3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
2ZVYA 5EAZA 3S06A 3OONA 4ERHA 4ZHVA 2HQSC 3CYQA 2K1SA 4G4YA 2ZF8A 2W8BC 2ZVZA 2LCAA 1R1MA 3CYPB 3WPXA 2KGWA 3KHNA 3S0HA 2LBTA 4G4WA 3S03A 4RHAA 3LDTA 2AIZP 3WPWA 4G4ZA 1OAPA 4G88A 4B62A 4ZHWA 5EB1B 3S02A 3TD4A 2L26A 5EB0A 3TD3A 3S0YA 4PWTA 4R40B 2N48A 4G4XA 4ZHYB 3TD5A 4G4VA 2MQEA 3S0WA 4B5CA 2ZOVA 3IMPA
chains in the Genus database with same CATH superfamily
4NUTA 1DBFA 4O4HB 3CPWF 3VIUA 2ZF8A 5J2TA 1KD1H 5J2UA 2RHOA 3FBAA 1SA0B 3V4DA 2LBTA 3IEWA 4U3JA 3S03A 1SZQA 3RA6A 3UT5A 2LBWA 3WPWA 2RHHA 4ZI7B 1JFFB 3RA5A 5LYJA 4ZHQA 3S02A 2L26A 5LA6B 4O4LA 3VO8A 2BTUA 2HRYA 3ZP7A 1YITF 3I56F 3CC7F 4I55B 2AMTA 4BVRA 1Q7YH 4O2BB 1S72F 1XBIA 5CA0B 4I4TB 5JH7B 3WPXA 3JARB 3WJRA 1Q81H 3WJPA 3M4SA 3KE1A 2UYKA 4R40B 3JASB 3KIZA 3JATB 2N48A 3ERNA 1FSZA 1Z5WA 5FJ4C 3HTNA 4X1YA 3CCQF 3JVHA 2ZODA 1GO0A 2BTOA 4FFBB 4X3LA 2CSLA 5FNVA 3EORA 1NQ3A 2CWJA 2HQSC 2GZLA 3LYBA 2FGYA 5EWRA 2ZVZA 2LCAA 4LNUB 3MDOA 1W3EX 1Z5VA 4EB6A 4X1IA 1COMA 4X20A 3WXMB 1ODEA 4C8IA 3HAXD 5KX5A 3RYCB 3JAKA 2Q1XA 3G6EF 3C9SA 3JAWA 3BYQA 2VAPA 1RLGA 3FD5A 3Q8HA 5AVMA 5LP6B 3B6NA 3WGMA 4TV8A 3CYQA 2EWCA 2QTPA 3SIUA 1W5FA 4O4IA 3I7TA 5GIOC 2UYPA 2W8BC 5ITZB 5CA1A 1FFXB 1FNJA 5FLXM 5HWEA 5GONB 5JQGA 2OHWA 4X1KB 1QAHA 2AIZP 3N2GB 5LOVB 1YIJF 1W55A 1Q82H 3HKBB 2GVIA 3MQWA 2OZBA 2HS0A 1KNJA 2HP0A 3CC4F 1PXWA 3GYQA 3TD5A 1YJWF 1W41A 4BVQA 1RQ7A 1U40A 2ZOVA 4B5CA 4TV9B 4O4JB 3VCZA 3LWRC 5KMGB 5EO3A 5IJ9A 3MBMA 2DYYA 1U3LA 1QU9A 1RA4A 3E22B 3ZOPA 5CB4A 4IHJA 5EZYA 4TZZA 3S0HA 3DDNA 2H8CA 5IYZB 2G9IA 2CVLA 2QI2A 3N2KA 2HP3A 5B8FA 3QTYA 2CW4A 4ZK7A 4I50B 4BT2A 2PHNA 1VQ8F 2FC3A 2I6DA 2R6R1 2ALEA 2UZHA 3C9TA 4LCKA 4O2AB 3MCQA 3VYTC 3E20B 1GX1A 4O4HA 1VQ5F 3VMFB 3CYPB 4YJ2B 3F0DA 2H8EA 1VHAA 3D00A 1SA0A 2LBXA 4G4ZA 3I55F 5HY4A 1VQNF 1JFFA 5LA6A 5HY0A 3RYIA 2NMUA 5GANK 1CN7A 1TUBB 4M8IA 3JALA 3WGLA 3CCJF 3D54A 5HY2A 5EYPA 4BT3A 5J2UB 1Q8RA 3LWOC 1JD1A 4I55A 1XHOA 4O2BA 4BY9D 1PF5A 4U3JB 3LWVC 5CA0A 1XRGA 3RYFA 4I4TA 1IV4A 1W5AA 4G4WA 3JARA 5G4VC 4C81A 4HNAB 3MCAB 3IR9A 3NVIB 2RB9A 3HJWC 1DT9A 4G4XA 3CCUF 1IPAA 3JATA 1VQVA 3LWQC 3HKDB 1X7PA 3HKCA 5IT9M 3LMEA 1OFUA 3G71F 2P6YA 4NQ3A 3SIVA 1YGYA 1VQOF 2VXYA 4G4YA 2AIFA 3RYHB 3N4ZA 2IQQA 2OTMA 2KGWA 5GIPC 4C4WC 2Z1TA 4LNUA 5MN4A 1KNKA 2B33A 3C9UA 3U0OA 4YJ3B 4ZHWA 4WBNA 3KJKA 4BT4A 5JVDB 1YJNF 3E1YA 3CXCF 3GTZA 4X1YB 1H47A 4PWTA 1SDSA 3RYCA 3NK7A 4IIJB 3LFOA 5A2QM 5FNVB 1T0AA 2MQEA 3M1XA 5MN6A 1K9MH 3CCMF 4EI9A 4NWOB 5JCOC 1TVKA 2H6LA 1VQPF 1YHQF 4B45A 2Z01A 1JN1A 2RHJA 5LP6A 4EB6B 4X1IB 4X20B 3CC2F 1FFXA 1JJ2F 1J7HA 5GONA 2VAMA 4X1KA 3G4SF 3JAWB 3HKBA 5MN5A 2IG8A 3PAFA 1QVGF 2Z1EA 5DCVA 1E7KA 4TV8B 3NMUC 5LXTB 3V7QA 3TD4A 3V7EA 3CCLF 2DT4A 5KMGA 4ZHVA 3CCEF 5CA1B 2HRUA 3K2XA 3VTIC 1QVFF 5IJ0A 5EIBC 5JQGB 2QEXF 3NK6A 4F6RB 3F0EA 1NJIH 4TUYB 3CCSF 2HVYD 2JNBA 2CZWA 1GZ0A 3HKEA 2Q1YA 4B62A 2KTVA 5EB1B 2UYNB 5IYZA 1VH8A 2HP0B 1VQLF 5EB0A 2F9ZC 3K0TA 2V9YA 3CMAF 1W5EA 1K73H 4C8GA 5IJ9B 1U3PA 3S0WA 1W5BA 5BMVB 4E6EA 1JY8A 5EIBD 1U43A 1M1KH 3ZO8A 5HXUA 4DRXB 1Q86H 4ZOLA 1W57A 5C8YB 2HS4A 2YXZA 3QUWA 4O2AA 1KC8H 3L7QA 1X25A 3P0ZA 3GHZA 2KG4A 3K14A 3LDTA 3J7AR 5HP8A 5GINC 3AGKA 1IV2A 4BW0B 4ZI7A 4KWEA 3WJQA 3J80M 1YI2F 3CMEF 3ESJA 3S06A 1TUBA 1X52A 4ERHA 5J2TB 1YQNA 3WGKA 2CHSA 3OW2F 3VOAA 5G4UC 3NVKE 1VQKF 1X7OA 1GO1A 1W40A 5HXZA 3JAMM 3KJJA 1ONIA 3UT5B 2YYEA 5JH7A 3VYSC 4ZHQB 5LYJB 3C9RA 1M90H 2PMPA 4O4LB 3RYIB 4HNAA 4DXDA 2I6RA 3JALB 2WALA 1H7MA 3D01A 4ZHYB 3JASA 5EYPB 3PLAC 2GLZA 1CLIA 2ZVYA 3VI6A 3HKDA 3FPIA 3JCMM 4FFBA 1T0KB 3WGNA 2RHLA 3RYFB 4BVSA 3RYHA 2VGMA 1W2BF 1UFYA 4U39A 5HY1A 3HWUA 4RHAA 4C8EA 3P10A 2OTLF 3IKFA 3OBWA 3S0YA 4YJ3A 1ZWZA 2KTUA 5JVDA 2VGNA 3ELCA 3VYUC 3I3FA 2IAFA 3HKCB 4B46A 1W59A 4IIJA 1IV1A 3CPQA 4BT7A 3DC2A 3OONA 1FNKA 3FD6A 3ZP4A 3CCVF 2K1SA 3ON1A 2VAWA 3T80A 3QHDA 1VQ9F 3LWPC 5LP6C 1R1MA 1NMUB 4EI8A 3WGJA 4WBNB 5ITZA 5KX5B 4EI7A 5HP7A 3RE3A 3JAKB 1UI9A 2HX0A 3FFMA 3N2GA 3TD3A 4BT5A 5LOVA 3F0GA 1H48A 3C8LA 5JCOA 4BT6A 1TVKB 2Z1UA 1VQ4F 1YJ9F 5EAZA 1W581 4O4IB 5LXTA 4TV9A 4O4JA 2Z1FA 2ZAUA 4RQOA 4C82A 3E22A 3KHNA 4F6RA 1XV2A 1RLUA 4TUYA 1W42A 1OAPA 3IKEA 3N4YA 2UYNA 1N8RH 3O85A 3K12A 3CCRF 3CB2A 3IMPA 4XCQA 5BMVA 5IJ0B 4I50A 1VK3A 1CK2A 1KQSF 2OTJF 1RQ2A 3VOBA 2UYJA 5CB4B 1IV3A 2BTQB 4IHJB 3V3TA 5EZYB 4DRXA 2CHTA 5C8YA 2BO1A 3HKEB 3OBYA 3P4EA 3N2KB 1K8AH 3IEQA 3CD6F 4YJ2A 2QA4F 4G88A 3F0FA 1VQMF 5GAPK 2R751 3R0PA 1QD9A 3M84A 4X3MA 4BVTA 3CG6A 1VQ6F 4G4VA 3F6MA 2HS3A 3J81M 1VQ7F 4ZOLB
chains in the Genus database with same CATH topology
2ZVYA 5EAZA 3S06A 3OONA 4ERHA 4ZHVA 2HQSC 3CYQA 2K1SA 4G4YA 2ZF8A 2W8BC 2ZVZA 2LCAA 1R1MA 3CYPB 3WPXA 2KGWA 3KHNA 3S0HA 2LBTA 4G4WA 3S03A 4RHAA 3LDTA 2AIZP 3WPWA 4G4ZA 1OAPA 4G88A 4B62A 4ZHWA 5EB1B 3S02A 3TD4A 2L26A 5EB0A 3TD3A 3S0YA 4PWTA 4R40B 2N48A 4G4XA 4ZHYB 3TD5A 4G4VA 2MQEA 3S0WA 4B5CA 2ZOVA 3IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  5EAZ A;  3S06 A;  3OON A;  4ERH A;  4ZHV A;  2HQS C;  3CYQ A;  2K1S A;  4G4Y A;  2ZF8 A;  2W8B C;  2ZVZ A;  2LCA A;  1R1M A;  3CYP B;  3WPX A;  2KGW A;  3KHN A;  3S0H A;  2LBT A;  4G4W A;  3S03 A;  4RHA A;  3LDT A;  2AIZ P;  3WPW A;  4G4Z A;  1OAP A;  4G88 A;  4B62 A;  4ZHW A;  5EB1 B;  3S02 A;  3TD4 A;  2L26 A;  5EB0 A;  3TD3 A;  3S0Y A;  4PWT A;  4R40 B;  2N48 A;  4G4X A;  4ZHY B;  3TD5 A;  4G4V A;  2MQE A;  3S0W A;  4B5C A;  2ZOV A;  3IMP A; 
#chains in the Genus database with same CATH topology
 4NUT A;  1DBF A;  4O4H B;  3CPW F;  3VIU A;  2ZF8 A;  5J2T A;  1KD1 H;  5J2U A;  2RHO A;  3FBA A;  1SA0 B;  3V4D A;  2LBT A;  3IEW A;  4U3J A;  3S03 A;  1SZQ A;  3RA6 A;  3UT5 A;  2LBW A;  3WPW A;  2RHH A;  4ZI7 B;  1JFF B;  3RA5 A;  5LYJ A;  4ZHQ A;  3S02 A;  2L26 A;  5LA6 B;  4O4L A;  3VO8 A;  2BTU A;  2HRY A;  3ZP7 A;  1YIT F;  3I56 F;  3CC7 F;  4I55 B;  2AMT A;  4BVR A;  1Q7Y H;  4O2B B;  1S72 F;  1XBI A;  5CA0 B;  4I4T B;  5JH7 B;  3WPX A;  3JAR B;  3WJR A;  1Q81 H;  3WJP A;  3M4S A;  3KE1 A;  2UYK A;  4R40 B;  3JAS B;  3KIZ A;  3JAT B;  2N48 A;  3ERN A;  1FSZ A;  1Z5W A;  5FJ4 C;  3HTN A;  4X1Y A;  3CCQ F;  3JVH A;  2ZOD A;  1GO0 A;  2BTO A;  4FFB B;  4X3L A;  2CSL A;  5FNV A;  3EOR A;  1NQ3 A;  2CWJ A;  2HQS C;  2GZL A;  3LYB A;  2FGY A;  5EWR A;  2ZVZ A;  2LCA A;  4LNU B;  3MDO A;  1W3E X;  1Z5V A;  4EB6 A;  4X1I A;  1COM A;  4X20 A;  3WXM B;  1ODE A;  4C8I A;  3HAX D;  5KX5 A;  3RYC B;  3JAK A;  2Q1X A;  3G6E F;  3C9S A;  3JAW A;  3BYQ A;  2VAP A;  1RLG A;  3FD5 A;  3Q8H A;  5AVM A;  5LP6 B;  3B6N A;  3WGM A;  4TV8 A;  3CYQ A;  2EWC A;  2QTP A;  3SIU A;  1W5F A;  4O4I A;  3I7T A;  5GIO C;  2UYP A;  2W8B C;  5ITZ B;  5CA1 A;  1FFX B;  1FNJ A;  5FLX M;  5HWE A;  5GON B;  5JQG A;  2OHW A;  4X1K B;  1QAH A;  2AIZ P;  3N2G B;  5LOV B;  1YIJ F;  1W55 A;  1Q82 H;  3HKB B;  2GVI A;  3MQW A;  2OZB A;  2HS0 A;  1KNJ A;  2HP0 A;  3CC4 F;  1PXW A;  3GYQ A;  3TD5 A;  1YJW F;  1W41 A;  4BVQ A;  1RQ7 A;  1U40 A;  2ZOV A;  4B5C A;  4TV9 B;  4O4J B;  3VCZ A;  3LWR C;  5KMG B;  5EO3 A;  5IJ9 A;  3MBM A;  2DYY A;  1U3L A;  1QU9 A;  1RA4 A;  3E22 B;  3ZOP A;  5CB4 A;  4IHJ A;  5EZY A;  4TZZ A;  3S0H A;  3DDN A;  2H8C A;  5IYZ B;  2G9I A;  2CVL A;  2QI2 A;  3N2K A;  2HP3 A;  5B8F A;  3QTY A;  2CW4 A;  4ZK7 A;  4I50 B;  4BT2 A;  2PHN A;  1VQ8 F;  2FC3 A;  2I6D A;  2R6R 1;  2ALE A;  2UZH A;  3C9T A;  4LCK A;  4O2A B;  3MCQ A;  3VYT C;  3E20 B;  1GX1 A;  4O4H A;  1VQ5 F;  3VMF B;  3CYP B;  4YJ2 B;  3F0D A;  2H8E A;  1VHA A;  3D00 A;  1SA0 A;  2LBX A;  4G4Z A;  3I55 F;  5HY4 A;  1VQN F;  1JFF A;  5LA6 A;  5HY0 A;  3RYI A;  2NMU A;  5GAN K;  1CN7 A;  1TUB B;  4M8I A;  3JAL A;  3WGL A;  3CCJ F;  3D54 A;  5HY2 A;  5EYP A;  4BT3 A;  5J2U B;  1Q8R A;  3LWO C;  1JD1 A;  4I55 A;  1XHO A;  4O2B A;  4BY9 D;  1PF5 A;  4U3J B;  3LWV C;  5CA0 A;  1XRG A;  3RYF A;  4I4T A;  1IV4 A;  1W5A A;  4G4W A;  3JAR A;  5G4V C;  4C81 A;  4HNA B;  3MCA B;  3IR9 A;  3NVI B;  2RB9 A;  3HJW C;  1DT9 A;  4G4X A;  3CCU F;  1IPA A;  3JAT A;  1VQV A;  3LWQ C;  3HKD B;  1X7P A;  3HKC A;  5IT9 M;  3LME A;  1OFU A;  3G71 F;  2P6Y A;  4NQ3 A;  3SIV A;  1YGY A;  1VQO F;  2VXY A;  4G4Y A;  2AIF A;  3RYH B;  3N4Z A;  2IQQ A;  2OTM A;  2KGW A;  5GIP C;  4C4W C;  2Z1T A;  4LNU A;  5MN4 A;  1KNK A;  2B33 A;  3C9U A;  3U0O A;  4YJ3 B;  4ZHW A;  4WBN A;  3KJK A;  4BT4 A;  5JVD B;  1YJN F;  3E1Y A;  3CXC F;  3GTZ A;  4X1Y B;  1H47 A;  4PWT A;  1SDS A;  3RYC A;  3NK7 A;  4IIJ B;  3LFO A;  5A2Q M;  5FNV B;  1T0A A;  2MQE A;  3M1X A;  5MN6 A;  1K9M H;  3CCM F;  4EI9 A;  4NWO B;  5JCO C;  1TVK A;  2H6L A;  1VQP F;  1YHQ F;  4B45 A;  2Z01 A;  1JN1 A;  2RHJ A;  5LP6 A;  4EB6 B;  4X1I B;  4X20 B;  3CC2 F;  1FFX A;  1JJ2 F;  1J7H A;  5GON A;  2VAM A;  4X1K A;  3G4S F;  3JAW B;  3HKB A;  5MN5 A;  2IG8 A;  3PAF A;  1QVG F;  2Z1E A;  5DCV A;  1E7K A;  4TV8 B;  3NMU C;  5LXT B;  3V7Q A;  3TD4 A;  3V7E A;  3CCL F;  2DT4 A;  5KMG A;  4ZHV A;  3CCE F;  5CA1 B;  2HRU A;  3K2X A;  3VTI C;  1QVF F;  5IJ0 A;  5EIB C;  5JQG B;  2QEX F;  3NK6 A;  4F6R B;  3F0E A;  1NJI H;  4TUY B;  3CCS F;  2HVY D;  2JNB A;  2CZW A;  1GZ0 A;  3HKE A;  2Q1Y A;  4B62 A;  2KTV A;  5EB1 B;  2UYN B;  5IYZ A;  1VH8 A;  2HP0 B;  1VQL F;  5EB0 A;  2F9Z C;  3K0T A;  2V9Y A;  3CMA F;  1W5E A;  1K73 H;  4C8G A;  5IJ9 B;  1U3P A;  3S0W A;  1W5B A;  5BMV B;  4E6E A;  1JY8 A;  5EIB D;  1U43 A;  1M1K H;  3ZO8 A;  5HXU A;  4DRX B;  1Q86 H;  4ZOL A;  1W57 A;  5C8Y B;  2HS4 A;  2YXZ A;  3QUW A;  4O2A A;  1KC8 H;  3L7Q A;  1X25 A;  3P0Z A;  3GHZ A;  2KG4 A;  3K14 A;  3LDT A;  3J7A R;  5HP8 A;  5GIN C;  3AGK A;  1IV2 A;  4BW0 B;  4ZI7 A;  4KWE A;  3WJQ A;  3J80 M;  1YI2 F;  3CME F;  3ESJ A;  3S06 A;  1TUB A;  1X52 A;  4ERH A;  5J2T B;  1YQN A;  3WGK A;  2CHS A;  3OW2 F;  3VOA A;  5G4U C;  3NVK E;  1VQK F;  1X7O A;  1GO1 A;  1W40 A;  5HXZ A;  3JAM M;  3KJJ A;  1ONI A;  3UT5 B;  2YYE A;  5JH7 A;  3VYS C;  4ZHQ B;  5LYJ B;  3C9R A;  1M90 H;  2PMP A;  4O4L B;  3RYI B;  4HNA A;  4DXD A;  2I6R A;  3JAL B;  2WAL A;  1H7M A;  3D01 A;  4ZHY B;  3JAS A;  5EYP B;  3PLA C;  2GLZ A;  1CLI A;  2ZVY A;  3VI6 A;  3HKD A;  3FPI A;  3JCM M;  4FFB A;  1T0K B;  3WGN A;  2RHL A;  3RYF B;  4BVS A;  3RYH A;  2VGM A;  1W2B F;  1UFY A;  4U39 A;  5HY1 A;  3HWU A;  4RHA A;  4C8E A;  3P10 A;  2OTL F;  3IKF A;  3OBW A;  3S0Y A;  4YJ3 A;  1ZWZ A;  2KTU A;  5JVD A;  2VGN A;  3ELC A;  3VYU C;  3I3F A;  2IAF A;  3HKC B;  4B46 A;  1W59 A;  4IIJ A;  1IV1 A;  3CPQ A;  4BT7 A;  3DC2 A;  3OON A;  1FNK A;  3FD6 A;  3ZP4 A;  3CCV F;  2K1S A;  3ON1 A;  2VAW A;  3T80 A;  3QHD A;  1VQ9 F;  3LWP C;  5LP6 C;  1R1M A;  1NMU B;  4EI8 A;  3WGJ A;  4WBN B;  5ITZ A;  5KX5 B;  4EI7 A;  5HP7 A;  3RE3 A;  3JAK B;  1UI9 A;  2HX0 A;  3FFM A;  3N2G A;  3TD3 A;  4BT5 A;  5LOV A;  3F0G A;  1H48 A;  3C8L A;  5JCO A;  4BT6 A;  1TVK B;  2Z1U A;  1VQ4 F;  1YJ9 F;  5EAZ A;  1W58 1;  4O4I B;  5LXT A;  4TV9 A;  4O4J A;  2Z1F A;  2ZAU A;  4RQO A;  4C82 A;  3E22 A;  3KHN A;  4F6R A;  1XV2 A;  1RLU A;  4TUY A;  1W42 A;  1OAP A;  3IKE A;  3N4Y A;  2UYN A;  1N8R H;  3O85 A;  3K12 A;  3CCR F;  3CB2 A;  3IMP A;  4XCQ A;  5BMV A;  5IJ0 B;  4I50 A;  1VK3 A;  1CK2 A;  1KQS F;  2OTJ F;  1RQ2 A;  3VOB A;  2UYJ A;  5CB4 B;  1IV3 A;  2BTQ B;  4IHJ B;  3V3T A;  5EZY B;  4DRX A;  2CHT A;  5C8Y A;  2BO1 A;  3HKE B;  3OBY A;  3P4E A;  3N2K B;  1K8A H;  3IEQ A;  3CD6 F;  4YJ2 A;  2QA4 F;  4G88 A;  3F0F A;  1VQM F;  5GAP K;  2R75 1;  3R0P A;  1QD9 A;  3M84 A;  4X3M A;  4BVT A;  3CG6 A;  1VQ6 F;  4G4V A;  3F6M A;  2HS3 A;  3J81 M;  1VQ7 F;  4ZOL B; 
#chains in the Genus database with same CATH homology
 2ZVY A;  5EAZ A;  3S06 A;  3OON A;  4ERH A;  4ZHV A;  2HQS C;  3CYQ A;  2K1S A;  4G4Y A;  2ZF8 A;  2W8B C;  2ZVZ A;  2LCA A;  1R1M A;  3CYP B;  3WPX A;  2KGW A;  3KHN A;  3S0H A;  2LBT A;  4G4W A;  3S03 A;  4RHA A;  3LDT A;  2AIZ P;  3WPW A;  4G4Z A;  1OAP A;  4G88 A;  4B62 A;  4ZHW A;  5EB1 B;  3S02 A;  3TD4 A;  2L26 A;  5EB0 A;  3TD3 A;  3S0Y A;  4PWT A;  4R40 B;  2N48 A;  4G4X A;  4ZHY B;  3TD5 A;  4G4V A;  2MQE A;  3S0W A;  4B5C A;  2ZOV A;  3IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...