1KC8H

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kc8H00
3PAFA 4BW0B 3WXMB 3O85A 1ZWZA 1M90H 2QI2A 1K73H 1X7PA 1GZ0A 1X7OA 3CG6A 1VQPF 2QA4F 1VQLF 4BY9D 3CCSF 2OTLF 3N4ZA 3LFOA 3J81M 1VQ7F 1W3EX 3VMFB 3LWQC 5IT9M 3OBWA 1M1KH 5A2QM 3PLAC 1VQOF 5GAPK 1JJ2F 3HAXD 1YJWF 1VQ6F 1GO1A 2JNBA 1IPAA 3VI6A 3NK6A 1K8AH 2ALEA 3V7QA 1VQKF 5GINC 1N8RH 1K9MH 2BO1A 1KD1H 5G4UC 3ON1A 1YJNF 1YHQF 3NMUC 1Q86H 3I55F 5DCVA 1QVGF 1GO0A 3CCQF 1RLGA 3CCLF 4LCKA 3RA6A 1VQMF 3NVKE 3SIUA 2LBWA 3G4SF 1DT9A 3CCVF 1VQ8F 3NVIB 1XBIA 3MCAB 5EWRA 1VQNF 3CPQA 3V7EA 3J7AR 1VQ5F 5GIOC 3GYQA 1CK2A 2HVYD 3CD6F 3FFMA 1W2BF 1W40A 3SIVA 3I56F 4TZZA 3CCEF 1PXWA 3CCUF 1QVFF 2FC3A 1YITF 1Q7YH 2OZBA 2VGNA 3LWOC 1YIJF 4X3LA 4X3MA 5GIPC 1YJ9F 1Q81H 3J80M 2KTVA 3NK7A 3OW2F 1X52A 1CN7A 5FLXM 5EO3A 3G6EF 1Q82H 3JCMM 1VQ9F 3CC2F 5FJ4C 3CCMF 3IR9A 3G71F 3OBYA 2VGMA 2OHWA 2KTUA 2KG4A 2WALA 3CCRF 2OTJF 1W41A 4C4WC 1NMUB 3E20B 1KC8H 1NJIH 3CC7F 1SDSA 1YI2F 3LWPC 3CMAF 3CPWF 3RA5A 2CZWA 4NUTA 1RA4A 3HJWC 5G4VC 1S72F 3LWVC 2I6DA 3CXCF 3CMEF 2AIFA 3CCJF 1VQ4F 1E7KA 5GANK 3CC4F 3E1YA 3JAMM 2QEXF 2LBXA 1T0KB 1W42A 3N4YA 3LWRC 1KQSF 3AGKA 1H7MA
chains in the Genus database with same CATH superfamily
3IEQA 3JARB 4U3JA 3KJKA 3PAFA 4ZOLA 1M90H 2HS0A 4E6EA 4X1YB 3JAWB 1X7OA 5ITZA 2ZVYA 3UT5A 1VQPF 1VQLF 3CCSF 2OTLF 3HWUA 3N4ZA 3J81M 3RYFB 1W3EX 2CWJA 4R40B 3LWQC 1IV2A 2Z1FA 3BYQA 3WPXA 3I7TA 3ELCA 5EYPA 3F0EA 4DXDA 3JALA 3ZP4A 4C8EA 2ALEA 4IHJB 2Q1XA 4EB6B 4BVSA 4O4LA 3IKEA 5J2UA 4O4HB 1TVKA 1FNKA 3NMUC 2L26A 5GONA 2GVIA 2NMUA 3WJRA 3CCLF 2RHJA 4LCKA 5EZYB 3IEWA 1VQMF 2GZLA 2CHSA 4NWOB 3NVKE 5CA1A 3IMPA 3N2KA 3NVIB 1OAPA 2IQQA 5EWRA 1VQNF 3CPQA 2HP0A 5HXUA 2RHHA 4LNUB 4O4JA 4BT2A 3M4SA 1FNJA 1CLIA 1CK2A 1Z5WA 2ZVZA 3DC2A 3ERNA 3FBAA 3FFMA 5EAZA 1W40A 5B8FA 4YJ2A 3CD6F 3SIVA 2Z1UA 4TZZA 1SA0B 5J2TB 3DDNA 4BVRA 1VQVA 4HNAB 3TD5A 2Q1YA 1YITF 3HKEA 1Q7YH 2PHNA 5HY4A 2OZBA 2EWCA 4IIJB 3L7QA 2VGNA 1NQ3A 4X3LA 3WGNA 2DT4A 3J80M 3VO8A 2HS4A 3NK7A 1JY8A 1X52A 5LP6A 3D01A 1JFFB 5KX5B 1VQ9F 3CC2F 3K12A 3IR9A 3G71F 1XHOA 4O2BA 3S0WA 5BMVB 2KG4A 2P6YA 5LXTB 4C4WC 3E20B 5LOVA 2DYYA 3CC7F 2HRYA 1U3LA 1IV1A 1Z5VA 3RYIB 3LWVC 1DBFA 1IV4A 3CXCF 4PWTA 3KJJA 3RYFA 4G4XA 1VQ4F 3KE1A 3E1YA 4TV9A 3LMEA 2LBXA 5MN4A 3AGKA 3IKFA 2G9IA 3K2XA 5HY1A 3WJQA 3M1XA 1ZWZA 3O85A 2H6LA 1X7PA 2HX0A 3CG6A 2UYJA 3V4DA 4BY9D 3WPWA 3LFOA 4BT5A 4X20B 3VMFB 5IT9M 5A2QM 5JQGA 5EZYA 3PLAC 1VQOF 1GX1A 3HTNA 3C8LA 1VQ6F 3WGMA 4TUYB 3KHNA 4G88A 5LYJA 2VAPA 3VI6A 1K8AH 4DRXB 3V7QA 4EI7A 2ZAUA 5C8YA 3ESJA 5IJ0B 1YJNF 2HP3A 2YXZA 1TUBB 2V9YA 5DCVA 5AVMA 1QVGF 5HP8A 3N2GA 3CCQF 3FPIA 3RYHA 2Z01A 3SIUA 2LBWA 4FFBB 3E22B 1DT9A 3VOBA 1XRGA 2IG8A 4YJ3A 2FGYA 3Q8HA 5JVDA 4X1IA 3S0HA 3KIZA 5FNVA 1U40A 1OFUA 3U0OA 2CSLA 3WJPA 3GYQA 4I4TB 3QHDA 5HWEA 3VYSC 5JCOA 5BMVA 4BT6A 1QU9A 2R6R1 4ZHQB 4ZI7B 2B33A 4B5CA 4F6RB 3F0GA 1PF5A 3VTIC 3LWOC 5LA6B 5GIPC 2CW4A 5CA0A 5CB4A 1CN7A 4WBNA 1W55A 3LYBA 3G6EF 1Q82H 5FJ4C 4NQ3A 3P10A 3OBYA 2VGMA 4TV8A 2OHWA 4M8IA 4O4IA 4B46A 3HKDB 1NJIH 1SDSA 3LWPC 2AIZP 4ZK7A 1VH8A 3CPWF 3JATB 3MQWA 4G4WA 3HJWC 1UFYA 3P4EA 5G4VC 3C9SA 3S0YA 2AIFA 2UYPA 3CCJF 4X20A 4B45A 2HRUA 4I55A 5JH7A 3S02A 3CC4F 5IYZB 3CB2A 3OONA 2F9ZC 1W42A 3JASA 3N4YA 3LWRC 4U3JB 1X25A 3ZOPA 4ZOLB 3JAKA 1W581 2UYNA 1H48A 5IJ9A 2BTOA 4ZHYB 2GLZA 4BW0B 3RYCA 5HP7A 5ITZB 2YYEA 3VYTC 3UT5B 3WXMB 2QI2A 5MN5A 2AMTA 3JARA 4U39A 2QA4F 3C9UA 2VAMA 4X1YA 3JAWA 1TUBA 4C8GA 3OBWA 1M1KH 2ZODA 5EYPB 5GAPK 4C81A 1JJ2F 3HAXD 3D00A 1YJWF 1Q8RA 3JALB 2JNBA 1IPAA 1H47A 4BT7A 3HKBB 5J2UB 3NK6A 1RLUA 1TVKB 1VQKF 5GINC 1N8RH 1JD1A 2BO1A 5GONB 4EB6A 4IHJA 1KD1H 1W5AA 4I4TA 1R1MA 3LDTA 1Q86H 4O4HA 4X1KB 3VYUC 3C9TA 4BVTA 4EI8A 3VIUA 5KMGB 3RA6A 3V3TA 3N2KB 4G4VA 2HP0B 2RHOA 3CCVF 4O4JB 1XBIA 3MCAB 5HXZA 4O2AB 2PMPA 4YJ2B 4BT4A 3I3FA 5GIOC 1XV2A 4LNUA 2LBTA 5LP6C 1W2BF 3HKEB 3CCEF 3CCUF 1QVFF 2FC3A 3EORA 3C9RA 1SA0A 2CHTA 3GTZA 5J2TA 1QD9A 3ZO8A 1FFXB 2RHLA 4HNAA 3CYQA 1W5BA 4X3MA 5LP6B 1SZQA 1W5EA 2UYKA 4IIJA 2KTVA 1YJ9F 3OW2F 4I50B 4O2BB 3T80A 5EO3A 1ONIA 3JCMM 1RQ2A 1KNJA 1JFFA 1COMA 5KX5A 5LOVB 1W57A 3WGLA 4ZHVA 1NMUB 1KC8H 1YI2F 3CMAF 5LXTA 3HKCB 3RA5A 2CZWA 4NUTA 1S72F 3MDOA 3K0TA 2I6DA 4TV9B 2MQEA 1E7KA 3M84A 3RYIA 4ERHA 1KNKA 1U43A 5EIBD 4EI9A 1T0KB 1KQSF 1H7MA 2ZF8A 3HKBA 3TD3A 1W5FA 3R0PA 3QTYA 1K73H 4KWEA 1GZ0A 3VOAA 4G4YA 2BTQB 5EIBC 1JN1A 1VQ7F 5JQGB 3WGJA 4ZHWA 2KGWA 4X1KA 3ZP7A 2QTPA 3FD6A 2HS3A 5KMGA 5LYJB 2ZOVA 1GO1A 3FD5A 3GHZA 3WGKA 5C8YB 2VAWA 4TUYA 4O2AA 2Z1TA 1K9MH 3MCQA 3N2GB 4DRXA 5G4UC 2CVLA 2I6RA 3ON1A 1YHQF 3I55F 3F6MA 5IJ0A 3RYHB 1GO0A 4XCQA 1RLGA 1U3PA 1FSZA 5JCOC 1VHAA 1FFXA 3G4SF 4YJ3B 1ODEA 3B6NA 1VQ8F 1VK3A 5JVDB 1YQNA 4X1IB 5FNVB 2BTUA 4FFBA 3E22A 1RQ7A 3F0FA 4I50A 3V7EA 3J7AR 2K1SA 1VQ5F 2IAFA 3D54A 4O4LB 5EB0A 2H8EA 3VCZA 3TD4A 2HVYD 1W59A 4BVQA 4RHAA 3JVHA 3I56F 1UI9A 1IV3A 1PXWA 2Z1EA 3RE3A 3S03A 3QUWA 4RQOA 5MN6A 3HKCA 4ZHQA 2HQSC 5CA0B 4ZI7A 5CA1B 4BT3A 5CB4B 1YIJF 4WBNB 4F6RA 1Q81H 2W8BC 2H8CA 1J7HA 5HY0A 5LA6A 5FLXM 4TV8B 4G4ZA 3CCMF 4C82A 4O4IB 4B62A 3K14A 2KTUA 5HY2A 2WALA 3CCRF 2OTJF 4C8IA 3CYPB 1W41A 2RB9A 2VXYA 3F0DA 3MBMA 2UZHA 3S06A 3HKDA 2R751 1RA4A 4I55B 5JH7B 2OTMA 3JATA 3CMEF 3JASB 5GANK 5EB1B 3JAKB 1QAHA 2LCAA 2UYNB 3JAMM 1YGYA 2QEXF 5IJ9B 3RYCB 5IYZA 3P0ZA 1T0AA 2N48A
chains in the Genus database with same CATH topology
5HY1A 2GLZA 3PAFA 4BW0B 3WXMB 3O85A 1ZWZA 1M90H 2QI2A 1K73H 1X7PA 1GZ0A 1X7OA 3CG6A 1VQPF 2QA4F 1VQLF 4BY9D 3CCSF 2OTLF 3N4ZA 3LFOA 3J81M 1VQ7F 1W3EX 3VMFB 3LWQC 5IT9M 3OBWA 1M1KH 5A2QM 3PLAC 1VQOF 5GAPK 1JJ2F 3HAXD 3D00A 1YJWF 1VQ6F 1GO1A 2JNBA 1IPAA 3VI6A 3NK6A 1K8AH 2ALEA 3V7QA 4EI7A 1VQKF 4BVSA 5GINC 1N8RH 1K9MH 2BO1A 1KD1H 5G4UC 3ON1A 1YJNF 1YHQF 3NMUC 1Q86H 3I55F 5DCVA 1QVGF 1GO0A 4XCQA 3CCQF 1RLGA 4BVTA 3CCLF 4LCKA 4EI8A 3RA6A 3V3TA 1VQMF 3NVKE 3SIUA 2LBWA 3G4SF 1DT9A 3CCVF 1VQ8F 3NVIB 1XBIA 3MCAB 5EWRA 5HXZA 1VQNF 3CPQA 2FGYA 5HXUA 3V7EA 3J7AR 1VQ5F 5GIOC 3GYQA 1CK2A 2HVYD 3CD6F 4BVQA 3FFMA 5HWEA 1W40A 1W2BF 3SIVA 3I56F 4TZZA 3CCEF 1PXWA 4BVRA 3CCUF 1QVFF 2FC3A 1YITF 1Q7YH 5HY4A 2OZBA 2VGNA 3LWOC 1YIJF 4X3LA 4X3MA 5GIPC 1YJ9F 1Q81H 3J80M 2KTVA 3NK7A 3OW2F 1X52A 1CN7A 5HY0A 5FLXM 5EO3A 3G6EF 1Q82H 3JCMM 1VQ9F 3CC2F 5FJ4C 3CCMF 3IR9A 3G71F 4NQ3A 3OBYA 2VGMA 2OHWA 2KTUA 5HY2A 2KG4A 2WALA 3CCRF 2OTJF 1W41A 4C4WC 1NMUB 3E20B 1KC8H 1NJIH 3CC7F 1SDSA 1YI2F 3LWPC 3CMAF 3CPWF 3RA5A 2CZWA 4NUTA 1RA4A 3HJWC 5G4VC 1S72F 3LWVC 2I6DA 3CXCF 3CMEF 2AIFA 3CCJF 1VQ4F 1E7KA 5GANK 3CC4F 3E1YA 3JAMM 4EI9A 2LBXA 2F9ZC 1W42A 3N4YA 3LWRC 2QEXF 1KQSF 1T0KB 3AGKA 1H7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  4BW0 B;  3WXM B;  3O85 A;  1ZWZ A;  1M90 H;  2QI2 A;  1K73 H;  1X7P A;  1GZ0 A;  1X7O A;  3CG6 A;  1VQP F;  2QA4 F;  1VQL F;  4BY9 D;  3CCS F;  2OTL F;  3N4Z A;  3LFO A;  3J81 M;  1VQ7 F;  1W3E X;  3VMF B;  3LWQ C;  5IT9 M;  3OBW A;  1M1K H;  5A2Q M;  3PLA C;  1VQO F;  5GAP K;  1JJ2 F;  3HAX D;  1YJW F;  1VQ6 F;  1GO1 A;  2JNB A;  1IPA A;  3VI6 A;  3NK6 A;  1K8A H;  2ALE A;  3V7Q A;  1VQK F;  5GIN C;  1N8R H;  1K9M H;  2BO1 A;  1KD1 H;  5G4U C;  3ON1 A;  1YJN F;  1YHQ F;  3NMU C;  1Q86 H;  3I55 F;  5DCV A;  1QVG F;  1GO0 A;  3CCQ F;  1RLG A;  3CCL F;  4LCK A;  3RA6 A;  1VQM F;  3NVK E;  3SIU A;  2LBW A;  3G4S F;  1DT9 A;  3CCV F;  1VQ8 F;  3NVI B;  1XBI A;  3MCA B;  5EWR A;  1VQN F;  3CPQ A;  3V7E A;  3J7A R;  1VQ5 F;  5GIO C;  3GYQ A;  1CK2 A;  2HVY D;  3CD6 F;  3FFM A;  1W2B F;  1W40 A;  3SIV A;  3I56 F;  4TZZ A;  3CCE F;  1PXW A;  3CCU F;  1QVF F;  2FC3 A;  1YIT F;  1Q7Y H;  2OZB A;  2VGN A;  3LWO C;  1YIJ F;  4X3L A;  4X3M A;  5GIP C;  1YJ9 F;  1Q81 H;  3J80 M;  2KTV A;  3NK7 A;  3OW2 F;  1X52 A;  1CN7 A;  5FLX M;  5EO3 A;  3G6E F;  1Q82 H;  3JCM M;  1VQ9 F;  3CC2 F;  5FJ4 C;  3CCM F;  3IR9 A;  3G71 F;  3OBY A;  2VGM A;  2OHW A;  2KTU A;  2KG4 A;  2WAL A;  3CCR F;  2OTJ F;  1W41 A;  4C4W C;  1NMU B;  3E20 B;  1KC8 H;  1NJI H;  3CC7 F;  1SDS A;  1YI2 F;  3LWP C;  3CMA F;  3CPW F;  3RA5 A;  2CZW A;  4NUT A;  1RA4 A;  3HJW C;  5G4V C;  1S72 F;  3LWV C;  2I6D A;  3CXC F;  3CME F;  2AIF A;  3CCJ F;  1VQ4 F;  1E7K A;  5GAN K;  3CC4 F;  3E1Y A;  3JAM M;  2QEX F;  2LBX A;  1T0K B;  1W42 A;  3N4Y A;  3LWR C;  1KQS F;  3AGK A;  1H7M A; 
#chains in the Genus database with same CATH topology
 3IEQ A;  3JAR B;  4U3J A;  3KJK A;  3PAF A;  4ZOL A;  1M90 H;  2HS0 A;  4E6E A;  4X1Y B;  3JAW B;  1X7O A;  5ITZ A;  2ZVY A;  3UT5 A;  1VQP F;  1VQL F;  3CCS F;  2OTL F;  3HWU A;  3N4Z A;  3J81 M;  3RYF B;  1W3E X;  2CWJ A;  4R40 B;  3LWQ C;  1IV2 A;  2Z1F A;  3BYQ A;  3WPX A;  3I7T A;  3ELC A;  5EYP A;  3F0E A;  4DXD A;  3JAL A;  3ZP4 A;  4C8E A;  2ALE A;  4IHJ B;  2Q1X A;  4EB6 B;  4BVS A;  4O4L A;  3IKE A;  5J2U A;  4O4H B;  1TVK A;  1FNK A;  3NMU C;  2L26 A;  5GON A;  2GVI A;  2NMU A;  3WJR A;  3CCL F;  2RHJ A;  4LCK A;  5EZY B;  3IEW A;  1VQM F;  2GZL A;  2CHS A;  4NWO B;  3NVK E;  5CA1 A;  3IMP A;  3N2K A;  3NVI B;  1OAP A;  2IQQ A;  5EWR A;  1VQN F;  3CPQ A;  2HP0 A;  5HXU A;  2RHH A;  4LNU B;  4O4J A;  4BT2 A;  3M4S A;  1FNJ A;  1CLI A;  1CK2 A;  1Z5W A;  2ZVZ A;  3DC2 A;  3ERN A;  3FBA A;  3FFM A;  5EAZ A;  1W40 A;  5B8F A;  4YJ2 A;  3CD6 F;  3SIV A;  2Z1U A;  4TZZ A;  1SA0 B;  5J2T B;  3DDN A;  4BVR A;  1VQV A;  4HNA B;  3TD5 A;  2Q1Y A;  1YIT F;  3HKE A;  1Q7Y H;  2PHN A;  5HY4 A;  2OZB A;  2EWC A;  4IIJ B;  3L7Q A;  2VGN A;  1NQ3 A;  4X3L A;  3WGN A;  2DT4 A;  3J80 M;  3VO8 A;  2HS4 A;  3NK7 A;  1JY8 A;  1X52 A;  5LP6 A;  3D01 A;  1JFF B;  5KX5 B;  1VQ9 F;  3CC2 F;  3K12 A;  3IR9 A;  3G71 F;  1XHO A;  4O2B A;  3S0W A;  5BMV B;  2KG4 A;  2P6Y A;  5LXT B;  4C4W C;  3E20 B;  5LOV A;  2DYY A;  3CC7 F;  2HRY A;  1U3L A;  1IV1 A;  1Z5V A;  3RYI B;  3LWV C;  1DBF A;  1IV4 A;  3CXC F;  4PWT A;  3KJJ A;  3RYF A;  4G4X A;  1VQ4 F;  3KE1 A;  3E1Y A;  4TV9 A;  3LME A;  2LBX A;  5MN4 A;  3AGK A;  3IKF A;  2G9I A;  3K2X A;  5HY1 A;  3WJQ A;  3M1X A;  1ZWZ A;  3O85 A;  2H6L A;  1X7P A;  2HX0 A;  3CG6 A;  2UYJ A;  3V4D A;  4BY9 D;  3WPW A;  3LFO A;  4BT5 A;  4X20 B;  3VMF B;  5IT9 M;  5A2Q M;  5JQG A;  5EZY A;  3PLA C;  1VQO F;  1GX1 A;  3HTN A;  3C8L A;  1VQ6 F;  3WGM A;  4TUY B;  3KHN A;  4G88 A;  5LYJ A;  2VAP A;  3VI6 A;  1K8A H;  4DRX B;  3V7Q A;  4EI7 A;  2ZAU A;  5C8Y A;  3ESJ A;  5IJ0 B;  1YJN F;  2HP3 A;  2YXZ A;  1TUB B;  2V9Y A;  5DCV A;  5AVM A;  1QVG F;  5HP8 A;  3N2G A;  3CCQ F;  3FPI A;  3RYH A;  2Z01 A;  3SIU A;  2LBW A;  4FFB B;  3E22 B;  1DT9 A;  3VOB A;  1XRG A;  2IG8 A;  4YJ3 A;  2FGY A;  3Q8H A;  5JVD A;  4X1I A;  3S0H A;  3KIZ A;  5FNV A;  1U40 A;  1OFU A;  3U0O A;  2CSL A;  3WJP A;  3GYQ A;  4I4T B;  3QHD A;  5HWE A;  3VYS C;  5JCO A;  5BMV A;  4BT6 A;  1QU9 A;  2R6R 1;  4ZHQ B;  4ZI7 B;  2B33 A;  4B5C A;  4F6R B;  3F0G A;  1PF5 A;  3VTI C;  3LWO C;  5LA6 B;  5GIP C;  2CW4 A;  5CA0 A;  5CB4 A;  1CN7 A;  4WBN A;  1W55 A;  3LYB A;  3G6E F;  1Q82 H;  5FJ4 C;  4NQ3 A;  3P10 A;  3OBY A;  2VGM A;  4TV8 A;  2OHW A;  4M8I A;  4O4I A;  4B46 A;  3HKD B;  1NJI H;  1SDS A;  3LWP C;  2AIZ P;  4ZK7 A;  1VH8 A;  3CPW F;  3JAT B;  3MQW A;  4G4W A;  3HJW C;  1UFY A;  3P4E A;  5G4V C;  3C9S A;  3S0Y A;  2AIF A;  2UYP A;  3CCJ F;  4X20 A;  4B45 A;  2HRU A;  4I55 A;  5JH7 A;  3S02 A;  3CC4 F;  5IYZ B;  3CB2 A;  3OON A;  2F9Z C;  1W42 A;  3JAS A;  3N4Y A;  3LWR C;  4U3J B;  1X25 A;  3ZOP A;  4ZOL B;  3JAK A;  1W58 1;  2UYN A;  1H48 A;  5IJ9 A;  2BTO A;  4ZHY B;  2GLZ A;  4BW0 B;  3RYC A;  5HP7 A;  5ITZ B;  2YYE A;  3VYT C;  3UT5 B;  3WXM B;  2QI2 A;  5MN5 A;  2AMT A;  3JAR A;  4U39 A;  2QA4 F;  3C9U A;  2VAM A;  4X1Y A;  3JAW A;  1TUB A;  4C8G A;  3OBW A;  1M1K H;  2ZOD A;  5EYP B;  5GAP K;  4C81 A;  1JJ2 F;  3HAX D;  3D00 A;  1YJW F;  1Q8R A;  3JAL B;  2JNB A;  1IPA A;  1H47 A;  4BT7 A;  3HKB B;  5J2U B;  3NK6 A;  1RLU A;  1TVK B;  1VQK F;  5GIN C;  1N8R H;  1JD1 A;  2BO1 A;  5GON B;  4EB6 A;  4IHJ A;  1KD1 H;  1W5A A;  4I4T A;  1R1M A;  3LDT A;  1Q86 H;  4O4H A;  4X1K B;  3VYU C;  3C9T A;  4BVT A;  4EI8 A;  3VIU A;  5KMG B;  3RA6 A;  3V3T A;  3N2K B;  4G4V A;  2HP0 B;  2RHO A;  3CCV F;  4O4J B;  1XBI A;  3MCA B;  5HXZ A;  4O2A B;  2PMP A;  4YJ2 B;  4BT4 A;  3I3F A;  5GIO C;  1XV2 A;  4LNU A;  2LBT A;  5LP6 C;  1W2B F;  3HKE B;  3CCE F;  3CCU F;  1QVF F;  2FC3 A;  3EOR A;  3C9R A;  1SA0 A;  2CHT A;  3GTZ A;  5J2T A;  1QD9 A;  3ZO8 A;  1FFX B;  2RHL A;  4HNA A;  3CYQ A;  1W5B A;  4X3M A;  5LP6 B;  1SZQ A;  1W5E A;  2UYK A;  4IIJ A;  2KTV A;  1YJ9 F;  3OW2 F;  4I50 B;  4O2B B;  3T80 A;  5EO3 A;  1ONI A;  3JCM M;  1RQ2 A;  1KNJ A;  1JFF A;  1COM A;  5KX5 A;  5LOV B;  1W57 A;  3WGL A;  4ZHV A;  1NMU B;  1KC8 H;  1YI2 F;  3CMA F;  5LXT A;  3HKC B;  3RA5 A;  2CZW A;  4NUT A;  1S72 F;  3MDO A;  3K0T A;  2I6D A;  4TV9 B;  2MQE A;  1E7K A;  3M84 A;  3RYI A;  4ERH A;  1KNK A;  1U43 A;  5EIB D;  4EI9 A;  1T0K B;  1KQS F;  1H7M A;  2ZF8 A;  3HKB A;  3TD3 A;  1W5F A;  3R0P A;  3QTY A;  1K73 H;  4KWE A;  1GZ0 A;  3VOA A;  4G4Y A;  2BTQ B;  5EIB C;  1JN1 A;  1VQ7 F;  5JQG B;  3WGJ A;  4ZHW A;  2KGW A;  4X1K A;  3ZP7 A;  2QTP A;  3FD6 A;  2HS3 A;  5KMG A;  5LYJ B;  2ZOV A;  1GO1 A;  3FD5 A;  3GHZ A;  3WGK A;  5C8Y B;  2VAW A;  4TUY A;  4O2A A;  2Z1T A;  1K9M H;  3MCQ A;  3N2G B;  4DRX A;  5G4U C;  2CVL A;  2I6R A;  3ON1 A;  1YHQ F;  3I55 F;  3F6M A;  5IJ0 A;  3RYH B;  1GO0 A;  4XCQ A;  1RLG A;  1U3P A;  1FSZ A;  5JCO C;  1VHA A;  1FFX A;  3G4S F;  4YJ3 B;  1ODE A;  3B6N A;  1VQ8 F;  1VK3 A;  5JVD B;  1YQN A;  4X1I B;  5FNV B;  2BTU A;  4FFB A;  3E22 A;  1RQ7 A;  3F0F A;  4I50 A;  3V7E A;  3J7A R;  2K1S A;  1VQ5 F;  2IAF A;  3D54 A;  4O4L B;  5EB0 A;  2H8E A;  3VCZ A;  3TD4 A;  2HVY D;  1W59 A;  4BVQ A;  4RHA A;  3JVH A;  3I56 F;  1UI9 A;  1IV3 A;  1PXW A;  2Z1E A;  3RE3 A;  3S03 A;  3QUW A;  4RQO A;  5MN6 A;  3HKC A;  4ZHQ A;  2HQS C;  5CA0 B;  4ZI7 A;  5CA1 B;  4BT3 A;  5CB4 B;  1YIJ F;  4WBN B;  4F6R A;  1Q81 H;  2W8B C;  2H8C A;  1J7H A;  5HY0 A;  5LA6 A;  5FLX M;  4TV8 B;  4G4Z A;  3CCM F;  4C82 A;  4O4I B;  4B62 A;  3K14 A;  2KTU A;  5HY2 A;  2WAL A;  3CCR F;  2OTJ F;  4C8I A;  3CYP B;  1W41 A;  2RB9 A;  2VXY A;  3F0D A;  3MBM A;  2UZH A;  3S06 A;  3HKD A;  2R75 1;  1RA4 A;  4I55 B;  5JH7 B;  2OTM A;  3JAT A;  3CME F;  3JAS B;  5GAN K;  5EB1 B;  3JAK B;  1QAH A;  2LCA A;  2UYN B;  3JAM M;  1YGY A;  2QEX F;  5IJ9 B;  3RYC B;  5IYZ A;  3P0Z A;  1T0A A;  2N48 A; 
#chains in the Genus database with same CATH homology
 5HY1 A;  2GLZ A;  3PAF A;  4BW0 B;  3WXM B;  3O85 A;  1ZWZ A;  1M90 H;  2QI2 A;  1K73 H;  1X7P A;  1GZ0 A;  1X7O A;  3CG6 A;  1VQP F;  2QA4 F;  1VQL F;  4BY9 D;  3CCS F;  2OTL F;  3N4Z A;  3LFO A;  3J81 M;  1VQ7 F;  1W3E X;  3VMF B;  3LWQ C;  5IT9 M;  3OBW A;  1M1K H;  5A2Q M;  3PLA C;  1VQO F;  5GAP K;  1JJ2 F;  3HAX D;  3D00 A;  1YJW F;  1VQ6 F;  1GO1 A;  2JNB A;  1IPA A;  3VI6 A;  3NK6 A;  1K8A H;  2ALE A;  3V7Q A;  4EI7 A;  1VQK F;  4BVS A;  5GIN C;  1N8R H;  1K9M H;  2BO1 A;  1KD1 H;  5G4U C;  3ON1 A;  1YJN F;  1YHQ F;  3NMU C;  1Q86 H;  3I55 F;  5DCV A;  1QVG F;  1GO0 A;  4XCQ A;  3CCQ F;  1RLG A;  4BVT A;  3CCL F;  4LCK A;  4EI8 A;  3RA6 A;  3V3T A;  1VQM F;  3NVK E;  3SIU A;  2LBW A;  3G4S F;  1DT9 A;  3CCV F;  1VQ8 F;  3NVI B;  1XBI A;  3MCA B;  5EWR A;  5HXZ A;  1VQN F;  3CPQ A;  2FGY A;  5HXU A;  3V7E A;  3J7A R;  1VQ5 F;  5GIO C;  3GYQ A;  1CK2 A;  2HVY D;  3CD6 F;  4BVQ A;  3FFM A;  5HWE A;  1W40 A;  1W2B F;  3SIV A;  3I56 F;  4TZZ A;  3CCE F;  1PXW A;  4BVR A;  3CCU F;  1QVF F;  2FC3 A;  1YIT F;  1Q7Y H;  5HY4 A;  2OZB A;  2VGN A;  3LWO C;  1YIJ F;  4X3L A;  4X3M A;  5GIP C;  1YJ9 F;  1Q81 H;  3J80 M;  2KTV A;  3NK7 A;  3OW2 F;  1X52 A;  1CN7 A;  5HY0 A;  5FLX M;  5EO3 A;  3G6E F;  1Q82 H;  3JCM M;  1VQ9 F;  3CC2 F;  5FJ4 C;  3CCM F;  3IR9 A;  3G71 F;  4NQ3 A;  3OBY A;  2VGM A;  2OHW A;  2KTU A;  5HY2 A;  2KG4 A;  2WAL A;  3CCR F;  2OTJ F;  1W41 A;  4C4W C;  1NMU B;  3E20 B;  1KC8 H;  1NJI H;  3CC7 F;  1SDS A;  1YI2 F;  3LWP C;  3CMA F;  3CPW F;  3RA5 A;  2CZW A;  4NUT A;  1RA4 A;  3HJW C;  5G4V C;  1S72 F;  3LWV C;  2I6D A;  3CXC F;  3CME F;  2AIF A;  3CCJ F;  1VQ4 F;  1E7K A;  5GAN K;  3CC4 F;  3E1Y A;  3JAM M;  4EI9 A;  2LBX A;  2F9Z C;  1W42 A;  3N4Y A;  3LWR C;  2QEX F;  1KQS F;  1T0K B;  3AGK A;  1H7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...