1KC8H

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kc8H00
3CCUF 1W3EX 3SIVA 4NUTA 2VGMA 3VI6A 2KG4A 3JCMM 1YI2F 1Q7YH 2JNBA 4X3LA 2QA4F 1W40A 3J80M 1VQPF 5GIOC 3IR9A 5FLXM 1QVGF 3CPWF 3VMFB 1VQKF 3CCVF 4TZZA 3I56F 1YITF 3CC2F 3CCJF 2QI2A 3GYQA 2LBXA 4LCKA 1X7OA 1VQLF 3HAXD 1KQSF 1ZWZA 1X52A 2CZWA 3O85A 3CCQF 2FC3A 3N4ZA 3G71F 1VQNF 3J7AR 1VQ6F 1M1KH 3CCRF 3LWPC 2KTUA 1M90H 2OTJF 3WXMB 5A2QM 3LWOC 3V7EA 3J81M 1S72F 1W41A 1QVFF 3OBWA 3CXCF 1VQOF 1RA4A 3RA5A 3CG6A 1E7KA 2HVYD 1K9MH 1K73H 2KTVA 3HJWC 2WALA 1W42A 3CMEF 2OHWA 3PLAC 3G4SF 1Q81H 2ALEA 3V7QA 3NVIB 1VQ7F 3CCLF 1PXWA 3OW2F 2VGNA 1YHQF 1KC8H 1CN7A 3NK6A 5FJ4C 4C4WC 4BW0B 1VQMF 5IT9M 1Q86H 1KD1H 3SIUA 1GO0A 3CCSF 3ON1A 5GANK 3LWQC 3CPQA 3MCAB 1N8RH 1VQ4F 5GIPC 5DCVA 3PAFA 1NJIH 3NK7A 5EO3A 1T0KB 1K8AH 1NMUB 1H7MA 3FFMA 5GAPK 3LFOA 3CD6F 3N4YA 1YJWF 1GO1A 3CCMF 5G4UC 5GINC 1RLGA 3NMUC 3OBYA 4BY9D 1SDSA 1VQ9F 1XBIA 2BO1A 5G4VC 1X7PA 3LWRC 3CMAF 3NVKE 3AGKA 1JJ2F 4X3MA 3E1YA 2OTLF 5EWRA 2LBWA 1YIJF 2AIFA 1Q82H 3I55F 3E20B 1VQ5F 3JAMM 1W2BF 2QEXF 3RA6A 1GZ0A 3LWVC 2OZBA 1CK2A 3CCEF 1DT9A 1VQ8F 2I6DA 3G6EF 1YJ9F 1YJNF 3CC4F 1IPAA 3CC7F
chains in the Genus database with same CATH superfamily
2UYNA 3P4EA 3SIVA 1YI2F 3VI6A 3VTIC 2LCAA 2JNBA 3HKCB 2ZVZA 4YJ3B 3IKFA 1OFUA 3F0GA 3RYFB 5JQGB 3CPWF 2DT4A 1ONIA 3ELCA 3JATB 4G4YA 2HX0A 1VQKF 3CCVF 5CA1A 5HXZA 3D00A 1XRGA 3KIZA 4XCQA 3GYQA 3K0TA 3VOBA 5B8FA 4O4JB 4X1IB 5HWEA 3JALB 4ZK7A 3M4SA 5LXTB 3QHDA 4RQOA 2KGWA 2R751 3JASB 4ZHVA 4I4TB 2YYEA 2K1SA 4TV8B 1M90H 3V7EA 2HQSC 3J81M 1W41A 5MN5A 1JN1A 1RQ7A 3CB2A 3WGLA 3FPIA 3M1XA 1VK3A 4F6RA 3V7QA 3CCLF 1PXWA 4BT4A 3V3TA 1YGYA 3NK6A 5FJ4C 2UYJA 3JAKA 1KD1H 1GO0A 5EZYA 3LWQC 4ZHQA 2Q1YA 4I55A 3MCAB 2UYPA 5JCOC 4ZHYB 5LOVA 5GIPC 5DCVA 3Q8HA 2VAWA 1NJIH 1VQVA 1TUBB 4IHJA 1FFXA 3WJQA 5C8YB 3LMEA 4U3JA 2IG8A 3C8LA 1J7HA 1H47A 3VOAA 1H7MA 4R40B 3LFOA 4EI7A 2GVIA 4G4VA 3MDOA 3UT5A 3U0OA 1IV2A 4EI8A 3F0FA 4X1KA 4BY9D 3T80A 3MCQA 3N2KA 4O4IB 3N2GA 3NVKE 3AGKA 1W5EA 4X3MA 3E1YA 5EWRA 3JAKB 4DRXA 1YIJF 5HP8A 2AIFA 2H6LA 4ZOLA 4ZHQB 3E20B 2YXZA 2GLZA 4I55B 2QEXF 3JVHA 3HWUA 3RYIA 2Z01A 3VYSC 5LOVB 4BT3A 5AVMA 2HS3A 4IHJB 3G6EF 1FFXB 1YJ9F 1YJNF 3CYQA 4U3JB 3V4DA 1JD1A 3C9TA 2ZODA 3CCUF 2H8EA 3JCMM 2KG4A 1NQ3A 5KMGA 4G4WA 1W40A 1JY8A 4BT7A 3J80M 1OAPA 1VQPF 1VH8A 4X1KB 5CB4A 5FLXM 3DDNA 2FGYA 3E22A 3F6MA 2LBTA 3C9SA 3D01A 2CHSA 4TZZA 3CCJF 4ZOLB 1SZQA 2Q1XA 3WJRA 4O2BA 1X7OA 2RHJA 3HKBB 5ITZA 3WGJA 3RYIB 2RB9A 2CSLA 2FC3A 4NQ3A 4X1YB 2Z1TA 4HNAA 3J7AR 1VQ6F 4TUYB 5GONA 3JARA 3RYCB 1QVFF 1VQOF 3S0YA 1RA4A 3RA5A 3CG6A 1E7KA 4WBNA 2KTVA 3E22B 3P0ZA 3TD3A 3LYBA 3NVIB 4C8EA 3GTZA 3S02A 3EORA 1YHQF 4NWOB 4G4ZA 1IV1A 5ITZB 1VQMF 1W5FA 4G88A 2UYNB 5FNVA 1Q86H 3JAWA 3CCSF 5IJ9A 4E6EA 4HNAB 4LNUA 2PHNA 4M8IA 2DYYA 1VQ4F 3L7QA 5GONB 3ZP7A 3LDTA 4YJ2A 1FSZA 3D54A 3B6NA 5EO3A 2Z1EA 1COMA 4WBNB 1NMUB 5LP6A 1K8AH 1T0KB 3P10A 1RQ2A 5CA1B 4B46A 2H8CA 1YJWF 5G4UC 5EB1B 3NMUC 3OBYA 5LA6A 1U3PA 2CW4A 2P6YA 3ZO8A 4C8IA 3S03A 4BT5A 3WPWA 4C81A 3VCZA 2HP0A 3M84A 1DBFA 3ESJA 1X25A 3FD6A 1QAHA 1JFFA 4U39A 5EYPA 3F0EA 5IJ9B 2L26A 2UYKA 1Z5VA 4LNUB 1W57A 3I7TA 2ZF8A 2BTOA 1TVKA 4ZI7A 3S06A 3RA6A 2RHOA 3LWVC 2OZBA 3CCEF 3WGKA 5LYJA 2HP3A 1RLUA 1IPAA 3CC7F 4O4HA 1W3EX 3KJJA 5LP6B 3HKDA 4NUTA 4F6RB 2BTQB 3VYUC 1Q7YH 5HY2A 2QA4F 4TV9A 4B45A 2W8BC 2CWJA 5LA6B 1QVGF 3IEWA 4X20A 2HP0B 3HTNA 4ERHA 5EZYB 1JFFB 1YITF 5EYPB 3CC2F 2Z1FA 4EI9A 1XHOA 5J2TA 2LBXA 2QTPA 4LCKA 1IV3A 3HKEA 5CA0A 1KQSF 2CZWA 1W55A 2PMPA 3O85A 2HRUA 3VO8A 5LYJB 3BYQA 3OONA 1VQNF 1KNKA 3HKDB 3UT5B 1UI9A 3LWPC 2KTUA 5LP6C 5A2QM 4TV9B 3LWOC 2VAPA 5KX5A 1S72F 3CXCF 4O4LA 3N2KB 3N2GB 4B5CA 4BVRA 2IAFA 4X20B 3HJWC 1XV2A 3RYCA 4DRXB 1W42A 3IEQA 2OHWA 3PLAC 1VQ7F 1KNJA 1W5BA 4YJ3A 2CHTA 4I50A 5J2TB 3K12A 1KC8H 3RYFA 5JQGA 3HKEB 3DC2A 3WGMA 5JH7A 5HP7A 3JATA 4BW0B 1PF5A 3SIUA 4BVQA 3MQWA 5KMGB 5BMVA 1H48A 3CPQA 5J2UA 1N8RH 5CB4B 1UFYA 3RE3A 4C8GA 4X1IA 5KX5B 3JALA 4O4LB 3K2XA 5LXTA 2MQEA 3FFMA 5IJ0A 3VIUA 4IIJA 4I4TA 2AMTA 1T0AA 5JCOA 3CCMF 4TV8A 5GINC 1RLGA 4O2BB 1SDSA 3CYPB 1VQ9F 2BO1A 1W5AA 4I50B 1X7PA 4PWTA 3TD4A 1Z5WA 5JH7B 1JJ2F 4BVSA 3C9RA 2LBWA 2CVLA 4DXDA 4O2AA 1Q82H 5BMVB 4RHAA 3WJPA 1VQ5F 2RHHA 3JAMM 2R6R1 3JARB 1W2BF 1GZ0A 1R1MA 5J2UB 1CK2A 3S0WA 1QD9A 2HRYA 4EB6A 5HY0A 3IKEA 4KWEA 5IJ0B 2VGMA 4IIJB 2IQQA 4X3LA 2GZLA 3ERNA 3K14A 3KE1A 3R0PA 2OTMA 5GIOC 3IR9A 2BTUA 3VMFB 1TUBA 5C8YA 5FNVB 3JAWB 1ODEA 2N48A 3I56F 3QTYA 2ZAUA 2QI2A 4O2AB 3S0HA 3C9UA 4FFBA 1SA0A 4YJ2B 1VQLF 3HAXD 1FNJA 1ZWZA 1X52A 4O4IA 5EIBD 1CLIA 4EB6B 3KHNA 3CCQF 3N4ZA 3G71F 2G9IA 2HS4A 5MN4A 1M1KH 3KJKA 5EAZA 3CCRF 3IMPA 1U3LA 2RHLA 2OTJF 3WXMB 5JVDA 1VHAA 2NMUA 1FNKA 4BT6A 3OBWA 2HVYD 1K9MH 1K73H 2I6RA 5HY1A 1GX1A 1U43A 5EIBC 1W59A 2EWCA 2WALA 1W581 4BVTA 3CMEF 3G4SF 1Q81H 2ALEA 1TVKB 4ZI7B 2V9YA 3OW2F 2VGNA 4FFBB 1SA0B 5EB0A 2Z1UA 3QUWA 1CN7A 1IV4A 1Q8RA 4C4WC 5IT9M 3MBMA 4O4HB 2VAMA 3WGNA 3ON1A 5GANK 3GHZA 3FBAA 3F0DA 3RYHA 5JVDB 5IYZA 2UZHA 3PAFA 1QU9A 3NK7A 3HKBA 2VXYA 4B62A 1YQNA 5GAPK 4X1YA 3HKCA 4TUYA 3N4YA 3CD6F 5HXUA 2HS0A 1GO1A 4ZHWA 3TD5A 2ZOVA 2ZVYA 4BT2A 5MN6A 5CA0B 1XBIA 5G4VC 3LWRC 3CMAF 2OTLF 3ZOPA 4G4XA 3FD5A 3VYTC 3I3FA 3I55F 4C82A 4O4JA 3RYHB 2B33A 3WPXA 3ZP4A 2AIZP 5IYZB 1DT9A 1VQ8F 2I6DA 5HY4A 3CC4F 2F9ZC 3JASA 1U40A
chains in the Genus database with same CATH topology
3CCUF 1W3EX 3SIVA 4NUTA 2VGMA 3VI6A 2KG4A 3JCMM 1YI2F 1Q7YH 2JNBA 5HY2A 4X3LA 2QA4F 1W40A 3J80M 1VQPF 5GIOC 3IR9A 5FLXM 1QVGF 3CPWF 3VMFB 2FGYA 1VQKF 3CCVF 4TZZA 3I56F 1YITF 5HXZA 3D00A 3CC2F 3CCJF 4EI9A 2QI2A 4XCQA 3GYQA 2LBXA 4LCKA 1X7OA 5HWEA 1VQLF 3HAXD 1KQSF 1ZWZA 1X52A 2CZWA 3O85A 3CCQF 2FC3A 3N4ZA 4NQ3A 3G71F 1VQNF 3J7AR 1VQ6F 1M1KH 3CCRF 3LWPC 2KTUA 2F9ZC 1M90H 2OTJF 3WXMB 5A2QM 3LWOC 3V7EA 3J81M 1S72F 1W41A 1QVFF 3OBWA 3CXCF 1VQOF 1RA4A 3RA5A 3CG6A 1E7KA 2HVYD 1K9MH 1K73H 5HY1A 4BVRA 2KTVA 3HJWC 2WALA 1W42A 4BVTA 3CMEF 2OHWA 3PLAC 3G4SF 1Q81H 2ALEA 3V7QA 3NVIB 1VQ7F 3CCLF 1PXWA 3OW2F 2VGNA 3V3TA 1YHQF 1KC8H 1CN7A 3NK6A 5FJ4C 4C4WC 4BW0B 1VQMF 5IT9M 1Q86H 1KD1H 3SIUA 1GO0A 3CCSF 3ON1A 4BVQA 5GANK 3LWQC 3CPQA 3MCAB 1N8RH 1VQ4F 5GIPC 5DCVA 3PAFA 1NJIH 3NK7A 5EO3A 1T0KB 1K8AH 1NMUB 1H7MA 3FFMA 5GAPK 3LFOA 4EI7A 3CD6F 3N4YA 5HXUA 1YJWF 1GO1A 3CCMF 4EI8A 5G4UC 5GINC 1RLGA 3NMUC 3OBYA 4BY9D 1SDSA 1VQ9F 1XBIA 2BO1A 5G4VC 1X7PA 3LWRC 3CMAF 3NVKE 3AGKA 1JJ2F 4X3MA 3E1YA 4BVSA 2OTLF 5EWRA 2LBWA 1YIJF 2AIFA 1Q82H 3I55F 3E20B 1VQ5F 3JAMM 1W2BF 2GLZA 2QEXF 3RA6A 1GZ0A 3LWVC 2OZBA 1CK2A 3CCEF 1DT9A 1VQ8F 5HY0A 2I6DA 3G6EF 5HY4A 1YJ9F 1YJNF 3CC4F 1IPAA 3CC7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU F;  1W3E X;  3SIV A;  4NUT A;  2VGM A;  3VI6 A;  2KG4 A;  3JCM M;  1YI2 F;  1Q7Y H;  2JNB A;  4X3L A;  2QA4 F;  1W40 A;  3J80 M;  1VQP F;  5GIO C;  3IR9 A;  5FLX M;  1QVG F;  3CPW F;  3VMF B;  1VQK F;  3CCV F;  4TZZ A;  3I56 F;  1YIT F;  3CC2 F;  3CCJ F;  2QI2 A;  3GYQ A;  2LBX A;  4LCK A;  1X7O A;  1VQL F;  3HAX D;  1KQS F;  1ZWZ A;  1X52 A;  2CZW A;  3O85 A;  3CCQ F;  2FC3 A;  3N4Z A;  3G71 F;  1VQN F;  3J7A R;  1VQ6 F;  1M1K H;  3CCR F;  3LWP C;  2KTU A;  1M90 H;  2OTJ F;  3WXM B;  5A2Q M;  3LWO C;  3V7E A;  3J81 M;  1S72 F;  1W41 A;  1QVF F;  3OBW A;  3CXC F;  1VQO F;  1RA4 A;  3RA5 A;  3CG6 A;  1E7K A;  2HVY D;  1K9M H;  1K73 H;  2KTV A;  3HJW C;  2WAL A;  1W42 A;  3CME F;  2OHW A;  3PLA C;  3G4S F;  1Q81 H;  2ALE A;  3V7Q A;  3NVI B;  1VQ7 F;  3CCL F;  1PXW A;  3OW2 F;  2VGN A;  1YHQ F;  1KC8 H;  1CN7 A;  3NK6 A;  5FJ4 C;  4C4W C;  4BW0 B;  1VQM F;  5IT9 M;  1Q86 H;  1KD1 H;  3SIU A;  1GO0 A;  3CCS F;  3ON1 A;  5GAN K;  3LWQ C;  3CPQ A;  3MCA B;  1N8R H;  1VQ4 F;  5GIP C;  5DCV A;  3PAF A;  1NJI H;  3NK7 A;  5EO3 A;  1T0K B;  1K8A H;  1NMU B;  1H7M A;  3FFM A;  5GAP K;  3LFO A;  3CD6 F;  3N4Y A;  1YJW F;  1GO1 A;  3CCM F;  5G4U C;  5GIN C;  1RLG A;  3NMU C;  3OBY A;  4BY9 D;  1SDS A;  1VQ9 F;  1XBI A;  2BO1 A;  5G4V C;  1X7P A;  3LWR C;  3CMA F;  3NVK E;  3AGK A;  1JJ2 F;  4X3M A;  3E1Y A;  2OTL F;  5EWR A;  2LBW A;  1YIJ F;  2AIF A;  1Q82 H;  3I55 F;  3E20 B;  1VQ5 F;  3JAM M;  1W2B F;  2QEX F;  3RA6 A;  1GZ0 A;  3LWV C;  2OZB A;  1CK2 A;  3CCE F;  1DT9 A;  1VQ8 F;  2I6D A;  3G6E F;  1YJ9 F;  1YJN F;  3CC4 F;  1IPA A;  3CC7 F; 
#chains in the Genus database with same CATH topology
 2UYN A;  3P4E A;  3SIV A;  1YI2 F;  3VI6 A;  3VTI C;  2LCA A;  2JNB A;  3HKC B;  2ZVZ A;  4YJ3 B;  3IKF A;  1OFU A;  3F0G A;  3RYF B;  5JQG B;  3CPW F;  2DT4 A;  1ONI A;  3ELC A;  3JAT B;  4G4Y A;  2HX0 A;  1VQK F;  3CCV F;  5CA1 A;  5HXZ A;  3D00 A;  1XRG A;  3KIZ A;  4XCQ A;  3GYQ A;  3K0T A;  3VOB A;  5B8F A;  4O4J B;  4X1I B;  5HWE A;  3JAL B;  4ZK7 A;  3M4S A;  5LXT B;  3QHD A;  4RQO A;  2KGW A;  2R75 1;  3JAS B;  4ZHV A;  4I4T B;  2YYE A;  2K1S A;  4TV8 B;  1M90 H;  3V7E A;  2HQS C;  3J81 M;  1W41 A;  5MN5 A;  1JN1 A;  1RQ7 A;  3CB2 A;  3WGL A;  3FPI A;  3M1X A;  1VK3 A;  4F6R A;  3V7Q A;  3CCL F;  1PXW A;  4BT4 A;  3V3T A;  1YGY A;  3NK6 A;  5FJ4 C;  2UYJ A;  3JAK A;  1KD1 H;  1GO0 A;  5EZY A;  3LWQ C;  4ZHQ A;  2Q1Y A;  4I55 A;  3MCA B;  2UYP A;  5JCO C;  4ZHY B;  5LOV A;  5GIP C;  5DCV A;  3Q8H A;  2VAW A;  1NJI H;  1VQV A;  1TUB B;  4IHJ A;  1FFX A;  3WJQ A;  5C8Y B;  3LME A;  4U3J A;  2IG8 A;  3C8L A;  1J7H A;  1H47 A;  3VOA A;  1H7M A;  4R40 B;  3LFO A;  4EI7 A;  2GVI A;  4G4V A;  3MDO A;  3UT5 A;  3U0O A;  1IV2 A;  4EI8 A;  3F0F A;  4X1K A;  4BY9 D;  3T80 A;  3MCQ A;  3N2K A;  4O4I B;  3N2G A;  3NVK E;  3AGK A;  1W5E A;  4X3M A;  3E1Y A;  5EWR A;  3JAK B;  4DRX A;  1YIJ F;  5HP8 A;  2AIF A;  2H6L A;  4ZOL A;  4ZHQ B;  3E20 B;  2YXZ A;  2GLZ A;  4I55 B;  2QEX F;  3JVH A;  3HWU A;  3RYI A;  2Z01 A;  3VYS C;  5LOV B;  4BT3 A;  5AVM A;  2HS3 A;  4IHJ B;  3G6E F;  1FFX B;  1YJ9 F;  1YJN F;  3CYQ A;  4U3J B;  3V4D A;  1JD1 A;  3C9T A;  2ZOD A;  3CCU F;  2H8E A;  3JCM M;  2KG4 A;  1NQ3 A;  5KMG A;  4G4W A;  1W40 A;  1JY8 A;  4BT7 A;  3J80 M;  1OAP A;  1VQP F;  1VH8 A;  4X1K B;  5CB4 A;  5FLX M;  3DDN A;  2FGY A;  3E22 A;  3F6M A;  2LBT A;  3C9S A;  3D01 A;  2CHS A;  4TZZ A;  3CCJ F;  4ZOL B;  1SZQ A;  2Q1X A;  3WJR A;  4O2B A;  1X7O A;  2RHJ A;  3HKB B;  5ITZ A;  3WGJ A;  3RYI B;  2RB9 A;  2CSL A;  2FC3 A;  4NQ3 A;  4X1Y B;  2Z1T A;  4HNA A;  3J7A R;  1VQ6 F;  4TUY B;  5GON A;  3JAR A;  3RYC B;  1QVF F;  1VQO F;  3S0Y A;  1RA4 A;  3RA5 A;  3CG6 A;  1E7K A;  4WBN A;  2KTV A;  3E22 B;  3P0Z A;  3TD3 A;  3LYB A;  3NVI B;  4C8E A;  3GTZ A;  3S02 A;  3EOR A;  1YHQ F;  4NWO B;  4G4Z A;  1IV1 A;  5ITZ B;  1VQM F;  1W5F A;  4G88 A;  2UYN B;  5FNV A;  1Q86 H;  3JAW A;  3CCS F;  5IJ9 A;  4E6E A;  4HNA B;  4LNU A;  2PHN A;  4M8I A;  2DYY A;  1VQ4 F;  3L7Q A;  5GON B;  3ZP7 A;  3LDT A;  4YJ2 A;  1FSZ A;  3D54 A;  3B6N A;  5EO3 A;  2Z1E A;  1COM A;  4WBN B;  1NMU B;  5LP6 A;  1K8A H;  1T0K B;  3P10 A;  1RQ2 A;  5CA1 B;  4B46 A;  2H8C A;  1YJW F;  5G4U C;  5EB1 B;  3NMU C;  3OBY A;  5LA6 A;  1U3P A;  2CW4 A;  2P6Y A;  3ZO8 A;  4C8I A;  3S03 A;  4BT5 A;  3WPW A;  4C81 A;  3VCZ A;  2HP0 A;  3M84 A;  1DBF A;  3ESJ A;  1X25 A;  3FD6 A;  1QAH A;  1JFF A;  4U39 A;  5EYP A;  3F0E A;  5IJ9 B;  2L26 A;  2UYK A;  1Z5V A;  4LNU B;  1W57 A;  3I7T A;  2ZF8 A;  2BTO A;  1TVK A;  4ZI7 A;  3S06 A;  3RA6 A;  2RHO A;  3LWV C;  2OZB A;  3CCE F;  3WGK A;  5LYJ A;  2HP3 A;  1RLU A;  1IPA A;  3CC7 F;  4O4H A;  1W3E X;  3KJJ A;  5LP6 B;  3HKD A;  4NUT A;  4F6R B;  2BTQ B;  3VYU C;  1Q7Y H;  5HY2 A;  2QA4 F;  4TV9 A;  4B45 A;  2W8B C;  2CWJ A;  5LA6 B;  1QVG F;  3IEW A;  4X20 A;  2HP0 B;  3HTN A;  4ERH A;  5EZY B;  1JFF B;  1YIT F;  5EYP B;  3CC2 F;  2Z1F A;  4EI9 A;  1XHO A;  5J2T A;  2LBX A;  2QTP A;  4LCK A;  1IV3 A;  3HKE A;  5CA0 A;  1KQS F;  2CZW A;  1W55 A;  2PMP A;  3O85 A;  2HRU A;  3VO8 A;  5LYJ B;  3BYQ A;  3OON A;  1VQN F;  1KNK A;  3HKD B;  3UT5 B;  1UI9 A;  3LWP C;  2KTU A;  5LP6 C;  5A2Q M;  4TV9 B;  3LWO C;  2VAP A;  5KX5 A;  1S72 F;  3CXC F;  4O4L A;  3N2K B;  3N2G B;  4B5C A;  4BVR A;  2IAF A;  4X20 B;  3HJW C;  1XV2 A;  3RYC A;  4DRX B;  1W42 A;  3IEQ A;  2OHW A;  3PLA C;  1VQ7 F;  1KNJ A;  1W5B A;  4YJ3 A;  2CHT A;  4I50 A;  5J2T B;  3K12 A;  1KC8 H;  3RYF A;  5JQG A;  3HKE B;  3DC2 A;  3WGM A;  5JH7 A;  5HP7 A;  3JAT A;  4BW0 B;  1PF5 A;  3SIU A;  4BVQ A;  3MQW A;  5KMG B;  5BMV A;  1H48 A;  3CPQ A;  5J2U A;  1N8R H;  5CB4 B;  1UFY A;  3RE3 A;  4C8G A;  4X1I A;  5KX5 B;  3JAL A;  4O4L B;  3K2X A;  5LXT A;  2MQE A;  3FFM A;  5IJ0 A;  3VIU A;  4IIJ A;  4I4T A;  2AMT A;  1T0A A;  5JCO A;  3CCM F;  4TV8 A;  5GIN C;  1RLG A;  4O2B B;  1SDS A;  3CYP B;  1VQ9 F;  2BO1 A;  1W5A A;  4I50 B;  1X7P A;  4PWT A;  3TD4 A;  1Z5W A;  5JH7 B;  1JJ2 F;  4BVS A;  3C9R A;  2LBW A;  2CVL A;  4DXD A;  4O2A A;  1Q82 H;  5BMV B;  4RHA A;  3WJP A;  1VQ5 F;  2RHH A;  3JAM M;  2R6R 1;  3JAR B;  1W2B F;  1GZ0 A;  1R1M A;  5J2U B;  1CK2 A;  3S0W A;  1QD9 A;  2HRY A;  4EB6 A;  5HY0 A;  3IKE A;  4KWE A;  5IJ0 B;  2VGM A;  4IIJ B;  2IQQ A;  4X3L A;  2GZL A;  3ERN A;  3K14 A;  3KE1 A;  3R0P A;  2OTM A;  5GIO C;  3IR9 A;  2BTU A;  3VMF B;  1TUB A;  5C8Y A;  5FNV B;  3JAW B;  1ODE A;  2N48 A;  3I56 F;  3QTY A;  2ZAU A;  2QI2 A;  4O2A B;  3S0H A;  3C9U A;  4FFB A;  1SA0 A;  4YJ2 B;  1VQL F;  3HAX D;  1FNJ A;  1ZWZ A;  1X52 A;  4O4I A;  5EIB D;  1CLI A;  4EB6 B;  3KHN A;  3CCQ F;  3N4Z A;  3G71 F;  2G9I A;  2HS4 A;  5MN4 A;  1M1K H;  3KJK A;  5EAZ A;  3CCR F;  3IMP A;  1U3L A;  2RHL A;  2OTJ F;  3WXM B;  5JVD A;  1VHA A;  2NMU A;  1FNK A;  4BT6 A;  3OBW A;  2HVY D;  1K9M H;  1K73 H;  2I6R A;  5HY1 A;  1GX1 A;  1U43 A;  5EIB C;  1W59 A;  2EWC A;  2WAL A;  1W58 1;  4BVT A;  3CME F;  3G4S F;  1Q81 H;  2ALE A;  1TVK B;  4ZI7 B;  2V9Y A;  3OW2 F;  2VGN A;  4FFB B;  1SA0 B;  5EB0 A;  2Z1U A;  3QUW A;  1CN7 A;  1IV4 A;  1Q8R A;  4C4W C;  5IT9 M;  3MBM A;  4O4H B;  2VAM A;  3WGN A;  3ON1 A;  5GAN K;  3GHZ A;  3FBA A;  3F0D A;  3RYH A;  5JVD B;  5IYZ A;  2UZH A;  3PAF A;  1QU9 A;  3NK7 A;  3HKB A;  2VXY A;  4B62 A;  1YQN A;  5GAP K;  4X1Y A;  3HKC A;  4TUY A;  3N4Y A;  3CD6 F;  5HXU A;  2HS0 A;  1GO1 A;  4ZHW A;  3TD5 A;  2ZOV A;  2ZVY A;  4BT2 A;  5MN6 A;  5CA0 B;  1XBI A;  5G4V C;  3LWR C;  3CMA F;  2OTL F;  3ZOP A;  4G4X A;  3FD5 A;  3VYT C;  3I3F A;  3I55 F;  4C82 A;  4O4J A;  3RYH B;  2B33 A;  3WPX A;  3ZP4 A;  2AIZ P;  5IYZ B;  1DT9 A;  1VQ8 F;  2I6D A;  5HY4 A;  3CC4 F;  2F9Z C;  3JAS A;  1U40 A; 
#chains in the Genus database with same CATH homology
 3CCU F;  1W3E X;  3SIV A;  4NUT A;  2VGM A;  3VI6 A;  2KG4 A;  3JCM M;  1YI2 F;  1Q7Y H;  2JNB A;  5HY2 A;  4X3L A;  2QA4 F;  1W40 A;  3J80 M;  1VQP F;  5GIO C;  3IR9 A;  5FLX M;  1QVG F;  3CPW F;  3VMF B;  2FGY A;  1VQK F;  3CCV F;  4TZZ A;  3I56 F;  1YIT F;  5HXZ A;  3D00 A;  3CC2 F;  3CCJ F;  4EI9 A;  2QI2 A;  4XCQ A;  3GYQ A;  2LBX A;  4LCK A;  1X7O A;  5HWE A;  1VQL F;  3HAX D;  1KQS F;  1ZWZ A;  1X52 A;  2CZW A;  3O85 A;  3CCQ F;  2FC3 A;  3N4Z A;  4NQ3 A;  3G71 F;  1VQN F;  3J7A R;  1VQ6 F;  1M1K H;  3CCR F;  3LWP C;  2KTU A;  2F9Z C;  1M90 H;  2OTJ F;  3WXM B;  5A2Q M;  3LWO C;  3V7E A;  3J81 M;  1S72 F;  1W41 A;  1QVF F;  3OBW A;  3CXC F;  1VQO F;  1RA4 A;  3RA5 A;  3CG6 A;  1E7K A;  2HVY D;  1K9M H;  1K73 H;  5HY1 A;  4BVR A;  2KTV A;  3HJW C;  2WAL A;  1W42 A;  4BVT A;  3CME F;  2OHW A;  3PLA C;  3G4S F;  1Q81 H;  2ALE A;  3V7Q A;  3NVI B;  1VQ7 F;  3CCL F;  1PXW A;  3OW2 F;  2VGN A;  3V3T A;  1YHQ F;  1KC8 H;  1CN7 A;  3NK6 A;  5FJ4 C;  4C4W C;  4BW0 B;  1VQM F;  5IT9 M;  1Q86 H;  1KD1 H;  3SIU A;  1GO0 A;  3CCS F;  3ON1 A;  4BVQ A;  5GAN K;  3LWQ C;  3CPQ A;  3MCA B;  1N8R H;  1VQ4 F;  5GIP C;  5DCV A;  3PAF A;  1NJI H;  3NK7 A;  5EO3 A;  1T0K B;  1K8A H;  1NMU B;  1H7M A;  3FFM A;  5GAP K;  3LFO A;  4EI7 A;  3CD6 F;  3N4Y A;  5HXU A;  1YJW F;  1GO1 A;  3CCM F;  4EI8 A;  5G4U C;  5GIN C;  1RLG A;  3NMU C;  3OBY A;  4BY9 D;  1SDS A;  1VQ9 F;  1XBI A;  2BO1 A;  5G4V C;  1X7P A;  3LWR C;  3CMA F;  3NVK E;  3AGK A;  1JJ2 F;  4X3M A;  3E1Y A;  4BVS A;  2OTL F;  5EWR A;  2LBW A;  1YIJ F;  2AIF A;  1Q82 H;  3I55 F;  3E20 B;  1VQ5 F;  3JAM M;  1W2B F;  2GLZ A;  2QEX F;  3RA6 A;  1GZ0 A;  3LWV C;  2OZB A;  1CK2 A;  3CCE F;  1DT9 A;  1VQ8 F;  5HY0 A;  2I6D A;  3G6E F;  5HY4 A;  1YJ9 F;  1YJN F;  3CC4 F;  1IPA A;  3CC7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...