3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
3S0WA 4G4XA 5EB0A 4ERHA 5EB1B 3IMPA 4G4WA 4PWTA 4B5CA 4ZHYB 2MQEA 2LCAA 3S0HA 2ZVZA 2ZF8A 4RHAA 3WPXA 3WPWA 3S03A 4G4YA 3S0YA 2HQSC 4G88A 1R1MA 2ZOVA 1OAPA 2LBTA 2ZVYA 2K1SA 3TD3A 2KGWA 3KHNA 4R40B 4ZHWA 2W8BC 2AIZP 3OONA 4G4VA 3LDTA 3S06A 5EAZA 3TD5A 2N48A 4ZHVA 3S02A 4G4ZA 3CYQA 4B62A 2L26A 3CYPB 3TD4A
chains in the Genus database with same CATH superfamily
2BTOA 4BT3A 3VCZA 3I55F 4E6EA 1UFYA 3GYQA 5KX5B 4NUTA 4BY9D 3ZOPA 1FSZA 3CCEF 3CG6A 3OBWA 3LWRC 3ON1A 5GAPK 3MBMA 1OAPA 3JVHA 5BMVB 2Z1UA 3VIUA 3JASA 4R40B 1E7KA 4C8GA 2AIZP 5LXTA 3LWPC 3TD5A 3GHZA 3CC4F 3IR9A 5IYZA 1JN1A 2Z1FA 2LBWA 1QU9A 5CA0A 5IJ0B 4ZK7A 4EI8A 5IJ0A 5JCOC 3PAFA 3ZP7A 3VYSC 3RE3A 1W59A 3CMAF 3FD5A 3SIUA 5ITZB 1VK3A 1VQ9F 2KGWA 1Q86H 2YYEA 4IHJA 5LYJA 1SDSA 3AGKA 5JCOA 3F0FA 2OTLF 1IPAA 3D01A 3ELCA 3K14A 1X7PA 5LA6B 4O2BB 1VQ8F 3NVIB 5CB4B 4TV9A 5HXZA 1OFUA 4RQOA 1YJ9F 5HY2A 1IV4A 3V4DA 3F6MA 5JVDA 4XCQA 4X3LA 3CPWF 3DC2A 1Q7YH 1K73H 5KX5A 5GINC 1X25A 2H8EA 1IV2A 5AVMA 2Z01A 4X1YA 4X3MA 2WALA 3HKBA 4EI9A 1VHAA 1PF5A 3LDTA 1N8RH 3IEWA 1COMA 3I7TA 3R0PA 3J80M 1DT9A 3T80A 1FFXB 2LCAA 1T0AA 4I50A 1YITF 3HKCA 3KIZA 3V7EA 3RYHB 3F0DA 4DRXB 3QUWA 5LP6B 3RYIA 4DRXA 1XBIA 4I55A 5CA0B 1VQOF 1VQPF 5HP7A 4BVTA 3N2GA 5EAZA 3RA5A 3IKEA 2UYPA 4X1KB 3V3TA 3JAKA 4G4XA 3CMEF 5GONB 1XHOA 5FJ4C 4LCKA 3HKDA 3C8LA 1VQLF 2VAPA 1W2BF 3FBAA 3KJJA 2HRUA 3OBYA 1K9MH 3S0HA 2ZVZA 1W5BA 4BT5A 1XRGA 5J2UB 3PLAC 2EWCA 4IIJA 1CN7A 3S0YA 1NMUB 3N2KB 3JALA 5J2TB 3JASB 1H47A 3UT5A 3M1XA 1YJNF 3NVKE 1QVFF 1JY8A 4ZHVA 5JQGA 2R751 1W41A 2CWJA 4M8IA 1ODEA 5C8YB 4I55B 3VYUC 2VGNA 1TVKA 2P6YA 4X20B 5HY4A 2UYNA 4ZHQB 3LYBA 3WPWA 1TUBB 1CK2A 2H6LA 1U43A 1QD9A 3HKEB 1W57A 2DYYA 2RB9A 4ZI7B 1VQ6F 4YJ3B 2HVYD 5EWRA 1RLUA 3CCLF 1W40A 4U3JA 3IKFA 3E22A 3VMFB 4WBNA 1Q82H 2LBXA 4BT4A 5EIBD 4EB6B 2OTMA 1YGYA 3NK7A 2UZHA 3G71F 2OHWA 3LFOA 1CLIA 5HY0A 2MQEA 2I6RA 2CVLA 3F0EA 3P4EA 5EIBC 1W55A 2IG8A 5G4UC 3LWQC 2UYNB 3WXMB 2ZOVA 1W581 3MDOA 3E1YA 3WGKA 1KC8H 5EYPB 2VGMA 3WJPA 1SA0B 1QAHA 2G9IA 3HKEA 4ZHWA 3CCVF 3OONA 1VQ7F 1VH8A 2PMPA 4TV8A 4C4WC 5LXTB 5HY1A 2HS0A 2CZWA 3MCQA 1GZ0A 1VQVA 4EI7A 2FGYA 2GZLA 3OW2F 4EB6A 4TUYB 1U3PA 2CW4A 1NQ3A 2RHLA 3WPXA 3DDNA 5FLXM 1W5EA 3VOAA 3E20B 1R1MA 3CCJF 2FC3A 3J7AR 4NWOB 5HP8A 4X1YB 1SA0A 3EORA 3VO8A 1W5FA 3N4YA 3WGLA 1KNJA 3HJWC 4YJ2A 2L26A 3WGNA 3HAXD 3Q8HA 5GIOC 3JATB 3C9SA 3G4SF 3U0OA 2IAFA 3HWUA 1RQ7A 4O4LB 1IV1A 2ALEA 5KMGB 2Q1XA 1W3EX 1JFFA 4G4YA 1UI9A 2LBTA 3CC7F 1Q81H 1YI2F 3RYIB 4HNAB 3LWVC 3RYCA 4KWEA 2W8BC 4C8EA 3CB2A 3K12A 3L7QA 1IV3A 3D00A 2GLZA 4X1IB 3CC2F 3NMUC 3S0WA 3G6EF 5EB0A 3ZP4A 4O4JA 1NJIH 3JAWA 3P10A 3C9UA 3KE1A 5FNVB 4TV8B 2HP0B 5J2UA 1Q8RA 1K8AH 4LNUA 5LA6A 2HP0A 2R6R1 3LWOC 3FPIA 5LP6C 1M1KH 2F9ZC 1RA4A 3RYHA 3WJRA 3JALB 3CYPB 3RA6A 4ERHA 1VQNF 1T0KB 5EB1B 1TVKB 3IMPA 3JAWB 3LMEA 2YXZA 2Z1EA 5EYPA 3HKDB 1S72F 3MQWA 1W42A 2NMUA 1VQ5F 1QVGF 1H7MA 2ZF8A 4RHAA 4O2BA 4FFBA 3S03A 1VQKF 4FFBB 2AIFA 2QEXF 3KJKA 1SZQA 4IHJB 5LYJB 2ZVYA 3CCMF 1KD1H 3VYTC 2VAWA 3JARB 4U39A 4F6RB 3M4SA 3CCUF 3V7QA 4F6RA 4G4ZA 4BT7A 1VQMF 2OTJF 5DCVA 5KMGA 1YQNA 1PXWA 4NQ3A 3JAMM 4O4IB 3CCSF 3CXCF 3JAKB 4ZHYB 2CHSA 3C9RA 5ITZA 2I6DA 3ESJA 3N2GB 1U40A 2KG4A 4YJ2B 3WJQA 3C9TA 5FNVA 3FD6A 3HKBB 5A2QM 3ZO8A 4O4HA 4YJ3A 1FNJA 2VAMA 5J2TA 2IQQA 2DT4A 4TV9B 1U3LA 2N48A 1RQ2A 5LOVB 3N4ZA 2HS3A 4I4TA 2BTQB 4I4TB 2QTPA 5EO3A 4B5CA 4BT2A 2Z1TA 3FFMA 4B46A 2RHOA 4BVRA 1GX1A 3QHDA 1YIJF 3MCAB 2KTUA 2HQSC 4G88A 1ONIA 4ZHQA 2CSLA 3HTNA 5IJ9A 2BTUA 3P0ZA 1GO1A 3WGJA 5BMVA 1YHQF 3ERNA 3CCQF 5HWEA 3F0GA 3S06A 4DXDA 4BW0B 4C8IA 1J7HA 3RYFA 5MN5A 4B62A 1FNKA 1VQ4F 3JARA 2JNBA 2V9YA 4O4HB 2RHHA 5B8FA 4BT6A 4G4WA 3K0TA 1M90H 5EZYB 1JFFB 2HX0A 1Z5WA 4TZZA 5JQGB 1KNKA 3E22B 2ZODA 5JVDB 3JCMM 5JH7B 5G4VC 3RYCB 4BVQA 3J81M 4C81A 2HS4A 4HNAA 5HXUA 5LP6A 5IJ9B 3O85A 1JJ2F 2GVIA 2KTVA 1X7OA 2UYKA 1RLGA 3NK6A 2QA4F 1TUBA 2CHTA 3RYFB 3S02A 3D54A 4ZOLB 5CA1B 3CD6F 3TD4A 2VXYA 1FFXA 2B33A 1YJWF 3VI6A 4O4LA 3M84A 3I3FA 5GIPC 5LOVA 3JATA 3HKCB 1Z5VA 4IIJB 5CB4A 4LNUB 4I50B 4C82A 2H8CA 1X52A 4TUYA 5MN6A 5EZYA 3BYQA 3QTYA 3UT5B 4BVSA 1H48A 2K1SA 4O4IA 1ZWZA 3KHNA 2OZBA 5C8YA 2RHJA 4X1KA 4B45A 5GANK 5IT9M 3B6NA 2QI2A 2Q1YA 4X20A 3SIVA 2HP3A 1W5AA 4PWTA 4O4JB 5GONA 2BO1A 4X1IA 4ZOLA 2AMTA 5CA1A 3CCRF 1DBFA 3VTIC 2ZAUA 5MN4A 4U3JB 2PHNA 1KQSF 1GO0A 4O2AB 3TD3A 1XV2A 3CPQA 4O2AA 4ZI7A 3WGMA 3N2KA 3K2XA 2HRYA 5JH7A 5IYZB 1JD1A 4WBNB 4G4VA 3IEQA 3CYQA 3VOBA 2UYJA 3I56F 3GTZA
chains in the Genus database with same CATH topology
3S0WA 4G4XA 5EB0A 4ERHA 5EB1B 3IMPA 4G4WA 4PWTA 4B5CA 4ZHYB 2MQEA 2LCAA 3S0HA 2ZVZA 2ZF8A 4RHAA 3WPXA 3WPWA 3S03A 4G4YA 3S0YA 2HQSC 4G88A 1R1MA 2ZOVA 1OAPA 2LBTA 2ZVYA 2K1SA 3TD3A 2KGWA 3KHNA 4R40B 4ZHWA 2W8BC 2AIZP 3OONA 4G4VA 3LDTA 3S06A 5EAZA 3TD5A 2N48A 4ZHVA 3S02A 4G4ZA 3CYQA 4B62A 2L26A 3CYPB 3TD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0W A;  4G4X A;  5EB0 A;  4ERH A;  5EB1 B;  3IMP A;  4G4W A;  4PWT A;  4B5C A;  4ZHY B;  2MQE A;  2LCA A;  3S0H A;  2ZVZ A;  2ZF8 A;  4RHA A;  3WPX A;  3WPW A;  3S03 A;  4G4Y A;  3S0Y A;  2HQS C;  4G88 A;  1R1M A;  2ZOV A;  1OAP A;  2LBT A;  2ZVY A;  2K1S A;  3TD3 A;  2KGW A;  3KHN A;  4R40 B;  4ZHW A;  2W8B C;  2AIZ P;  3OON A;  4G4V A;  3LDT A;  3S06 A;  5EAZ A;  3TD5 A;  2N48 A;  4ZHV A;  3S02 A;  4G4Z A;  3CYQ A;  4B62 A;  2L26 A;  3CYP B;  3TD4 A; 
#chains in the Genus database with same CATH topology
 2BTO A;  4BT3 A;  3VCZ A;  3I55 F;  4E6E A;  1UFY A;  3GYQ A;  5KX5 B;  4NUT A;  4BY9 D;  3ZOP A;  1FSZ A;  3CCE F;  3CG6 A;  3OBW A;  3LWR C;  3ON1 A;  5GAP K;  3MBM A;  1OAP A;  3JVH A;  5BMV B;  2Z1U A;  3VIU A;  3JAS A;  4R40 B;  1E7K A;  4C8G A;  2AIZ P;  5LXT A;  3LWP C;  3TD5 A;  3GHZ A;  3CC4 F;  3IR9 A;  5IYZ A;  1JN1 A;  2Z1F A;  2LBW A;  1QU9 A;  5CA0 A;  5IJ0 B;  4ZK7 A;  4EI8 A;  5IJ0 A;  5JCO C;  3PAF A;  3ZP7 A;  3VYS C;  3RE3 A;  1W59 A;  3CMA F;  3FD5 A;  3SIU A;  5ITZ B;  1VK3 A;  1VQ9 F;  2KGW A;  1Q86 H;  2YYE A;  4IHJ A;  5LYJ A;  1SDS A;  3AGK A;  5JCO A;  3F0F A;  2OTL F;  1IPA A;  3D01 A;  3ELC A;  3K14 A;  1X7P A;  5LA6 B;  4O2B B;  1VQ8 F;  3NVI B;  5CB4 B;  4TV9 A;  5HXZ A;  1OFU A;  4RQO A;  1YJ9 F;  5HY2 A;  1IV4 A;  3V4D A;  3F6M A;  5JVD A;  4XCQ A;  4X3L A;  3CPW F;  3DC2 A;  1Q7Y H;  1K73 H;  5KX5 A;  5GIN C;  1X25 A;  2H8E A;  1IV2 A;  5AVM A;  2Z01 A;  4X1Y A;  4X3M A;  2WAL A;  3HKB A;  4EI9 A;  1VHA A;  1PF5 A;  3LDT A;  1N8R H;  3IEW A;  1COM A;  3I7T A;  3R0P A;  3J80 M;  1DT9 A;  3T80 A;  1FFX B;  2LCA A;  1T0A A;  4I50 A;  1YIT F;  3HKC A;  3KIZ A;  3V7E A;  3RYH B;  3F0D A;  4DRX B;  3QUW A;  5LP6 B;  3RYI A;  4DRX A;  1XBI A;  4I55 A;  5CA0 B;  1VQO F;  1VQP F;  5HP7 A;  4BVT A;  3N2G A;  5EAZ A;  3RA5 A;  3IKE A;  2UYP A;  4X1K B;  3V3T A;  3JAK A;  4G4X A;  3CME F;  5GON B;  1XHO A;  5FJ4 C;  4LCK A;  3HKD A;  3C8L A;  1VQL F;  2VAP A;  1W2B F;  3FBA A;  3KJJ A;  2HRU A;  3OBY A;  1K9M H;  3S0H A;  2ZVZ A;  1W5B A;  4BT5 A;  1XRG A;  5J2U B;  3PLA C;  2EWC A;  4IIJ A;  1CN7 A;  3S0Y A;  1NMU B;  3N2K B;  3JAL A;  5J2T B;  3JAS B;  1H47 A;  3UT5 A;  3M1X A;  1YJN F;  3NVK E;  1QVF F;  1JY8 A;  4ZHV A;  5JQG A;  2R75 1;  1W41 A;  2CWJ A;  4M8I A;  1ODE A;  5C8Y B;  4I55 B;  3VYU C;  2VGN A;  1TVK A;  2P6Y A;  4X20 B;  5HY4 A;  2UYN A;  4ZHQ B;  3LYB A;  3WPW A;  1TUB B;  1CK2 A;  2H6L A;  1U43 A;  1QD9 A;  3HKE B;  1W57 A;  2DYY A;  2RB9 A;  4ZI7 B;  1VQ6 F;  4YJ3 B;  2HVY D;  5EWR A;  1RLU A;  3CCL F;  1W40 A;  4U3J A;  3IKF A;  3E22 A;  3VMF B;  4WBN A;  1Q82 H;  2LBX A;  4BT4 A;  5EIB D;  4EB6 B;  2OTM A;  1YGY A;  3NK7 A;  2UZH A;  3G71 F;  2OHW A;  3LFO A;  1CLI A;  5HY0 A;  2MQE A;  2I6R A;  2CVL A;  3F0E A;  3P4E A;  5EIB C;  1W55 A;  2IG8 A;  5G4U C;  3LWQ C;  2UYN B;  3WXM B;  2ZOV A;  1W58 1;  3MDO A;  3E1Y A;  3WGK A;  1KC8 H;  5EYP B;  2VGM A;  3WJP A;  1SA0 B;  1QAH A;  2G9I A;  3HKE A;  4ZHW A;  3CCV F;  3OON A;  1VQ7 F;  1VH8 A;  2PMP A;  4TV8 A;  4C4W C;  5LXT B;  5HY1 A;  2HS0 A;  2CZW A;  3MCQ A;  1GZ0 A;  1VQV A;  4EI7 A;  2FGY A;  2GZL A;  3OW2 F;  4EB6 A;  4TUY B;  1U3P A;  2CW4 A;  1NQ3 A;  2RHL A;  3WPX A;  3DDN A;  5FLX M;  1W5E A;  3VOA A;  3E20 B;  1R1M A;  3CCJ F;  2FC3 A;  3J7A R;  4NWO B;  5HP8 A;  4X1Y B;  1SA0 A;  3EOR A;  3VO8 A;  1W5F A;  3N4Y A;  3WGL A;  1KNJ A;  3HJW C;  4YJ2 A;  2L26 A;  3WGN A;  3HAX D;  3Q8H A;  5GIO C;  3JAT B;  3C9S A;  3G4S F;  3U0O A;  2IAF A;  3HWU A;  1RQ7 A;  4O4L B;  1IV1 A;  2ALE A;  5KMG B;  2Q1X A;  1W3E X;  1JFF A;  4G4Y A;  1UI9 A;  2LBT A;  3CC7 F;  1Q81 H;  1YI2 F;  3RYI B;  4HNA B;  3LWV C;  3RYC A;  4KWE A;  2W8B C;  4C8E A;  3CB2 A;  3K12 A;  3L7Q A;  1IV3 A;  3D00 A;  2GLZ A;  4X1I B;  3CC2 F;  3NMU C;  3S0W A;  3G6E F;  5EB0 A;  3ZP4 A;  4O4J A;  1NJI H;  3JAW A;  3P10 A;  3C9U A;  3KE1 A;  5FNV B;  4TV8 B;  2HP0 B;  5J2U A;  1Q8R A;  1K8A H;  4LNU A;  5LA6 A;  2HP0 A;  2R6R 1;  3LWO C;  3FPI A;  5LP6 C;  1M1K H;  2F9Z C;  1RA4 A;  3RYH A;  3WJR A;  3JAL B;  3CYP B;  3RA6 A;  4ERH A;  1VQN F;  1T0K B;  5EB1 B;  1TVK B;  3IMP A;  3JAW B;  3LME A;  2YXZ A;  2Z1E A;  5EYP A;  3HKD B;  1S72 F;  3MQW A;  1W42 A;  2NMU A;  1VQ5 F;  1QVG F;  1H7M A;  2ZF8 A;  4RHA A;  4O2B A;  4FFB A;  3S03 A;  1VQK F;  4FFB B;  2AIF A;  2QEX F;  3KJK A;  1SZQ A;  4IHJ B;  5LYJ B;  2ZVY A;  3CCM F;  1KD1 H;  3VYT C;  2VAW A;  3JAR B;  4U39 A;  4F6R B;  3M4S A;  3CCU F;  3V7Q A;  4F6R A;  4G4Z A;  4BT7 A;  1VQM F;  2OTJ F;  5DCV A;  5KMG A;  1YQN A;  1PXW A;  4NQ3 A;  3JAM M;  4O4I B;  3CCS F;  3CXC F;  3JAK B;  4ZHY B;  2CHS A;  3C9R A;  5ITZ A;  2I6D A;  3ESJ A;  3N2G B;  1U40 A;  2KG4 A;  4YJ2 B;  3WJQ A;  3C9T A;  5FNV A;  3FD6 A;  3HKB B;  5A2Q M;  3ZO8 A;  4O4H A;  4YJ3 A;  1FNJ A;  2VAM A;  5J2T A;  2IQQ A;  2DT4 A;  4TV9 B;  1U3L A;  2N48 A;  1RQ2 A;  5LOV B;  3N4Z A;  2HS3 A;  4I4T A;  2BTQ B;  4I4T B;  2QTP A;  5EO3 A;  4B5C A;  4BT2 A;  2Z1T A;  3FFM A;  4B46 A;  2RHO A;  4BVR A;  1GX1 A;  3QHD A;  1YIJ F;  3MCA B;  2KTU A;  2HQS C;  4G88 A;  1ONI A;  4ZHQ A;  2CSL A;  3HTN A;  5IJ9 A;  2BTU A;  3P0Z A;  1GO1 A;  3WGJ A;  5BMV A;  1YHQ F;  3ERN A;  3CCQ F;  5HWE A;  3F0G A;  3S06 A;  4DXD A;  4BW0 B;  4C8I A;  1J7H A;  3RYF A;  5MN5 A;  4B62 A;  1FNK A;  1VQ4 F;  3JAR A;  2JNB A;  2V9Y A;  4O4H B;  2RHH A;  5B8F A;  4BT6 A;  4G4W A;  3K0T A;  1M90 H;  5EZY B;  1JFF B;  2HX0 A;  1Z5W A;  4TZZ A;  5JQG B;  1KNK A;  3E22 B;  2ZOD A;  5JVD B;  3JCM M;  5JH7 B;  5G4V C;  3RYC B;  4BVQ A;  3J81 M;  4C81 A;  2HS4 A;  4HNA A;  5HXU A;  5LP6 A;  5IJ9 B;  3O85 A;  1JJ2 F;  2GVI A;  2KTV A;  1X7O A;  2UYK A;  1RLG A;  3NK6 A;  2QA4 F;  1TUB A;  2CHT A;  3RYF B;  3S02 A;  3D54 A;  4ZOL B;  5CA1 B;  3CD6 F;  3TD4 A;  2VXY A;  1FFX A;  2B33 A;  1YJW F;  3VI6 A;  4O4L A;  3M84 A;  3I3F A;  5GIP C;  5LOV A;  3JAT A;  3HKC B;  1Z5V A;  4IIJ B;  5CB4 A;  4LNU B;  4I50 B;  4C82 A;  2H8C A;  1X52 A;  4TUY A;  5MN6 A;  5EZY A;  3BYQ A;  3QTY A;  3UT5 B;  4BVS A;  1H48 A;  2K1S A;  4O4I A;  1ZWZ A;  3KHN A;  2OZB A;  5C8Y A;  2RHJ A;  4X1K A;  4B45 A;  5GAN K;  5IT9 M;  3B6N A;  2QI2 A;  2Q1Y A;  4X20 A;  3SIV A;  2HP3 A;  1W5A A;  4PWT A;  4O4J B;  5GON A;  2BO1 A;  4X1I A;  4ZOL A;  2AMT A;  5CA1 A;  3CCR F;  1DBF A;  3VTI C;  2ZAU A;  5MN4 A;  4U3J B;  2PHN A;  1KQS F;  1GO0 A;  4O2A B;  3TD3 A;  1XV2 A;  3CPQ A;  4O2A A;  4ZI7 A;  3WGM A;  3N2K A;  3K2X A;  2HRY A;  5JH7 A;  5IYZ B;  1JD1 A;  4WBN B;  4G4V A;  3IEQ A;  3CYQ A;  3VOB A;  2UYJ A;  3I56 F;  3GTZ A; 
#chains in the Genus database with same CATH homology
 3S0W A;  4G4X A;  5EB0 A;  4ERH A;  5EB1 B;  3IMP A;  4G4W A;  4PWT A;  4B5C A;  4ZHY B;  2MQE A;  2LCA A;  3S0H A;  2ZVZ A;  2ZF8 A;  4RHA A;  3WPX A;  3WPW A;  3S03 A;  4G4Y A;  3S0Y A;  2HQS C;  4G88 A;  1R1M A;  2ZOV A;  1OAP A;  2LBT A;  2ZVY A;  2K1S A;  3TD3 A;  2KGW A;  3KHN A;  4R40 B;  4ZHW A;  2W8B C;  2AIZ P;  3OON A;  4G4V A;  3LDT A;  3S06 A;  5EAZ A;  3TD5 A;  2N48 A;  4ZHV A;  3S02 A;  4G4Z A;  3CYQ A;  4B62 A;  2L26 A;  3CYP B;  3TD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...