2W8BC

Crystal structure of processed tolb in complex with pal
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
104
Chain Sequence
b'NNIVYFDLDKYDIRSDFAQMLDAHANFLRSSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TOLB
molecule tags Protein transport/membrane protein
source organism Escherichia coli
publication title Allosteric Beta-Propeller Signalling in Tolb and its Manipulation by Translocating Colicins.
pubmed doi rcsb
total genus 34
structure length 104
sequence length 106
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2w8bC00
3WPXA 1R1MA 3TD3A 4ZHVA 5EB0A 3KHNA 3S06A 4ERHA 2W8BC 2K1SA 1OAPA 2ZF8A 4ZHYB 2ZOVA 3TD4A 4B62A 2LCAA 4G88A 4ZHWA 2AIZP 2ZVZA 4G4WA 3TD5A 5EAZA 4G4XA 3CYPB 4G4VA 3S0WA 3S0HA 3WPWA 2LBTA 3CYQA 2KGWA 2L26A 4RHAA 5EB1B 4B5CA 2N48A 4PWTA 2HQSC 3S02A 4R40B 4G4YA 4G4ZA 3S03A 3S0YA 2ZVYA 3OONA 3LDTA 3IMPA 2MQEA
chains in the Genus database with same CATH superfamily
1ZWZA 3T80A 2V9YA 4IIJB 4O2BA 5LP6B 1W42A 3N4YA 3LWPC 2ZF8A 1T0KB 3E1YA 1UFYA 1UI9A 3P10A 4F6RB 3RYHA 1K73H 3OBWA 1IV3A 4NUTA 3HKBA 4LNUA 4YJ3B 4TZZA 3IEWA 3HKBB 4LNUB 4YJ3A 3F0FA 3F0GA 3N4ZA 1Z5VA 5MN5A 1YIJF 3C9SA 3N2KA 1VQOF 2GZLA 1VQLF 2VAPA 3N2KB 5C8YB 1XV2A 4BT2A 1W5BA 1Q7YH 4F6RA 1RLGA 3U0OA 2LBXA 4ZI7A 3E22A 2K1SA 3CXCF 1VQ6F 5J2UA 5JQGB 4B46A 4HNAB 3HTNA 2OHWA 1T0AA 2F9ZC 3HAXD 3F0EA 5HP7A 4DRXB 3HKEB 3HKCA 4G4ZA 2HVYD 3SIVA 4ZOLA 3OBYA 1KNJA 1TUBA 2UZHA 1U3PA 2RB9A 5LYJB 3B6NA 4X3LA 1FFXB 4EI7A 3RYCA 3MCAB 2YYEA 5HXZA 2IQQA 1JD1A 3DC2A 3WXMB 5IT9M 4X1YA 3JVHA 3K2XA 5CA0A 3SIUA 3JAKA 5JCOC 1JFFB 5HXUA 3WGKA 4BY9D 2HP0A 1GO0A 3F6MA 2Z1EA 1FSZA 3LWQC 3HWUA 3VYSC 3CMEF 1VQ9F 2RHJA 5LA6B 2KTUA 3JALA 4ZHYB 5CB4A 3I56F 3CCLF 4XCQA 2LCAA 3VTIC 3HKDA 1OFUA 1IV4A 4X1KA 1IV2A 3GYQA 3IKFA 3WPWA 2JNBA 5LA6A 1VQ5F 4RHAA 3MCQA 3ESJA 3CC2F 3JAWB 3C8LA 3LFOA 5IJ9A 3WJRA 2HQSC 5LXTB 2IAFA 5EIBD 1W581 2UYJA 4BT5A 1R1MA 5EB0A 4U39A 5FJ4C 5JVDA 2I6DA 5GONB 2VAMA 3PAFA 1X7PA 2WALA 3P0ZA 3IR9A 3IEQA 1CK2A 4IIJA 2AMTA 4O2BB 5LP6A 3CPWF 5IJ0B 2GLZA 2CSLA 5IYZB 2OTJF 3IKEA 5HY1A 3G6EF 1K8AH 3KE1A 4YJ2B 4WBNB 2ZODA 2VGMA 5JH7A 2Z1TA 4TV9B 3WGMA 5GANK 1CN7A 1K9MH 1JJ2F 3BYQA 4O4HB 3C9TA 2GVIA 3NVKE 3CPQA 4EI9A 3OONA 2Q1YA 5LOVB 1QVGF 5HP8A 5JH7B 2W8BC 4U3JB 2H6LA 3FD6A 3LYBA 1SA0B 3UT5B 2NMUA 3S0HA 3RA6A 3QTYA 4EB6B 5HY0A 1SA0A 2H8EA 3I55F 2RHLA 3RYIB 3RE3A 3I7TA 3VOAA 1KQSF 2R6R1 4FFBB 3VI6A 3KJKA 2R751 5IJ9B 5EZYB 1SDSA 5FNVA 5JVDB 2CW4A 3J80M 1OAPA 5HY2A 1W5AA 5JCOA 3TD4A 1DT9A 1RQ2A 4O2AB 1VQ4F 3OW2F 1KD1H 3LMEA 1XHOA 5J2TB 4FFBA 3LWOC 5FLXM 4R40B 4DRXA 1W2BF 3HJWC 3VCZA 3JATA 3CCSF 2HRYA 4TV8B 4EI8A 2BO1A 5GONA 1VQ8F 2VXYA 3M84A 1H48A 2CWJA 3WGLA 5MN4A 3K0TA 3KHNA 1W55A 1COMA 3J81M 4IHJB 3GHZA 3C9UA 5G4VC 5IJ0A 1YQNA 1J7HA 3EORA 3G4SF 1FFXA 3WJQA 1QU9A 4I55B 5LP6C 4I4TB 5EWRA 4BT7A 2FC3A 4BVSA 2L26A 3G71F 4B5CA 1YJNF 2CHTA 2HS0A 3S02A 2LBWA 3S0YA 5J2TA 1NJIH 3FFMA 4TUYB 1VQVA 2VGNA 4E6EA 5GIOC 5DCVA 2HX0A 3ZO8A 1XBIA 2KG4A 3CB2A 4C8EA 3I3FA 4ERHA 3CCVF 3CCMF 4WBNA 3JAKB 3M4SA 5ITZB 3L7QA 5AVMA 2UYKA 2HRUA 2DT4A 2BTOA 4BT4A 5ITZA 3JASA 1JFFA 1ONIA 3RYIA 3VYUC 1Q81H 4C82A 1W3EX 1YHQF 5GAPK 4O4JA 1JY8A 1W41A 3FBAA 1FNKA 3IMPA 3LDTA 3V7EA 4X1YB 5A2QM 3TD3A 5GINC 1Z5WA 4O4IB 3LWRC 3JAWA 4NWOB 2I6RA 4BT3A 3CCUF 2HS4A 1QD9A 4X1KB 4X20B 3RYFA 3ON1A 4G4XA 4BW0B 1X52A 5CA1A 3CYQA 1SZQA 4ZK7A 4ZOLB 2N48A 4PWTA 5JQGA 2B33A 4G4YA 4ZI7B 3S03A 3C9RA 3RYHB 1IV1A 4X3MA 2Z1UA 3WJPA 4YJ2A 3NVIB 3NMUC 3E20B 5CA0B 4ZHQB 4C8IA 3JATB 2RHOA 4DXDA 3D00A 3CG6A 1H7MA 3KJJA 3RYCB 2QEXF 3JAMM 5G4UC 1QAHA 1CLIA 1Q82H 3KIZA 1NMUB 1H47A 2KGWA 1YI2F 2OTLF 3CMAF 2KTVA 2Z01A 5C8YA 3K12A 1KNKA 3NK7A 2P6YA 4O4LA 1X25A 4O4IA 3R0PA 2HS3A 4ZHVA 4BVTA 3N2GB 3JASB 3VYTC 4BVRA 1NQ3A 5EZYA 1RLUA 5GIPC 1Q86H 2PHNA 4KWEA 3D54A 3JARA 4B45A 2VAWA 3F0DA 2BTQB 5KX5A 5FNVB 2CZWA 5EAZA 5J2UB 3CYPB 3S0WA 2PMPA 4LCKA 3M1XA 3FD5A 5EB1B 1M90H 5MN6A 1M1KH 3CCQF 3ZP7A 3PLAC 3CD6F 1YJWF 4O4LB 4BT6A 1QVFF 2IG8A 5LOVA 3D01A 1W5FA 2Z1FA 5HY4A 3WGJA 1N8RH 3HKEA 3HKCB 2UYNB 5KMGB 2ZOVA 2UYNA 4B62A 4I50B 4I55A 3VIUA 1VHAA 1JN1A 4HNAA 2LBTA 3AGKA 3JCMM 3V3TA 1S72F 3O85A 2CHSA 4O4HA 3LWVC 2RHHA 5EYPB 2AIFA 4TV9A 4TV8A 3S06A 3V4DA 5IYZA 2UYPA 3RA5A 2QTPA 1PXWA 1VQ7F 1VQKF 4IHJA 1GX1A 4C8GA 3CCJF 1Q8RA 2Q1XA 2YXZA 1DBFA 5LXTA 1U43A 3E22B 3QUWA 3JARB 5EO3A 3Q8HA 3RYFB 3VOBA 4ZHWA 3CCEF 1YJ9F 3FPIA 3MBMA 4O2AA 3N2GA 3WGNA 1VK3A 4M8IA 1XRGA 1PF5A 3ZP4A 1VQNF 1W40A 2CVLA 2OZBA 1RA4A 1X7OA 5EIBC 1RQ7A 3NK6A 4RQOA 4I50A 2MQEA 1GO1A 2DYYA 3MQWA 3JALB 2FGYA 3ELCA 1KC8H 3HKDB 4EB6A 3DDNA 4X1IA 1VQPF 5CB4B 3CC7F 1YITF 4G88A 1W5EA 3UT5A 4BVQA 2AIZP 2ZVZA 1FNJA 4O4JB 3P4EA 3VMFB 2BTUA 4G4VA 1U40A 1VH8A 3CCRF 3ERNA 4X1IB 3GTZA 2HP0B 2EWCA 3ZOPA 2ALEA 5EYPA 1IPAA 4U3JA 1TVKA 1VQMF 5LYJA 4C4WC 1W59A 5BMVB 3WPXA 5BMVA 5CA1B 2G9IA 4X20A 1TUBB 5KMGA 1W57A 1YGYA 4I4TA 4TUYA 3CC4F 2QI2A 3VO8A 4G4WA 3TD5A 2ZAUA 3QHDA 2QA4F 1E7KA 2H8CA 1GZ0A 1ODEA 2HP3A 1U3LA 3MDOA 5KX5B 3K14A 4ZHQA 3J7AR 4C81A 3V7QA 1TVKB 2OTMA 5HWEA 4NQ3A 2ZVYA 5B8FA
chains in the Genus database with same CATH topology
3WPXA 1R1MA 3TD3A 4ZHVA 5EB0A 3KHNA 3S06A 4ERHA 2W8BC 2K1SA 1OAPA 2ZF8A 4ZHYB 2ZOVA 3TD4A 4B62A 2LCAA 4G88A 4ZHWA 2AIZP 2ZVZA 4G4WA 3TD5A 5EAZA 4G4XA 3CYPB 4G4VA 3S0WA 3S0HA 3WPWA 2LBTA 3CYQA 2KGWA 2L26A 4RHAA 5EB1B 4B5CA 2N48A 4PWTA 2HQSC 3S02A 4R40B 4G4YA 4G4ZA 3S03A 3S0YA 2ZVYA 3OONA 3LDTA 3IMPA 2MQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPX A;  1R1M A;  3TD3 A;  4ZHV A;  5EB0 A;  3KHN A;  3S06 A;  4ERH A;  2W8B C;  2K1S A;  1OAP A;  2ZF8 A;  4ZHY B;  2ZOV A;  3TD4 A;  4B62 A;  2LCA A;  4G88 A;  4ZHW A;  2AIZ P;  2ZVZ A;  4G4W A;  3TD5 A;  5EAZ A;  4G4X A;  3CYP B;  4G4V A;  3S0W A;  3S0H A;  3WPW A;  2LBT A;  3CYQ A;  2KGW A;  2L26 A;  4RHA A;  5EB1 B;  4B5C A;  2N48 A;  4PWT A;  2HQS C;  3S02 A;  4R40 B;  4G4Y A;  4G4Z A;  3S03 A;  3S0Y A;  2ZVY A;  3OON A;  3LDT A;  3IMP A;  2MQE A; 
#chains in the Genus database with same CATH topology
 1ZWZ A;  3T80 A;  2V9Y A;  4IIJ B;  4O2B A;  5LP6 B;  1W42 A;  3N4Y A;  3LWP C;  2ZF8 A;  1T0K B;  3E1Y A;  1UFY A;  1UI9 A;  3P10 A;  4F6R B;  3RYH A;  1K73 H;  3OBW A;  1IV3 A;  4NUT A;  3HKB A;  4LNU A;  4YJ3 B;  4TZZ A;  3IEW A;  3HKB B;  4LNU B;  4YJ3 A;  3F0F A;  3F0G A;  3N4Z A;  1Z5V A;  5MN5 A;  1YIJ F;  3C9S A;  3N2K A;  1VQO F;  2GZL A;  1VQL F;  2VAP A;  3N2K B;  5C8Y B;  1XV2 A;  4BT2 A;  1W5B A;  1Q7Y H;  4F6R A;  1RLG A;  3U0O A;  2LBX A;  4ZI7 A;  3E22 A;  2K1S A;  3CXC F;  1VQ6 F;  5J2U A;  5JQG B;  4B46 A;  4HNA B;  3HTN A;  2OHW A;  1T0A A;  2F9Z C;  3HAX D;  3F0E A;  5HP7 A;  4DRX B;  3HKE B;  3HKC A;  4G4Z A;  2HVY D;  3SIV A;  4ZOL A;  3OBY A;  1KNJ A;  1TUB A;  2UZH A;  1U3P A;  2RB9 A;  5LYJ B;  3B6N A;  4X3L A;  1FFX B;  4EI7 A;  3RYC A;  3MCA B;  2YYE A;  5HXZ A;  2IQQ A;  1JD1 A;  3DC2 A;  3WXM B;  5IT9 M;  4X1Y A;  3JVH A;  3K2X A;  5CA0 A;  3SIU A;  3JAK A;  5JCO C;  1JFF B;  5HXU A;  3WGK A;  4BY9 D;  2HP0 A;  1GO0 A;  3F6M A;  2Z1E A;  1FSZ A;  3LWQ C;  3HWU A;  3VYS C;  3CME F;  1VQ9 F;  2RHJ A;  5LA6 B;  2KTU A;  3JAL A;  4ZHY B;  5CB4 A;  3I56 F;  3CCL F;  4XCQ A;  2LCA A;  3VTI C;  3HKD A;  1OFU A;  1IV4 A;  4X1K A;  1IV2 A;  3GYQ A;  3IKF A;  3WPW A;  2JNB A;  5LA6 A;  1VQ5 F;  4RHA A;  3MCQ A;  3ESJ A;  3CC2 F;  3JAW B;  3C8L A;  3LFO A;  5IJ9 A;  3WJR A;  2HQS C;  5LXT B;  2IAF A;  5EIB D;  1W58 1;  2UYJ A;  4BT5 A;  1R1M A;  5EB0 A;  4U39 A;  5FJ4 C;  5JVD A;  2I6D A;  5GON B;  2VAM A;  3PAF A;  1X7P A;  2WAL A;  3P0Z A;  3IR9 A;  3IEQ A;  1CK2 A;  4IIJ A;  2AMT A;  4O2B B;  5LP6 A;  3CPW F;  5IJ0 B;  2GLZ A;  2CSL A;  5IYZ B;  2OTJ F;  3IKE A;  5HY1 A;  3G6E F;  1K8A H;  3KE1 A;  4YJ2 B;  4WBN B;  2ZOD A;  2VGM A;  5JH7 A;  2Z1T A;  4TV9 B;  3WGM A;  5GAN K;  1CN7 A;  1K9M H;  1JJ2 F;  3BYQ A;  4O4H B;  3C9T A;  2GVI A;  3NVK E;  3CPQ A;  4EI9 A;  3OON A;  2Q1Y A;  5LOV B;  1QVG F;  5HP8 A;  5JH7 B;  2W8B C;  4U3J B;  2H6L A;  3FD6 A;  3LYB A;  1SA0 B;  3UT5 B;  2NMU A;  3S0H A;  3RA6 A;  3QTY A;  4EB6 B;  5HY0 A;  1SA0 A;  2H8E A;  3I55 F;  2RHL A;  3RYI B;  3RE3 A;  3I7T A;  3VOA A;  1KQS F;  2R6R 1;  4FFB B;  3VI6 A;  3KJK A;  2R75 1;  5IJ9 B;  5EZY B;  1SDS A;  5FNV A;  5JVD B;  2CW4 A;  3J80 M;  1OAP A;  5HY2 A;  1W5A A;  5JCO A;  3TD4 A;  1DT9 A;  1RQ2 A;  4O2A B;  1VQ4 F;  3OW2 F;  1KD1 H;  3LME A;  1XHO A;  5J2T B;  4FFB A;  3LWO C;  5FLX M;  4R40 B;  4DRX A;  1W2B F;  3HJW C;  3VCZ A;  3JAT A;  3CCS F;  2HRY A;  4TV8 B;  4EI8 A;  2BO1 A;  5GON A;  1VQ8 F;  2VXY A;  3M84 A;  1H48 A;  2CWJ A;  3WGL A;  5MN4 A;  3K0T A;  3KHN A;  1W55 A;  1COM A;  3J81 M;  4IHJ B;  3GHZ A;  3C9U A;  5G4V C;  5IJ0 A;  1YQN A;  1J7H A;  3EOR A;  3G4S F;  1FFX A;  3WJQ A;  1QU9 A;  4I55 B;  5LP6 C;  4I4T B;  5EWR A;  4BT7 A;  2FC3 A;  4BVS A;  2L26 A;  3G71 F;  4B5C A;  1YJN F;  2CHT A;  2HS0 A;  3S02 A;  2LBW A;  3S0Y A;  5J2T A;  1NJI H;  3FFM A;  4TUY B;  1VQV A;  2VGN A;  4E6E A;  5GIO C;  5DCV A;  2HX0 A;  3ZO8 A;  1XBI A;  2KG4 A;  3CB2 A;  4C8E A;  3I3F A;  4ERH A;  3CCV F;  3CCM F;  4WBN A;  3JAK B;  3M4S A;  5ITZ B;  3L7Q A;  5AVM A;  2UYK A;  2HRU A;  2DT4 A;  2BTO A;  4BT4 A;  5ITZ A;  3JAS A;  1JFF A;  1ONI A;  3RYI A;  3VYU C;  1Q81 H;  4C82 A;  1W3E X;  1YHQ F;  5GAP K;  4O4J A;  1JY8 A;  1W41 A;  3FBA A;  1FNK A;  3IMP A;  3LDT A;  3V7E A;  4X1Y B;  5A2Q M;  3TD3 A;  5GIN C;  1Z5W A;  4O4I B;  3LWR C;  3JAW A;  4NWO B;  2I6R A;  4BT3 A;  3CCU F;  2HS4 A;  1QD9 A;  4X1K B;  4X20 B;  3RYF A;  3ON1 A;  4G4X A;  4BW0 B;  1X52 A;  5CA1 A;  3CYQ A;  1SZQ A;  4ZK7 A;  4ZOL B;  2N48 A;  4PWT A;  5JQG A;  2B33 A;  4G4Y A;  4ZI7 B;  3S03 A;  3C9R A;  3RYH B;  1IV1 A;  4X3M A;  2Z1U A;  3WJP A;  4YJ2 A;  3NVI B;  3NMU C;  3E20 B;  5CA0 B;  4ZHQ B;  4C8I A;  3JAT B;  2RHO A;  4DXD A;  3D00 A;  3CG6 A;  1H7M A;  3KJJ A;  3RYC B;  2QEX F;  3JAM M;  5G4U C;  1QAH A;  1CLI A;  1Q82 H;  3KIZ A;  1NMU B;  1H47 A;  2KGW A;  1YI2 F;  2OTL F;  3CMA F;  2KTV A;  2Z01 A;  5C8Y A;  3K12 A;  1KNK A;  3NK7 A;  2P6Y A;  4O4L A;  1X25 A;  4O4I A;  3R0P A;  2HS3 A;  4ZHV A;  4BVT A;  3N2G B;  3JAS B;  3VYT C;  4BVR A;  1NQ3 A;  5EZY A;  1RLU A;  5GIP C;  1Q86 H;  2PHN A;  4KWE A;  3D54 A;  3JAR A;  4B45 A;  2VAW A;  3F0D A;  2BTQ B;  5KX5 A;  5FNV B;  2CZW A;  5EAZ A;  5J2U B;  3CYP B;  3S0W A;  2PMP A;  4LCK A;  3M1X A;  3FD5 A;  5EB1 B;  1M90 H;  5MN6 A;  1M1K H;  3CCQ F;  3ZP7 A;  3PLA C;  3CD6 F;  1YJW F;  4O4L B;  4BT6 A;  1QVF F;  2IG8 A;  5LOV A;  3D01 A;  1W5F A;  2Z1F A;  5HY4 A;  3WGJ A;  1N8R H;  3HKE A;  3HKC B;  2UYN B;  5KMG B;  2ZOV A;  2UYN A;  4B62 A;  4I50 B;  4I55 A;  3VIU A;  1VHA A;  1JN1 A;  4HNA A;  2LBT A;  3AGK A;  3JCM M;  3V3T A;  1S72 F;  3O85 A;  2CHS A;  4O4H A;  3LWV C;  2RHH A;  5EYP B;  2AIF A;  4TV9 A;  4TV8 A;  3S06 A;  3V4D A;  5IYZ A;  2UYP A;  3RA5 A;  2QTP A;  1PXW A;  1VQ7 F;  1VQK F;  4IHJ A;  1GX1 A;  4C8G A;  3CCJ F;  1Q8R A;  2Q1X A;  2YXZ A;  1DBF A;  5LXT A;  1U43 A;  3E22 B;  3QUW A;  3JAR B;  5EO3 A;  3Q8H A;  3RYF B;  3VOB A;  4ZHW A;  3CCE F;  1YJ9 F;  3FPI A;  3MBM A;  4O2A A;  3N2G A;  3WGN A;  1VK3 A;  4M8I A;  1XRG A;  1PF5 A;  3ZP4 A;  1VQN F;  1W40 A;  2CVL A;  2OZB A;  1RA4 A;  1X7O A;  5EIB C;  1RQ7 A;  3NK6 A;  4RQO A;  4I50 A;  2MQE A;  1GO1 A;  2DYY A;  3MQW A;  3JAL B;  2FGY A;  3ELC A;  1KC8 H;  3HKD B;  4EB6 A;  3DDN A;  4X1I A;  1VQP F;  5CB4 B;  3CC7 F;  1YIT F;  4G88 A;  1W5E A;  3UT5 A;  4BVQ A;  2AIZ P;  2ZVZ A;  1FNJ A;  4O4J B;  3P4E A;  3VMF B;  2BTU A;  4G4V A;  1U40 A;  1VH8 A;  3CCR F;  3ERN A;  4X1I B;  3GTZ A;  2HP0 B;  2EWC A;  3ZOP A;  2ALE A;  5EYP A;  1IPA A;  4U3J A;  1TVK A;  1VQM F;  5LYJ A;  4C4W C;  1W59 A;  5BMV B;  3WPX A;  5BMV A;  5CA1 B;  2G9I A;  4X20 A;  1TUB B;  5KMG A;  1W57 A;  1YGY A;  4I4T A;  4TUY A;  3CC4 F;  2QI2 A;  3VO8 A;  4G4W A;  3TD5 A;  2ZAU A;  3QHD A;  2QA4 F;  1E7K A;  2H8C A;  1GZ0 A;  1ODE A;  2HP3 A;  1U3L A;  3MDO A;  5KX5 B;  3K14 A;  4ZHQ A;  3J7A R;  4C81 A;  3V7Q A;  1TVK B;  2OTM A;  5HWE A;  4NQ3 A;  2ZVY A;  5B8F A; 
#chains in the Genus database with same CATH homology
 3WPX A;  1R1M A;  3TD3 A;  4ZHV A;  5EB0 A;  3KHN A;  3S06 A;  4ERH A;  2W8B C;  2K1S A;  1OAP A;  2ZF8 A;  4ZHY B;  2ZOV A;  3TD4 A;  4B62 A;  2LCA A;  4G88 A;  4ZHW A;  2AIZ P;  2ZVZ A;  4G4W A;  3TD5 A;  5EAZ A;  4G4X A;  3CYP B;  4G4V A;  3S0W A;  3S0H A;  3WPW A;  2LBT A;  3CYQ A;  2KGW A;  2L26 A;  4RHA A;  5EB1 B;  4B5C A;  2N48 A;  4PWT A;  2HQS C;  3S02 A;  4R40 B;  4G4Y A;  4G4Z A;  3S03 A;  3S0Y A;  2ZVY A;  3OON A;  3LDT A;  3IMP A;  2MQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...