3S0W A;  2L26 A;  4F6R A;  5HY0 A;  2ZVZ A;  2GZL A;  3C8L A;  1W57 A;  1QU9 A;  1VQ5 F;  3LWQ C;  3CG6 A;  3HKD B;  4IHJ B;  3S0H A;  2QA4 F;  3P10 A;  3M4S A;  4RQO A;  3VCZ A;  3E1Y A;  4B45 A;  2KTV A;  5GIO C;  1CLI A;  5EWR A;  3MBM A;  4ZHQ B;  2Q1X A;  4ZI7 B;  1K9M H;  5KMG A;  5IJ9 A;  4B46 A;  4LNU B;  3M84 A;  4ZOL B;  5CB4 A;  1X7P A;  2B33 A;  4ZK7 A;  4O2B A;  4X1K A;  3HKC A;  1ODE A;  3JAL A;  3CXC F;  3NK7 A;  1X52 A;  5LA6 B;  1Z5V A;  2IQQ A;  4IIJ A;  3EOR A;  1JJ2 F;  1IV3 A;  1OFU A;  2PMP A;  2VAW A;  3AGK A;  1Q82 H;  2VXY A;  1RQ2 A;  3WGM A;  3KHN A;  4X3M A;  2GLZ A;  3K0T A;  1IV2 A;  1FFX A;  2HVY D;  2H6L A;  1W5B A;  5FNV B;  3CCL F;  1T0K B;  1VQO F;  2I6D A;  4YJ3 A;  4BT2 A;  2OTM A;  3MQW A;  5MN6 A;  2HP0 B;  4BT7 A;  1J7H A;  5GIN C;  1ZWZ A;  5EYP B;  5CA0 B;  3KJJ A;  3IKF A;  1IV4 A;  2VGN A;  3P4E A;  3DC2 A;  4U3J B;  3TD5 A;  3T80 A;  3VYT C;  3N2K B;  5BMV A;  3CCJ F;  3MCA B;  3ON1 A;  2R6R 1;  4O2A A;  3J7A R;  3WXM B;  4DRX B;  3IMP A;  3CC7 F;  3LFO A;  2H8E A;  4X1Y B;  3IEW A;  4EB6 A;  2BO1 A;  3M1X A;  4BVQ A;  5FLX M;  1GX1 A;  2UYK A;  4TV9 B;  2JNB A;  1VQL F;  2RHO A;  3IKE A;  5EIB D;  4BT4 A;  3MCQ A;  4X20 A;  1W40 A;  2DT4 A;  3JAT A;  2KTU A;  5HY4 A;  4FFB A;  5MN5 A;  2UZH A;  3LDT A;  1JFF B;  1YGY A;  1M90 H;  3CYP B;  3JAK B;  4I55 B;  2BTU A;  1E7K A;  3QTY A;  1SA0 A;  3JAW A;  1TUB A;  1KC8 H;  3CCQ F;  3WGL A;  5HWE A;  1XV2 A;  5LOV B;  5J2T B;  1S72 F;  3F0G A;  4I50 A;  1Q81 H;  4TV8 A;  2W8B C;  1VQ9 F;  3V7Q A;  3BYQ A;  3CME F;  2ZOD A;  3JAM M;  3L7Q A;  5KX5 B;  4O4L A;  1K8A H;  4E6E A;  1Q7Y H;  5C8Y A;  5LYJ A;  3OBY A;  1DT9 A;  4DXD A;  3NVI B;  3HAX D;  2KGW A;  3RYI B;  3C9S A;  1KNK A;  3PLA C;  4G4Y A;  4WBN A;  5JH7 B;  5ITZ A;  3DDN A;  5HY2 A;  3J81 M;  3VTI C;  4HNA A;  1RLG A;  2CZW A;  5G4V C;  2VAP A;  4BT6 A;  1QVF F;  5LXT A;  1VHA A;  3HKD A;  4X3L A;  1SDS A;  2CHT A;  1VH8 A;  2K1S A;  3CPW F;  2H8C A;  4NUT A;  3ELC A;  3HWU A;  4ZHV A;  3JAR A;  3RYC A;  3SIV A;  1TVK B;  4M8I A;  2LBT A;  3CCU F;  4PWT A;  3LWR C;  1RLU A;  1YIJ F;  4BW0 B;  3VOB A;  5CA1 A;  4C82 A;  4O4H B;  3WJR A;  3I56 F;  4LNU A;  1QVG F;  5HXU A;  4ZOL A;  2NMU A;  3WGJ A;  1Q8R A;  2FC3 A;  4BT5 A;  3K2X A;  2QI2 A;  1KQS F;  5IJ0 B;  3CC4 F;  2ZF8 A;  4XCQ A;  3ZP4 A;  5LA6 A;  3I3F A;  4C8G A;  3V4D A;  4B62 A;  4R40 B;  2OTJ F;  5GIP C;  2FGY A;  5IYZ B;  1KD1 H;  5GON B;  1YQN A;  4BY9 D;  1PXW A;  4TUY A;  4YJ2 B;  3CCR F;  2IAF A;  5FNV A;  2MQE A;  1W41 A;  1QAH A;  3LWO C;  1VQV A;  2HP0 A;  2KG4 A;  3N4Z A;  5IJ9 B;  5HY1 A;  5EYP A;  5CA0 A;  3VYS C;  2UYP A;  3JAS B;  4X1K B;  3TD4 A;  3HKC B;  3HKB B;  4EI9 A;  3JAL B;  1FNJ A;  3V3T A;  1KNJ A;  5JCO C;  3CB2 A;  4IIJ B;  3N2G A;  3GTZ A;  3KE1 A;  2Z1U A;  5FJ4 C;  5EZY B;  2ZAU A;  1H47 A;  3B6N A;  1VQN F;  2EWC A;  2Q1Y A;  1U43 A;  4KWE A;  1W55 A;  3GYQ A;  3F6M A;  4O4I B;  1YJN F;  5J2U A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 4ERH A;  3TD3 A;  2AIZ P;  1R1M A;  4G4Z A;  2K1S A;  3TD4 A;  5EB1 B;  3S0H A;  4ZHV A;  2N48 A;  3TD5 A;  4B62 A;  4R40 B;  2LCA A;  3LDT A;  3CYQ A;  5EAZ A;  2LBT A;  4PWT A;  4ZHY B;  3S0Y A;  2KGW A;  2ZOV A;  3CYP B;  3KHN A;  3S06 A;  4G4Y A;  3WPX A;  3S03 A;  1OAP A;  3IMP A;  4G4X A;  2MQE A;  5EB0 A;  3S02 A;  4RHA A;  3WPW A;  2ZF8 A;  4ZHW A;  4G4V A;  4B5C A;  4G4W A;  2HQS C;  2W8B C;  4G88 A;  3S0W A;  2L26 A;  2ZVY A;  3OON A;  2ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...