3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
3S02A 3KHNA 4ERHA 2LBTA 2ZVZA 3TD5A 3S0WA 4ZHWA 2LCAA 3WPWA 2ZOVA 3LDTA 5EB0A 3CYPB 4G4VA 3WPXA 4G88A 4G4ZA 2HQSC 2AIZP 4R40B 2K1SA 4RHAA 4G4WA 2KGWA 3TD4A 4ZHYB 2ZVYA 3S06A 4G4YA 1OAPA 3S03A 2W8BC 3CYQA 3OONA 4B5CA 3S0YA 3TD3A 2MQEA 4PWTA 3S0HA 4B62A 4G4XA 3IMPA 4ZHVA 2N48A 2ZF8A 5EAZA 2L26A 5EB1B 1R1MA
chains in the Genus database with same CATH superfamily
1CN7A 1VQ7F 3TD5A 5LP6B 1IV1A 1TUBA 5CA1A 4ZI7B 3P4EA 2QI2A 3FPIA 3MQWA 3I56F 3HKDA 2B33A 5A2QM 1VK3A 3UT5A 1ONIA 2UYKA 5JVDA 3RYHA 1FSZA 2R6R1 4NQ3A 3DDNA 3CXCF 3CMEF 3CCQF 2JNBA 4TV9A 3WJQA 5ITZA 1GO0A 3J80M 1R1MA 1Q7YH 5CB4B 2OZBA 3V7EA 5IYZB 3GHZA 1Q82H 2Q1XA 3JALB 3RA6A 2QTPA 2Z1EA 3WJPA 4BVTA 2BTOA 5HY4A 3VOAA 3LWVC 4O4LA 1QAHA 3RA5A 5KX5B 2HP0B 3U0OA 4IIJB 3N2GB 3LWRC 5LYJA 1XV2A 3OBWA 1VQOF 5KMGA 2HS3A 2R751 5EB1B 3J7AR 5IJ0B 4I50A 5LP6A 2BO1A 4X1KA 3CPQA 1H48A 4DRXB 4ZHWA 3KJKA 2LCAA 4YJ3B 5JCOA 3WPWA 1CK2A 4EI7A 3NVKE 3LWQC 3WGLA 2CW4A 2HQSC 4G4WA 5J2UB 2GZLA 1W5AA 1OAPA 2Z1FA 1IV2A 2AIFA 3JATA 4KWEA 4HNAB 1QVFF 3UT5B 3VTIC 1ODEA 1PXWA 5EYPB 3HJWC 5JQGB 1M1KH 4G4XA 3ZP7A 1VHAA 1K9MH 4TUYB 2H6LA 3F0DA 5FLXM 2FGYA 1K73H 1U40A 2UYJA 1JN1A 1W57A 3KHNA 4ERHA 2V9YA 1W581 4O4HA 3F6MA 1KNJA 4O4HB 3JALA 3ZP4A 2UZHA 1XRGA 3NK6A 2YYEA 1VQ6F 4ZOLB 3L7QA 3HTNA 4IHJA 4PWTA 4F6RA 1NJIH 5LOVA 1JJ2F 3M1XA 4B46A 1IV4A 1YIJF 3VYUC 1GZ0A 4U3JA 3C9SA 4DRXA 5GANK 2LBTA 3WJRA 1W41A 5CA1B 2IAFA 1GO1A 4XCQA 4BVSA 3E22A 3MCQA 1COMA 3RYFB 4ZHYB 2K1SA 3CCSF 2BTQB 2VAWA 2HS4A 3D54A 3J81M 4C8GA 3P0ZA 2AMTA 3F0FA 4LNUA 1DBFA 3MCAB 3EORA 4BT3A 5G4VC 3DC2A 2G9IA 2N48A 1VQPF 1VQNF 5CA0A 2HRUA 5IJ9B 3CCVF 2VAMA 3MBMA 5LXTB 5CA0B 1W55A 2LBWA 1E7KA 3PLAC 3N2KA 4X1IA 1CLIA 4I55B 4BVRA 2Z1TA 4TV8A 5EB0A 2PMPA 1YQNA 3WPXA 1DT9A 1VQVA 4R40B 5JH7A 2IQQA 3CCRF 2ZVYA 1X7PA 3RYCB 2KG4A 1VQ4F 2HS0A 3JASA 1VQ9F 3CYQA 3N2GA 4X3MA 3S0YA 3VIUA 1PF5A 4E6EA 3BYQA 1UI9A 1VQ8F 2RHHA 3SIUA 5EZYB 1FFXB 5J2TB 3N4ZA 3MDOA 1NMUB 1W2BF 3VYTC 2KGWA 5GONA 1JD1A 5MN4A 4I4TA 5J2UA 1XHOA 2IG8A 1IPAA 2CHSA 3JATB 5BMVB 5GIPC 4FFBA 4ZHVA 5BMVA 3NK7A 4TV9B 2Z01A 2HX0A 3GTZA 4TZZA 1SDSA 1H47A 2PHNA 5GIOC 3E20B 5DCVA 5IJ9A 2CHTA 3S02A 3B6NA 2RHJA 3HAXD 4O2BA 1YGYA 3ZO8A 3ZOPA 5JH7B 4BT6A 4G4VA 3K14A 1RA4A 1SA0B 4G88A 3HKCB 3S03A 3CCMF 3OBYA 1GX1A 4EB6B 2W8BC 1QU9A 4ZOLA 3FD6A 1KQSF 2QA4F 4X1YB 4C8IA 5HWEA 5EAZA 5GINC 1W3EX 2VAPA 4X20A 3WGNA 4C81A 3G6EF 3GYQA 1N8RH 5IT9M 4BY9D 1U3LA 5IJ0A 2NMUA 2ZAUA 1NQ3A 3C9UA 3LYBA 3RYFA 3HKDB 3F0EA 3E22B 3WGJA 5HY1A 2CZWA 4I4TB 3S06A 1U43A 2OTLF 2CWJA 2VXYA 1XBIA 2WALA 4O4IB 2UYNB 2HVYD 4X3LA 3HKEA 4B5CA 5HY2A 5C8YB 1X52A 5JQGA 3ESJA 4BT5A 3R0PA 2Z1UA 3CG6A 3JVHA 5FJ4C 2Q1YA 5LXTA 3FD5A 3LWPC 3KIZA 2VGNA 1TVKB 3C9RA 2RB9A 4O2AB 3V3TA 2KTVA 4O2BB 3E1YA 5LP6C 3CB2A 3CCJF 3I7TA 1QVGF 4WBNB 5MN5A 1VQ5F 5KX5A 4G4YA 4C8EA 4O4LB 5HY0A 1Q81H 4O4JB 5LOVB 2ALEA 4EI8A 1W40A 2P6YA 3CPWF 5EZYA 4B45A 4BVQA 4U3JB 2I6DA 1Q86H 1FNKA 1FFXA 1TUBB 5B8FA 4RQOA 3S0WA 3IKEA 3VOBA 3NVIB 2RHLA 1RLUA 4U39A 4YJ3A 3P10A 2AIZP 3IEWA 2FC3A 1H7MA 3HKEB 5GAPK 2DYYA 3OONA 1YI2F 3IKFA 2UYNA 4ZK7A 5JVDB 1UFYA 1SZQA 3KE1A 3N4YA 3G71F 3VO8A 2H8EA 1X7OA 5EWRA 5HP8A 1YJNF 2EWCA 3VI6A 3RYIA 3VCZA 3WGKA 3CCLF 1TVKA 1VQMF 3I3FA 3RYIB 2ZVZA 3ELCA 3QUWA 3JAWA 1YJ9F 3CC7F 4I55A 1OFUA 4DXDA 3FFMA 1YITF 3HWUA 2OHWA 4RHAA 5LA6A 4YJ2A 1YJWF 1T0KB 3K12A 4O4JA 3RYCA 1VQKF 3FBAA 1U3PA 3TD3A 3QHDA 3CD6F 3D00A 2GVIA 4ZHQA 5FNVB 4IHJB 4F6RB 4NUTA 4X20B 2CSLA 2L26A 4X1YA 5J2TA 3OW2F 4X1KB 1IV3A 3WGMA 5KMGB 4NWOB 1KD1H 3IR9A 5HXUA 1X25A 1KNKA 3C8LA 1VH8A 3VYSC 3V4DA 3CC2F 2GLZA 1Q8RA 4O4IA 5GONB 1Z5VA 3M84A 2VGMA 5AVMA 3ON1A 1JY8A 3F0GA 2MQEA 3JAMM 4TUYA 5C8YA 1K8AH 4EI9A 1W5BA 4O2AA 5CB4A 1W59A 2DT4A 5G4UC 1KC8H 2UYPA 4TV8B 2QEXF 1JFFB 3JAKB 5IYZA 2HRYA 4X1IB 1W5FA 2ZOVA 3LDTA 5EIBC 1ZWZA 3AGKA 4YJ2B 5LA6B 1M90H 1FNJA 4G4ZA 2I6RA 3VMFB 3T80A 3V7QA 3LMEA 3CMAF 2CVLA 3G4SF 2HP3A 1YHQF 3JASB 4EB6A 3WXMB 1VQLF 3IMPA 4C82A 3K2XA 4IIJA 4BT7A 3I55F 5MN6A 3HKBA 4ZHQB 5JCOC 2ZF8A 2ZODA 3JARB 5HP7A 4WBNA 3CC4F 4BW0B 3JARA 3SIVA 2OTJF 5HXZA 3PAFA 4I50B 3KJJA 3CYPB 4ZI7A 2KTUA 3TD4A 2LBXA 3M4SA 3NMUC 4HNAA 4BT2A 3QTYA 4BT4A 1J7HA 1W42A 3Q8HA 5EIBD 2F9ZC 4LNUB 2YXZA 4M8IA 3S0HA 4B62A 3JCMM 5EYPA 3RYHB 4FFBB 1RQ2A 3RE3A 4LCKA 3N2KB 5ITZB 4C4WC 1JFFA 1W5EA 3JAWB 3ERNA 5EO3A 3D01A 1QD9A 3K0TA 3JAKA 1SA0A 3CCUF 3HKCA 2HP0A 3O85A 2BTUA 2RHOA 1RQ7A 3CCEF 3IEQA 3LWOC 3LFOA 1RLGA 1S72F 2H8CA 5FNVA 1T0AA 5LYJB 2OTMA 3HKBB 3C9TA 1Z5WA
chains in the Genus database with same CATH topology
3S02A 3KHNA 4ERHA 2LBTA 2ZVZA 3TD5A 3S0WA 4ZHWA 2LCAA 3WPWA 2ZOVA 3LDTA 5EB0A 3CYPB 4G4VA 3WPXA 4G88A 4G4ZA 2HQSC 2AIZP 4R40B 2K1SA 4RHAA 4G4WA 2KGWA 3TD4A 4ZHYB 2ZVYA 3S06A 4G4YA 1OAPA 3S03A 2W8BC 3CYQA 3OONA 4B5CA 3S0YA 3TD3A 2MQEA 4PWTA 3S0HA 4B62A 4G4XA 3IMPA 4ZHVA 2N48A 2ZF8A 5EAZA 2L26A 5EB1B 1R1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S02 A;  3KHN A;  4ERH A;  2LBT A;  2ZVZ A;  3TD5 A;  3S0W A;  4ZHW A;  2LCA A;  3WPW A;  2ZOV A;  3LDT A;  5EB0 A;  3CYP B;  4G4V A;  3WPX A;  4G88 A;  4G4Z A;  2HQS C;  2AIZ P;  4R40 B;  2K1S A;  4RHA A;  4G4W A;  2KGW A;  3TD4 A;  4ZHY B;  2ZVY A;  3S06 A;  4G4Y A;  1OAP A;  3S03 A;  2W8B C;  3CYQ A;  3OON A;  4B5C A;  3S0Y A;  3TD3 A;  2MQE A;  4PWT A;  3S0H A;  4B62 A;  4G4X A;  3IMP A;  4ZHV A;  2N48 A;  2ZF8 A;  5EAZ A;  2L26 A;  5EB1 B;  1R1M A; 
#chains in the Genus database with same CATH topology
 1CN7 A;  1VQ7 F;  3TD5 A;  5LP6 B;  1IV1 A;  1TUB A;  5CA1 A;  4ZI7 B;  3P4E A;  2QI2 A;  3FPI A;  3MQW A;  3I56 F;  3HKD A;  2B33 A;  5A2Q M;  1VK3 A;  3UT5 A;  1ONI A;  2UYK A;  5JVD A;  3RYH A;  1FSZ A;  2R6R 1;  4NQ3 A;  3DDN A;  3CXC F;  3CME F;  3CCQ F;  2JNB A;  4TV9 A;  3WJQ A;  5ITZ A;  1GO0 A;  3J80 M;  1R1M A;  1Q7Y H;  5CB4 B;  2OZB A;  3V7E A;  5IYZ B;  3GHZ A;  1Q82 H;  2Q1X A;  3JAL B;  3RA6 A;  2QTP A;  2Z1E A;  3WJP A;  4BVT A;  2BTO A;  5HY4 A;  3VOA A;  3LWV C;  4O4L A;  1QAH A;  3RA5 A;  5KX5 B;  2HP0 B;  3U0O A;  4IIJ B;  3N2G B;  3LWR C;  5LYJ A;  1XV2 A;  3OBW A;  1VQO F;  5KMG A;  2HS3 A;  2R75 1;  5EB1 B;  3J7A R;  5IJ0 B;  4I50 A;  5LP6 A;  2BO1 A;  4X1K A;  3CPQ A;  1H48 A;  4DRX B;  4ZHW A;  3KJK A;  2LCA A;  4YJ3 B;  5JCO A;  3WPW A;  1CK2 A;  4EI7 A;  3NVK E;  3LWQ C;  3WGL A;  2CW4 A;  2HQS C;  4G4W A;  5J2U B;  2GZL A;  1W5A A;  1OAP A;  2Z1F A;  1IV2 A;  2AIF A;  3JAT A;  4KWE A;  4HNA B;  1QVF F;  3UT5 B;  3VTI C;  1ODE A;  1PXW A;  5EYP B;  3HJW C;  5JQG B;  1M1K H;  4G4X A;  3ZP7 A;  1VHA A;  1K9M H;  4TUY B;  2H6L A;  3F0D A;  5FLX M;  2FGY A;  1K73 H;  1U40 A;  2UYJ A;  1JN1 A;  1W57 A;  3KHN A;  4ERH A;  2V9Y A;  1W58 1;  4O4H A;  3F6M A;  1KNJ A;  4O4H B;  3JAL A;  3ZP4 A;  2UZH A;  1XRG A;  3NK6 A;  2YYE A;  1VQ6 F;  4ZOL B;  3L7Q A;  3HTN A;  4IHJ A;  4PWT A;  4F6R A;  1NJI H;  5LOV A;  1JJ2 F;  3M1X A;  4B46 A;  1IV4 A;  1YIJ F;  3VYU C;  1GZ0 A;  4U3J A;  3C9S A;  4DRX A;  5GAN K;  2LBT A;  3WJR A;  1W41 A;  5CA1 B;  2IAF A;  1GO1 A;  4XCQ A;  4BVS A;  3E22 A;  3MCQ A;  1COM A;  3RYF B;  4ZHY B;  2K1S A;  3CCS F;  2BTQ B;  2VAW A;  2HS4 A;  3D54 A;  3J81 M;  4C8G A;  3P0Z A;  2AMT A;  3F0F A;  4LNU A;  1DBF A;  3MCA B;  3EOR A;  4BT3 A;  5G4V C;  3DC2 A;  2G9I A;  2N48 A;  1VQP F;  1VQN F;  5CA0 A;  2HRU A;  5IJ9 B;  3CCV F;  2VAM A;  3MBM A;  5LXT B;  5CA0 B;  1W55 A;  2LBW A;  1E7K A;  3PLA C;  3N2K A;  4X1I A;  1CLI A;  4I55 B;  4BVR A;  2Z1T A;  4TV8 A;  5EB0 A;  2PMP A;  1YQN A;  3WPX A;  1DT9 A;  1VQV A;  4R40 B;  5JH7 A;  2IQQ A;  3CCR F;  2ZVY A;  1X7P A;  3RYC B;  2KG4 A;  1VQ4 F;  2HS0 A;  3JAS A;  1VQ9 F;  3CYQ A;  3N2G A;  4X3M A;  3S0Y A;  3VIU A;  1PF5 A;  4E6E A;  3BYQ A;  1UI9 A;  1VQ8 F;  2RHH A;  3SIU A;  5EZY B;  1FFX B;  5J2T B;  3N4Z A;  3MDO A;  1NMU B;  1W2B F;  3VYT C;  2KGW A;  5GON A;  1JD1 A;  5MN4 A;  4I4T A;  5J2U A;  1XHO A;  2IG8 A;  1IPA A;  2CHS A;  3JAT B;  5BMV B;  5GIP C;  4FFB A;  4ZHV A;  5BMV A;  3NK7 A;  4TV9 B;  2Z01 A;  2HX0 A;  3GTZ A;  4TZZ A;  1SDS A;  1H47 A;  2PHN A;  5GIO C;  3E20 B;  5DCV A;  5IJ9 A;  2CHT A;  3S02 A;  3B6N A;  2RHJ A;  3HAX D;  4O2B A;  1YGY A;  3ZO8 A;  3ZOP A;  5JH7 B;  4BT6 A;  4G4V A;  3K14 A;  1RA4 A;  1SA0 B;  4G88 A;  3HKC B;  3S03 A;  3CCM F;  3OBY A;  1GX1 A;  4EB6 B;  2W8B C;  1QU9 A;  4ZOL A;  3FD6 A;  1KQS F;  2QA4 F;  4X1Y B;  4C8I A;  5HWE A;  5EAZ A;  5GIN C;  1W3E X;  2VAP A;  4X20 A;  3WGN A;  4C81 A;  3G6E F;  3GYQ A;  1N8R H;  5IT9 M;  4BY9 D;  1U3L A;  5IJ0 A;  2NMU A;  2ZAU A;  1NQ3 A;  3C9U A;  3LYB A;  3RYF A;  3HKD B;  3F0E A;  3E22 B;  3WGJ A;  5HY1 A;  2CZW A;  4I4T B;  3S06 A;  1U43 A;  2OTL F;  2CWJ A;  2VXY A;  1XBI A;  2WAL A;  4O4I B;  2UYN B;  2HVY D;  4X3L A;  3HKE A;  4B5C A;  5HY2 A;  5C8Y B;  1X52 A;  5JQG A;  3ESJ A;  4BT5 A;  3R0P A;  2Z1U A;  3CG6 A;  3JVH A;  5FJ4 C;  2Q1Y A;  5LXT A;  3FD5 A;  3LWP C;  3KIZ A;  2VGN A;  1TVK B;  3C9R A;  2RB9 A;  4O2A B;  3V3T A;  2KTV A;  4O2B B;  3E1Y A;  5LP6 C;  3CB2 A;  3CCJ F;  3I7T A;  1QVG F;  4WBN B;  5MN5 A;  1VQ5 F;  5KX5 A;  4G4Y A;  4C8E A;  4O4L B;  5HY0 A;  1Q81 H;  4O4J B;  5LOV B;  2ALE A;  4EI8 A;  1W40 A;  2P6Y A;  3CPW F;  5EZY A;  4B45 A;  4BVQ A;  4U3J B;  2I6D A;  1Q86 H;  1FNK A;  1FFX A;  1TUB B;  5B8F A;  4RQO A;  3S0W A;  3IKE A;  3VOB A;  3NVI B;  2RHL A;  1RLU A;  4U39 A;  4YJ3 A;  3P10 A;  2AIZ P;  3IEW A;  2FC3 A;  1H7M A;  3HKE B;  5GAP K;  2DYY A;  3OON A;  1YI2 F;  3IKF A;  2UYN A;  4ZK7 A;  5JVD B;  1UFY A;  1SZQ A;  3KE1 A;  3N4Y A;  3G71 F;  3VO8 A;  2H8E A;  1X7O A;  5EWR A;  5HP8 A;  1YJN F;  2EWC A;  3VI6 A;  3RYI A;  3VCZ A;  3WGK A;  3CCL F;  1TVK A;  1VQM F;  3I3F A;  3RYI B;  2ZVZ A;  3ELC A;  3QUW A;  3JAW A;  1YJ9 F;  3CC7 F;  4I55 A;  1OFU A;  4DXD A;  3FFM A;  1YIT F;  3HWU A;  2OHW A;  4RHA A;  5LA6 A;  4YJ2 A;  1YJW F;  1T0K B;  3K12 A;  4O4J A;  3RYC A;  1VQK F;  3FBA A;  1U3P A;  3TD3 A;  3QHD A;  3CD6 F;  3D00 A;  2GVI A;  4ZHQ A;  5FNV B;  4IHJ B;  4F6R B;  4NUT A;  4X20 B;  2CSL A;  2L26 A;  4X1Y A;  5J2T A;  3OW2 F;  4X1K B;  1IV3 A;  3WGM A;  5KMG B;  4NWO B;  1KD1 H;  3IR9 A;  5HXU A;  1X25 A;  1KNK A;  3C8L A;  1VH8 A;  3VYS C;  3V4D A;  3CC2 F;  2GLZ A;  1Q8R A;  4O4I A;  5GON B;  1Z5V A;  3M84 A;  2VGM A;  5AVM A;  3ON1 A;  1JY8 A;  3F0G A;  2MQE A;  3JAM M;  4TUY A;  5C8Y A;  1K8A H;  4EI9 A;  1W5B A;  4O2A A;  5CB4 A;  1W59 A;  2DT4 A;  5G4U C;  1KC8 H;  2UYP A;  4TV8 B;  2QEX F;  1JFF B;  3JAK B;  5IYZ A;  2HRY A;  4X1I B;  1W5F A;  2ZOV A;  3LDT A;  5EIB C;  1ZWZ A;  3AGK A;  4YJ2 B;  5LA6 B;  1M90 H;  1FNJ A;  4G4Z A;  2I6R A;  3VMF B;  3T80 A;  3V7Q A;  3LME A;  3CMA F;  2CVL A;  3G4S F;  2HP3 A;  1YHQ F;  3JAS B;  4EB6 A;  3WXM B;  1VQL F;  3IMP A;  4C82 A;  3K2X A;  4IIJ A;  4BT7 A;  3I55 F;  5MN6 A;  3HKB A;  4ZHQ B;  5JCO C;  2ZF8 A;  2ZOD A;  3JAR B;  5HP7 A;  4WBN A;  3CC4 F;  4BW0 B;  3JAR A;  3SIV A;  2OTJ F;  5HXZ A;  3PAF A;  4I50 B;  3KJJ A;  3CYP B;  4ZI7 A;  2KTU A;  3TD4 A;  2LBX A;  3M4S A;  3NMU C;  4HNA A;  4BT2 A;  3QTY A;  4BT4 A;  1J7H A;  1W42 A;  3Q8H A;  5EIB D;  2F9Z C;  4LNU B;  2YXZ A;  4M8I A;  3S0H A;  4B62 A;  3JCM M;  5EYP A;  3RYH B;  4FFB B;  1RQ2 A;  3RE3 A;  4LCK A;  3N2K B;  5ITZ B;  4C4W C;  1JFF A;  1W5E A;  3JAW B;  3ERN A;  5EO3 A;  3D01 A;  1QD9 A;  3K0T A;  3JAK A;  1SA0 A;  3CCU F;  3HKC A;  2HP0 A;  3O85 A;  2BTU A;  2RHO A;  1RQ7 A;  3CCE F;  3IEQ A;  3LWO C;  3LFO A;  1RLG A;  1S72 F;  2H8C A;  5FNV A;  1T0A A;  5LYJ B;  2OTM A;  3HKB B;  3C9T A;  1Z5W A; 
#chains in the Genus database with same CATH homology
 3S02 A;  3KHN A;  4ERH A;  2LBT A;  2ZVZ A;  3TD5 A;  3S0W A;  4ZHW A;  2LCA A;  3WPW A;  2ZOV A;  3LDT A;  5EB0 A;  3CYP B;  4G4V A;  3WPX A;  4G88 A;  4G4Z A;  2HQS C;  2AIZ P;  4R40 B;  2K1S A;  4RHA A;  4G4W A;  2KGW A;  3TD4 A;  4ZHY B;  2ZVY A;  3S06 A;  4G4Y A;  1OAP A;  3S03 A;  2W8B C;  3CYQ A;  3OON A;  4B5C A;  3S0Y A;  3TD3 A;  2MQE A;  4PWT A;  3S0H A;  4B62 A;  4G4X A;  3IMP A;  4ZHV A;  2N48 A;  2ZF8 A;  5EAZ A;  2L26 A;  5EB1 B;  1R1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...