3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
source organism Helicobacter pylori
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
2AIZP 2LCAA 3TD5A 4B5CA 3CYQA 4ZHYB 3KHNA 3WPXA 5EAZA 4G4YA 4G4VA 4ERHA 3S03A 5EB1B 2ZF8A 1R1MA 2MQEA 4R40B 2K1SA 3WPWA 4G4ZA 2HQSC 2L26A 3TD4A 2W8BC 3TD3A 4ZHVA 2ZVYA 3OONA 4B62A 4G4XA 2N48A 3CYPB 3IMPA 3LDTA 2ZVZA 2KGWA 3S0YA 1OAPA 4RHAA 5EB0A 3S0WA 3S02A 2ZOVA 4PWTA 2LBTA 3S06A 3S0HA 4G4WA 4G88A 4ZHWA
chains in the Genus database with same CATH superfamily
3CCUF 2Q1YA 1VQVA 4I50B 1XV2A 5HY2A 3QTYA 3WPXA 3I55F 4O4JA 1TVKB 2PHNA 3S03A 1T0KB 5IJ9B 3JAKA 2JNBA 2HP3A 3FD5A 3FFMA 4R40B 3RYIB 2FC3A 2VAPA 4ZOLA 3GTZA 3HKBB 3LWQC 3G71F 3CPQA 5C8YA 1QAHA 3V7EA 2CHSA 3LYBA 4X1KB 3JASA 2RHHA 5IYZB 2ZOVA 1NJIH 3KJKA 5KX5B 5GINC 2KTVA 1QVGF 2NMUA 4BT2A 2QA4F 3V4DA 2ZAUA 1QVFF 3CCQF 4F6RB 1Q81H 1VQNF 3SIVA 1VQ7F 5BMVA 3ZP7A 3O85A 4FFBA 3SIUA 2UYJA 2RB9A 4X3LA 1S72F 3P10A 4ZHVA 1W40A 3CCMF 4B62A 4TV9A 1JY8A 3V3TA 3KIZA 5EYPB 1Q82H 3LFOA 3N2GA 4DRXA 2IAFA 1GX1A 4O4LB 5MN6A 3MCQA 4ZI7A 5LA6B 2HP0B 2OZBA 5EZYA 5ITZB 2B33A 4TUYB 5LXTB 1U43A 2CVLA 1COMA 4ZHQA 1FFXB 2IG8A 3C8LA 5GONA 3VTIC 4TZZA 2YYEA 3F0EA 3NMUC 4HNAA 1VH8A 3JCMM 3E1YA 1W57A 4X20A 1T0AA 1M1KH 3S0YA 4X1IA 3JVHA 4YJ3A 3BYQA 2OTMA 1K9MH 4I4TB 2ALEA 1Z5VA 1DT9A 3JATA 1UI9A 1VQ6F 4I50A 3L7QA 5IT9M 1SDSA 1TVKA 4BW0B 4B45A 5EO3A 3RYHB 2HS0A 5IJ9A 4BVTA 3F6MA 3ZP4A 2UYNB 4BVSA 3RYIA 5HP8A 4ERHA 5FNVB 3HKBA 2HRYA 1GO0A 1SZQA 1VQ9F 3HKEA 1JFFB 1W2BF 4NUTA 4X1KA 3F0GA 5IYZA 3CPWF 3WGMA 4O2AB 5LP6B 3WGLA 5FJ4C 2G9IA 2YXZA 1CLIA 5KX5A 2KTUA 2K1SA 1YITF 3JARB 3VMFB 3CYPB 3D54A 4F6RA 4I55B 2H8EA 3J7AR 4C82A 2QI2A 2UYKA 3VOBA 3S02A 5G4VC 3Q8HA 3B6NA 5DCVA 3HKDB 3RYCB 1U3PA 1W581 1W5BA 4X3MA 5EAZA 5EYPA 4G4YA 1H7MA 4BT7A 3VO8A 1J7HA 4EI8A 2HVYD 1JJ2F 3FD6A 3I7TA 5EB1B 4EI9A 3CC7F 5CA0B 3LWVC 4BVRA 4O4LA 5LA6A 4C4WC 2ZVYA 5JQGB 1X25A 2HP0A 3HWUA 2I6RA 3IMPA 3QUWA 3VOAA 5ITZA 4TUYA 2CZWA 4M8IA 5LXTA 1YIJF 1X52A 1IV1A 1FFXA 3OBYA 1PXWA 3C9RA 3EORA 3M4SA 2VAMA 3K0TA 1U3LA 4ZHYB 1KNKA 5HY4A 5HWEA 4O4HB 2RHLA 3WXMB 2HS3A 3NVKE 2ZF8A 3E20B 5J2UB 3HTNA 1VQ4F 5GAPK 4YJ2A 3PLAC 4U3JB 3N2KB 2L26A 4I4TA 4IIJB 1YJWF 2HX0A 4G4XA 4DXDA 4U39A 4X1YB 1YGYA 1XHOA 2PMPA 1OAPA 2QTPA 3LWRC 3G4SF 3WGNA 2AIFA 3IKFA 3S0HA 3GHZA 2LBXA 2BTOA 3CG6A 1SA0B 3RE3A 1Q7YH 1JN1A 3CCLF 4EB6A 2F9ZC 1KD1H 3T80A 4E6EA 5HXUA 3RYHA 1FSZA 1IPAA 2UYNA 2Z01A 5HY0A 5FNVA 1DBFA 2Q1XA 2VXYA 1Q86H 2BO1A 3CMAF 1JFFA 1IV2A 5EIBC 3VYSC 3HJWC 1KNJA 3N4YA 3IEWA 4WBNB 3CMEF 3CD6F 2H8CA 1W42A 3F0FA 2AMTA 1VHAA 4O2AA 5LP6A 5HXZA 1W5EA 2BTUA 3JARA 3K2XA 4I55A 1RQ2A 2EWCA 3HKCB 3AGKA 4XCQA 3UT5B 2OHWA 1KQSF 4LNUB 3HKDA 3RYCA 5IJ0B 1QD9A 1W41A 2HRUA 1W59A 3LWPC 1YI2F 1XBIA 5LP6C 3C9SA 4C8EA 4BY9D 5JVDB 2Z1FA 2VAWA 5EB0A 3S0WA 1VQMF 5CA0A 5LYJB 1GZ0A 4FFBB 3S06A 4G4WA 4ZHWA 2AIZP 1M90H 3P4EA 3OW2F 5JQGA 5JH7B 3G6EF 3CCSF 1Z5WA 5LOVB 3FBAA 3I56F 3N2GB 1R1MA 2MQEA 5CA1B 3CB2A 3RA5A 3WPWA 2R6R1 4BT3A 2HQSC 4EI7A 2HS4A 3ZOPA 1E7KA 4TV8B 4O4HA 3IR9A 3JALB 5EZYB 2V9YA 3ELCA 3WJRA 2Z1TA 4BVQA 4ZHQB 5J2UA 2Z1EA 3LWOC 1H48A 4U3JA 1W55A 2CWJA 3N2KA 4IIJA 2RHJA 1Q8RA 3FPIA 2DYYA 4X1YA 3KJJA 1IV3A 1VQKF 4C81A 2LBWA 3M1XA 1CK2A 2R751 3PAFA 1OFUA 1SA0A 3RA6A 4O4IB 3TD3A 2GVIA 4B46A 3LDTA 2ZVZA 3E22B 3NK7A 3ZO8A 1FNKA 4PWTA 2KG4A 4C8IA 5CB4B 1RLGA 3MDOA 1N8RH 1X7OA 4G88A 3TD5A 5GANK 3VI6A 4C8GA 1NQ3A 3M84A 4WBNA 1KC8H 3OBWA 1TUBB 2OTJF 4G4VA 1CN7A 5KMGB 5J2TB 2GZLA 3HKEB 3K14A 3VYUC 2VGNA 1ONIA 3HKCA 1XRGA 4NQ3A 3JAWB 1W5FA 3P0ZA 3UT5A 4ZK7A 2KGWA 4LNUA 1IV4A 3F0DA 1YHQF 1VQ5F 3RYFB 3VCZA 1GO1A 5IJ0A 1RLUA 1YJNF 4B5CA 3CYQA 3KHNA 3WJQA 4IHJB 1RQ7A 3VYTC 3U0OA 4O2BB 5JVDA 1W3EX 1NMUB 5LYJA 5FLXM 3VIUA 5JH7A 1FNJA 3WJPA 5GIOC 1VQPF 4RQOA 4BT4A 3ERNA 4O4JB 4BT5A 5LOVA 5MN4A 3ESJA 2UYPA 5CA1A 3JAKB 2WALA 4ZOLB 2CW4A 2LCAA 3JAMM 3CC4F 3KE1A 4TV8A 4NWOB 1K73H 5C8YB 3JALA 2IQQA 2ZODA 1YJ9F 1H47A 2Z1UA 3JASB 2GLZA 4G4ZA 1ODEA 3TD4A 3GYQA 2FGYA 5HY1A 1K8AH 5JCOA 3I3FA 3HAXD 5EWRA 3MCAB 2LBTA 1YQNA 5BMVB 4YJ2B 4O4IA 2QEXF 3D01A 1VK3A 3CCEF 3CCJF 3MBMA 1X7PA 3ON1A 3CXCF 3E22A 2DT4A 4TV9B 2CHTA 1VQLF 4LCKA 3C9TA 3NK6A 4BT6A 5G4UC 5CB4A 3D00A 3IEQA 2H6LA 4DRXB 3N4ZA 1W5AA 1PF5A 3DC2A 5EIBD 5B8FA 3DDNA 4KWEA 5JCOC 4EB6B 2N48A 4ZI7B 2BTQB 5AVMA 1TUBA 3QHDA 3CC2F 3NVIB 2I6DA 5KMGA 3R0PA 5J2TA 1UFYA 5A2QM 3J81M 5MN5A 1QU9A 5GONB 3WGJA 3MQWA 3WGKA 2OTLF 1ZWZA 4HNAB 3JAWA 1VQOF 3CCRF 2P6YA 2CSLA 4X20B 3RYFA 3K12A 3C9UA 4X1IB 5HP7A 3J80M 3IKEA 3CCVF 3LMEA 4YJ3B 2VGMA 1U40A 2W8BC 4IHJA 3OONA 5GIPC 1RA4A 4O2BA 1JD1A 4RHAA 2UZHA 3JATB 1VQ8F 3V7QA 2RHOA
chains in the Genus database with same CATH topology
2AIZP 2LCAA 3TD5A 4B5CA 3CYQA 4ZHYB 3KHNA 3WPXA 5EAZA 4G4YA 4G4VA 4ERHA 3S03A 5EB1B 2ZF8A 1R1MA 2MQEA 4R40B 2K1SA 3WPWA 4G4ZA 2HQSC 2L26A 3TD4A 2W8BC 3TD3A 4ZHVA 2ZVYA 3OONA 4B62A 4G4XA 2N48A 3CYPB 3IMPA 3LDTA 2ZVZA 2KGWA 3S0YA 1OAPA 4RHAA 5EB0A 3S0WA 3S02A 2ZOVA 4PWTA 2LBTA 3S06A 3S0HA 4G4WA 4G88A 4ZHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  2LCA A;  3TD5 A;  4B5C A;  3CYQ A;  4ZHY B;  3KHN A;  3WPX A;  5EAZ A;  4G4Y A;  4G4V A;  4ERH A;  3S03 A;  5EB1 B;  2ZF8 A;  1R1M A;  2MQE A;  4R40 B;  2K1S A;  3WPW A;  4G4Z A;  2HQS C;  2L26 A;  3TD4 A;  2W8B C;  3TD3 A;  4ZHV A;  2ZVY A;  3OON A;  4B62 A;  4G4X A;  2N48 A;  3CYP B;  3IMP A;  3LDT A;  2ZVZ A;  2KGW A;  3S0Y A;  1OAP A;  4RHA A;  5EB0 A;  3S0W A;  3S02 A;  2ZOV A;  4PWT A;  2LBT A;  3S06 A;  3S0H A;  4G4W A;  4G88 A;  4ZHW A; 
#chains in the Genus database with same CATH topology
 3CCU F;  2Q1Y A;  1VQV A;  4I50 B;  1XV2 A;  5HY2 A;  3QTY A;  3WPX A;  3I55 F;  4O4J A;  1TVK B;  2PHN A;  3S03 A;  1T0K B;  5IJ9 B;  3JAK A;  2JNB A;  2HP3 A;  3FD5 A;  3FFM A;  4R40 B;  3RYI B;  2FC3 A;  2VAP A;  4ZOL A;  3GTZ A;  3HKB B;  3LWQ C;  3G71 F;  3CPQ A;  5C8Y A;  1QAH A;  3V7E A;  2CHS A;  3LYB A;  4X1K B;  3JAS A;  2RHH A;  5IYZ B;  2ZOV A;  1NJI H;  3KJK A;  5KX5 B;  5GIN C;  2KTV A;  1QVG F;  2NMU A;  4BT2 A;  2QA4 F;  3V4D A;  2ZAU A;  1QVF F;  3CCQ F;  4F6R B;  1Q81 H;  1VQN F;  3SIV A;  1VQ7 F;  5BMV A;  3ZP7 A;  3O85 A;  4FFB A;  3SIU A;  2UYJ A;  2RB9 A;  4X3L A;  1S72 F;  3P10 A;  4ZHV A;  1W40 A;  3CCM F;  4B62 A;  4TV9 A;  1JY8 A;  3V3T A;  3KIZ A;  5EYP B;  1Q82 H;  3LFO A;  3N2G A;  4DRX A;  2IAF A;  1GX1 A;  4O4L B;  5MN6 A;  3MCQ A;  4ZI7 A;  5LA6 B;  2HP0 B;  2OZB A;  5EZY A;  5ITZ B;  2B33 A;  4TUY B;  5LXT B;  1U43 A;  2CVL A;  1COM A;  4ZHQ A;  1FFX B;  2IG8 A;  3C8L A;  5GON A;  3VTI C;  4TZZ A;  2YYE A;  3F0E A;  3NMU C;  4HNA A;  1VH8 A;  3JCM M;  3E1Y A;  1W57 A;  4X20 A;  1T0A A;  1M1K H;  3S0Y A;  4X1I A;  3JVH A;  4YJ3 A;  3BYQ A;  2OTM A;  1K9M H;  4I4T B;  2ALE A;  1Z5V A;  1DT9 A;  3JAT A;  1UI9 A;  1VQ6 F;  4I50 A;  3L7Q A;  5IT9 M;  1SDS A;  1TVK A;  4BW0 B;  4B45 A;  5EO3 A;  3RYH B;  2HS0 A;  5IJ9 A;  4BVT A;  3F6M A;  3ZP4 A;  2UYN B;  4BVS A;  3RYI A;  5HP8 A;  4ERH A;  5FNV B;  3HKB A;  2HRY A;  1GO0 A;  1SZQ A;  1VQ9 F;  3HKE A;  1JFF B;  1W2B F;  4NUT A;  4X1K A;  3F0G A;  5IYZ A;  3CPW F;  3WGM A;  4O2A B;  5LP6 B;  3WGL A;  5FJ4 C;  2G9I A;  2YXZ A;  1CLI A;  5KX5 A;  2KTU A;  2K1S A;  1YIT F;  3JAR B;  3VMF B;  3CYP B;  3D54 A;  4F6R A;  4I55 B;  2H8E A;  3J7A R;  4C82 A;  2QI2 A;  2UYK A;  3VOB A;  3S02 A;  5G4V C;  3Q8H A;  3B6N A;  5DCV A;  3HKD B;  3RYC B;  1U3P A;  1W58 1;  1W5B A;  4X3M A;  5EAZ A;  5EYP A;  4G4Y A;  1H7M A;  4BT7 A;  3VO8 A;  1J7H A;  4EI8 A;  2HVY D;  1JJ2 F;  3FD6 A;  3I7T A;  5EB1 B;  4EI9 A;  3CC7 F;  5CA0 B;  3LWV C;  4BVR A;  4O4L A;  5LA6 A;  4C4W C;  2ZVY A;  5JQG B;  1X25 A;  2HP0 A;  3HWU A;  2I6R A;  3IMP A;  3QUW A;  3VOA A;  5ITZ A;  4TUY A;  2CZW A;  4M8I A;  5LXT A;  1YIJ F;  1X52 A;  1IV1 A;  1FFX A;  3OBY A;  1PXW A;  3C9R A;  3EOR A;  3M4S A;  2VAM A;  3K0T A;  1U3L A;  4ZHY B;  1KNK A;  5HY4 A;  5HWE A;  4O4H B;  2RHL A;  3WXM B;  2HS3 A;  3NVK E;  2ZF8 A;  3E20 B;  5J2U B;  3HTN A;  1VQ4 F;  5GAP K;  4YJ2 A;  3PLA C;  4U3J B;  3N2K B;  2L26 A;  4I4T A;  4IIJ B;  1YJW F;  2HX0 A;  4G4X A;  4DXD A;  4U39 A;  4X1Y B;  1YGY A;  1XHO A;  2PMP A;  1OAP A;  2QTP A;  3LWR C;  3G4S F;  3WGN A;  2AIF A;  3IKF A;  3S0H A;  3GHZ A;  2LBX A;  2BTO A;  3CG6 A;  1SA0 B;  3RE3 A;  1Q7Y H;  1JN1 A;  3CCL F;  4EB6 A;  2F9Z C;  1KD1 H;  3T80 A;  4E6E A;  5HXU A;  3RYH A;  1FSZ A;  1IPA A;  2UYN A;  2Z01 A;  5HY0 A;  5FNV A;  1DBF A;  2Q1X A;  2VXY A;  1Q86 H;  2BO1 A;  3CMA F;  1JFF A;  1IV2 A;  5EIB C;  3VYS C;  3HJW C;  1KNJ A;  3N4Y A;  3IEW A;  4WBN B;  3CME F;  3CD6 F;  2H8C A;  1W42 A;  3F0F A;  2AMT A;  1VHA A;  4O2A A;  5LP6 A;  5HXZ A;  1W5E A;  2BTU A;  3JAR A;  3K2X A;  4I55 A;  1RQ2 A;  2EWC A;  3HKC B;  3AGK A;  4XCQ A;  3UT5 B;  2OHW A;  1KQS F;  4LNU B;  3HKD A;  3RYC A;  5IJ0 B;  1QD9 A;  1W41 A;  2HRU A;  1W59 A;  3LWP C;  1YI2 F;  1XBI A;  5LP6 C;  3C9S A;  4C8E A;  4BY9 D;  5JVD B;  2Z1F A;  2VAW A;  5EB0 A;  3S0W A;  1VQM F;  5CA0 A;  5LYJ B;  1GZ0 A;  4FFB B;  3S06 A;  4G4W A;  4ZHW A;  2AIZ P;  1M90 H;  3P4E A;  3OW2 F;  5JQG A;  5JH7 B;  3G6E F;  3CCS F;  1Z5W A;  5LOV B;  3FBA A;  3I56 F;  3N2G B;  1R1M A;  2MQE A;  5CA1 B;  3CB2 A;  3RA5 A;  3WPW A;  2R6R 1;  4BT3 A;  2HQS C;  4EI7 A;  2HS4 A;  3ZOP A;  1E7K A;  4TV8 B;  4O4H A;  3IR9 A;  3JAL B;  5EZY B;  2V9Y A;  3ELC A;  3WJR A;  2Z1T A;  4BVQ A;  4ZHQ B;  5J2U A;  2Z1E A;  3LWO C;  1H48 A;  4U3J A;  1W55 A;  2CWJ A;  3N2K A;  4IIJ A;  2RHJ A;  1Q8R A;  3FPI A;  2DYY A;  4X1Y A;  3KJJ A;  1IV3 A;  1VQK F;  4C81 A;  2LBW A;  3M1X A;  1CK2 A;  2R75 1;  3PAF A;  1OFU A;  1SA0 A;  3RA6 A;  4O4I B;  3TD3 A;  2GVI A;  4B46 A;  3LDT A;  2ZVZ A;  3E22 B;  3NK7 A;  3ZO8 A;  1FNK A;  4PWT A;  2KG4 A;  4C8I A;  5CB4 B;  1RLG A;  3MDO A;  1N8R H;  1X7O A;  4G88 A;  3TD5 A;  5GAN K;  3VI6 A;  4C8G A;  1NQ3 A;  3M84 A;  4WBN A;  1KC8 H;  3OBW A;  1TUB B;  2OTJ F;  4G4V A;  1CN7 A;  5KMG B;  5J2T B;  2GZL A;  3HKE B;  3K14 A;  3VYU C;  2VGN A;  1ONI A;  3HKC A;  1XRG A;  4NQ3 A;  3JAW B;  1W5F A;  3P0Z A;  3UT5 A;  4ZK7 A;  2KGW A;  4LNU A;  1IV4 A;  3F0D A;  1YHQ F;  1VQ5 F;  3RYF B;  3VCZ A;  1GO1 A;  5IJ0 A;  1RLU A;  1YJN F;  4B5C A;  3CYQ A;  3KHN A;  3WJQ A;  4IHJ B;  1RQ7 A;  3VYT C;  3U0O A;  4O2B B;  5JVD A;  1W3E X;  1NMU B;  5LYJ A;  5FLX M;  3VIU A;  5JH7 A;  1FNJ A;  3WJP A;  5GIO C;  1VQP F;  4RQO A;  4BT4 A;  3ERN A;  4O4J B;  4BT5 A;  5LOV A;  5MN4 A;  3ESJ A;  2UYP A;  5CA1 A;  3JAK B;  2WAL A;  4ZOL B;  2CW4 A;  2LCA A;  3JAM M;  3CC4 F;  3KE1 A;  4TV8 A;  4NWO B;  1K73 H;  5C8Y B;  3JAL A;  2IQQ A;  2ZOD A;  1YJ9 F;  1H47 A;  2Z1U A;  3JAS B;  2GLZ A;  4G4Z A;  1ODE A;  3TD4 A;  3GYQ A;  2FGY A;  5HY1 A;  1K8A H;  5JCO A;  3I3F A;  3HAX D;  5EWR A;  3MCA B;  2LBT A;  1YQN A;  5BMV B;  4YJ2 B;  4O4I A;  2QEX F;  3D01 A;  1VK3 A;  3CCE F;  3CCJ F;  3MBM A;  1X7P A;  3ON1 A;  3CXC F;  3E22 A;  2DT4 A;  4TV9 B;  2CHT A;  1VQL F;  4LCK A;  3C9T A;  3NK6 A;  4BT6 A;  5G4U C;  5CB4 A;  3D00 A;  3IEQ A;  2H6L A;  4DRX B;  3N4Z A;  1W5A A;  1PF5 A;  3DC2 A;  5EIB D;  5B8F A;  3DDN A;  4KWE A;  5JCO C;  4EB6 B;  2N48 A;  4ZI7 B;  2BTQ B;  5AVM A;  1TUB A;  3QHD A;  3CC2 F;  3NVI B;  2I6D A;  5KMG A;  3R0P A;  5J2T A;  1UFY A;  5A2Q M;  3J81 M;  5MN5 A;  1QU9 A;  5GON B;  3WGJ A;  3MQW A;  3WGK A;  2OTL F;  1ZWZ A;  4HNA B;  3JAW A;  1VQO F;  3CCR F;  2P6Y A;  2CSL A;  4X20 B;  3RYF A;  3K12 A;  3C9U A;  4X1I B;  5HP7 A;  3J80 M;  3IKE A;  3CCV F;  3LME A;  4YJ3 B;  2VGM A;  1U40 A;  2W8B C;  4IHJ A;  3OON A;  5GIP C;  1RA4 A;  4O2B A;  1JD1 A;  4RHA A;  2UZH A;  3JAT B;  1VQ8 F;  3V7Q A;  2RHO A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  2LCA A;  3TD5 A;  4B5C A;  3CYQ A;  4ZHY B;  3KHN A;  3WPX A;  5EAZ A;  4G4Y A;  4G4V A;  4ERH A;  3S03 A;  5EB1 B;  2ZF8 A;  1R1M A;  2MQE A;  4R40 B;  2K1S A;  3WPW A;  4G4Z A;  2HQS C;  2L26 A;  3TD4 A;  2W8B C;  3TD3 A;  4ZHV A;  2ZVY A;  3OON A;  4B62 A;  4G4X A;  2N48 A;  3CYP B;  3IMP A;  3LDT A;  2ZVZ A;  2KGW A;  3S0Y A;  1OAP A;  4RHA A;  5EB0 A;  3S0W A;  3S02 A;  2ZOV A;  4PWT A;  2LBT A;  3S06 A;  3S0H A;  4G4W A;  4G88 A;  4ZHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...