3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
4G4VA 1R1MA 5EAZA 4G88A 2AIZP 2HQSC 4R40B 5EB0A 3S0WA 3WPWA 4ZHWA 2W8BC 2LCAA 2ZF8A 1OAPA 4RHAA 2L26A 3TD4A 3TD5A 4ZHVA 4B5CA 2K1SA 3LDTA 4G4YA 3WPXA 4ERHA 4PWTA 4G4XA 4G4WA 3TD3A 4ZHYB 3IMPA 2ZOVA 3OONA 3S02A 3CYPB 4B62A 2KGWA 3S0HA 2ZVZA 4G4ZA 3KHNA 5EB1B 2LBTA 3S03A 3CYQA 3S0YA 2MQEA 2N48A 2ZVYA 3S06A
chains in the Genus database with same CATH superfamily
2YXZA 1GO1A 3ZP4A 3BYQA 5BMVB 1RQ7A 1FNKA 1KC8H 4O2AB 3IKFA 3OBYA 5CA1A 5IJ0B 5MN6A 4BT4A 2DYYA 3PAFA 1W55A 3IKEA 3CYPB 3FBAA 4C4WC 4M8IA 3GHZA 4ZOLB 1H47A 4KWEA 5GONA 3LWVC 2EWCA 2OHWA 3KJJA 2MQEA 3D00A 3Q8HA 4DRXB 1GX1A 1X25A 2UYJA 4O2AA 3S03A 3S06A 4TV8A 2PMPA 3JATB 4BT2A 1GZ0A 5GANK 3WXMB 5LP6B 5EWRA 2BO1A 5B8FA 2VAPA 1W57A 3F0DA 3J81M 1M90H 5A2QM 3S02A 4X1KB 4LNUA 3DDNA 4I50B 5EIBC 5GAPK 3V7QA 3CXCF 1KD1H 4TV8B 3JATA 3ELCA 3I7TA 3OW2F 3I56F 3V3TA 2ZAUA 3RA6A 3NVKE 4BVQA 3DC2A 2RHHA 3P0ZA 4C8GA 5GINC 1UI9A 5MN4A 1YJWF 2Q1XA 5FNVB 2I6DA 3VCZA 3HJWC 5LOVB 3ESJA 3VIUA 2PHNA 4TUYA 3EORA 5GIOC 1E7KA 3JARB 2H6LA 3RYCA 3CCQF 1J7HA 3C9SA 1Q7YH 5HWEA 5HP8A 3VMFB 3M4SA 2RHOA 1JD1A 5KMGA 1Q86H 1NMUB 5ITZA 3MBMA 2V9YA 4U3JA 3VO8A 1QU9A 5LP6A 5EO3A 3T80A 1R1MA 3FFMA 2AIZP 3N2KB 3HKEB 3KJKA 2HP0A 3RYFB 3WGKA 5G4VC 1VQKF 3F0EA 2W8BC 2L26A 5KX5A 3ZO8A 2CSLA 5IJ9A 4ZI7B 3WPXA 4BVTA 2OTLF 3NVIB 1GO0A 2QA4F 1QVFF 3JVHA 2KTUA 2Z01A 3CPQA 2IAFA 3C9UA 3C9TA 1TUBA 4O4LA 2QI2A 2ALEA 3VOAA 2KGWA 1XV2A 2CHSA 4B45A 3N2KA 1S72F 3IEQA 1VQ6F 1U40A 3K12A 3K0TA 1VQ7F 1XBIA 3HKBA 5JVDA 1Z5VA 3I3FA 1QD9A 5LOVA 4TZZA 1Z5WA 3N4YA 3JASA 5HXUA 3G4SF 3MDOA 5IYZA 1RA4A 1VQOF 3N2GA 4YJ3B 5JQGB 1SA0B 4O4JB 4ZK7A 2HS3A 2K1SA 2H8CA 3HKDA 2RHLA 4X3MA 5JH7B 1CN7A 4X3LA 5HY1A 3RYHA 1VQ8F 3CC7F 5IJ0A 3CCJF 1FSZA 2HS0A 2Z1TA 5EB1B 4O4JA 4I55A 1K8AH 4ZOLA 5GONB 2HQSC 2Q1YA 2Z1EA 4YJ2A 2HRUA 4HNAA 3VI6A 1W5AA 3UT5A 1X7OA 3WGNA 4B5CA 2FC3A 5J2UB 3E22B 2CWJA 4G4XA 1KNKA 2WALA 3ZP7A 3G6EF 5BMVA 1YJNF 3M84A 3HWUA 4I4TB 5HY4A 4ZHQA 2Z1UA 2LBTA 3F0FA 2YYEA 2CZWA 1XRGA 5J2UA 1YQNA 3HAXD 3JAKA 4BVRA 5MN5A 2VGMA 2LBWA 4LCKA 3HKDB 5HP7A 4ERHA 4G4WA 4I4TA 3GTZA 1W5FA 4ZHQB 5LXTA 5FJ4C 1XHOA 4BT7A 3QHDA 2I6RA 3F6MA 4C8IA 1Q82H 3NK7A 2JNBA 4BT6A 1VQ5F 3JALA 3WGLA 2VGNA 2NMUA 3RYIA 3U0OA 2RB9A 1X7PA 1VQPF 3UT5B 3CC2F 1FFXB 3S0WA 5C8YA 1TVKA 2LCAA 1RLGA 4BW0B 1KNJA 1W3EX 1IV2A 4X1IA 5JCOC 2R751 3C8LA 4NUTA 5CB4B 5EIBD 4ZHYB 5EYPB 3HKEA 3OBWA 2G9IA 4O4HA 3LWOC 3LWRC 1VQMF 1T0KB 1NJIH 3LFOA 5FNVA 4C8EA 1FFXA 5CA0B 5EZYB 4O2BA 2UYKA 1SZQA 3S0YA 4X1YB 2AIFA 2P6YA 4X20A 3AGKA 1YITF 4O4LB 1VQLF 5LP6C 1U3PA 5AVMA 5EYPA 5LXTB 3CCLF 3CCSF 1K73H 3QTYA 4IHJA 1YGYA 1YI2F 3LDTA 3HKBB 3JAWA 2VAWA 3P10A 4U3JB 5JVDB 5LA6B 2Z1FA 1VQ9F 3TD3A 3IMPA 3JALB 1YJ9F 3VYTC 3QUWA 3K2XA 4E6EA 3FD6A 5LYJA 3RYIB 2HRYA 2UYPA 1ODEA 4DRXA 5HY2A 2DT4A 5IJ9B 3VYUC 4IHJB 3RE3A 3MCAB 3SIVA 3CD6F 1X52A 5EAZA 4O4IA 1RQ2A 3WPWA 1PF5A 2R6R1 2QEXF 3J7AR 3CB2A 2CVLA 1UFYA 2FGYA 4EI7A 1W2BF 1OFUA 3B6NA 3N4ZA 3HTNA 4YJ2B 3GYQA 4HNAB 1KQSF 4O4IB 1VHAA 1W59A 4X20B 3LMEA 1DBFA 1QAHA 4IIJA 1DT9A 3KIZA 3G71F 3CC4F 3RYHB 4R40B 5FLXM 4YJ3A 3RA5A 3CCVF 4I55B 5LA6A 3D54A 3FD5A 1SDSA 4EB6A 2OTMA 4PWTA 1VH8A 1JJ2F 2ZOVA 1VQVA 3CMAF 1Q81H 2HP3A 1H7MA 3RYCB 5DCVA 2CW4A 3E20B 2GVIA 2HX0A 1Q8RA 2IG8A 5G4UC 2VXYA 3NMUC 1W581 1W42A 5CA1B 1JY8A 1FNJA 4DXDA 1CK2A 1U3LA 4ZHWA 1JN1A 3IR9A 1IV3A 1PXWA 1W5EA 3FPIA 3D01A 3V4DA 3WJPA 4BT5A 3CCEF 3LWQC 3CCUF 1N8RH 3KE1A 1H48A 1TVKB 2AMTA 2UYNA 2F9ZC 4BVSA 2VAMA 3KHNA 5CB4A 3J80M 2N48A 3LYBA 3ZOPA 4U39A 2ZVYA 3CPWF 4G4VA 4WBNB 5IYZB 1NQ3A 1YHQF 5EB0A 3VTIC 3WGJA 4RQOA 3WJRA 5J2TB 3O85A 4NWOB 3CCMF 5IT9M 3M1XA 4LNUB 1OAPA 4EB6B 4O2BB 2ZODA 4G4YA 1IPAA 1U43A 2GZLA 1RLUA 3JAMM 3K14A 2H8EA 1IV4A 1T0AA 3E1YA 4B62A 5JH7A 2RHJA 4EI8A 4FFBB 3JCMM 2ZVZA 2HVYD 3C9RA 3JAWB 3CYQA 1ONIA 3MCQA 4TV9A 4TUYB 3TD5A 4XCQA 5LYJB 1W5BA 5GIPC 3IEWA 4F6RA 3JARA 1QVGF 4ZHVA 4X1YA 1JFFB 5EZYA 2GLZA 1M1KH 4FFBA 3E22A 5KMGB 3ON1A 3OONA 3NK6A 2UYNB 3L7QA 3P4EA 3F0GA 5JQGA 4WBNA 1W40A 4ZI7A 3ERNA 5KX5B 2HS4A 4BY9D 3V7EA 1JFFA 5J2TA 3PLAC 3JAKB 4NQ3A 5JCOA 1K9MH 3CG6A 2ZF8A 3TD4A 4RHAA 2KTVA 3I55F 5ITZB 4B46A 4C81A 1W41A 2KG4A 3VYSC 4EI9A 1CLIA 1VQNF 2HP0B 3RYFA 1IV1A 3JASB 4TV9B 3SIUA 3HKCB 2OTJF 4BT3A 1YIJF 2UZHA 3LWPC 3R0PA 3WGMA 2IQQA 5C8YB 4G88A 4F6RB 2BTOA 5HXZA 3CCRF 2OZBA 3WJQA 1TUBB 1ZWZA 4IIJB 2BTQB 3HKCA 2CHTA 4X1IB 1COMA 4C82A 3MQWA 1VQ4F 2QTPA 4X1KA 5HY0A 4I50A 4O4HB 3S0HA 4G4ZA 3VOBA 2BTUA 3CMEF 5CA0A 1VK3A 3N2GB 1SA0A 2B33A 2LBXA
chains in the Genus database with same CATH topology
4G4VA 1R1MA 5EAZA 4G88A 2AIZP 2HQSC 4R40B 5EB0A 3S0WA 3WPWA 4ZHWA 2W8BC 2LCAA 2ZF8A 1OAPA 4RHAA 2L26A 3TD4A 3TD5A 4ZHVA 4B5CA 2K1SA 3LDTA 4G4YA 3WPXA 4ERHA 4PWTA 4G4XA 4G4WA 3TD3A 4ZHYB 3IMPA 2ZOVA 3OONA 3S02A 3CYPB 4B62A 2KGWA 3S0HA 2ZVZA 4G4ZA 3KHNA 5EB1B 2LBTA 3S03A 3CYQA 3S0YA 2MQEA 2N48A 2ZVYA 3S06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4V A;  1R1M A;  5EAZ A;  4G88 A;  2AIZ P;  2HQS C;  4R40 B;  5EB0 A;  3S0W A;  3WPW A;  4ZHW A;  2W8B C;  2LCA A;  2ZF8 A;  1OAP A;  4RHA A;  2L26 A;  3TD4 A;  3TD5 A;  4ZHV A;  4B5C A;  2K1S A;  3LDT A;  4G4Y A;  3WPX A;  4ERH A;  4PWT A;  4G4X A;  4G4W A;  3TD3 A;  4ZHY B;  3IMP A;  2ZOV A;  3OON A;  3S02 A;  3CYP B;  4B62 A;  2KGW A;  3S0H A;  2ZVZ A;  4G4Z A;  3KHN A;  5EB1 B;  2LBT A;  3S03 A;  3CYQ A;  3S0Y A;  2MQE A;  2N48 A;  2ZVY A;  3S06 A; 
#chains in the Genus database with same CATH topology
 2YXZ A;  1GO1 A;  3ZP4 A;  3BYQ A;  5BMV B;  1RQ7 A;  1FNK A;  1KC8 H;  4O2A B;  3IKF A;  3OBY A;  5CA1 A;  5IJ0 B;  5MN6 A;  4BT4 A;  2DYY A;  3PAF A;  1W55 A;  3IKE A;  3CYP B;  3FBA A;  4C4W C;  4M8I A;  3GHZ A;  4ZOL B;  1H47 A;  4KWE A;  5GON A;  3LWV C;  2EWC A;  2OHW A;  3KJJ A;  2MQE A;  3D00 A;  3Q8H A;  4DRX B;  1GX1 A;  1X25 A;  2UYJ A;  4O2A A;  3S03 A;  3S06 A;  4TV8 A;  2PMP A;  3JAT B;  4BT2 A;  1GZ0 A;  5GAN K;  3WXM B;  5LP6 B;  5EWR A;  2BO1 A;  5B8F A;  2VAP A;  1W57 A;  3F0D A;  3J81 M;  1M90 H;  5A2Q M;  3S02 A;  4X1K B;  4LNU A;  3DDN A;  4I50 B;  5EIB C;  5GAP K;  3V7Q A;  3CXC F;  1KD1 H;  4TV8 B;  3JAT A;  3ELC A;  3I7T A;  3OW2 F;  3I56 F;  3V3T A;  2ZAU A;  3RA6 A;  3NVK E;  4BVQ A;  3DC2 A;  2RHH A;  3P0Z A;  4C8G A;  5GIN C;  1UI9 A;  5MN4 A;  1YJW F;  2Q1X A;  5FNV B;  2I6D A;  3VCZ A;  3HJW C;  5LOV B;  3ESJ A;  3VIU A;  2PHN A;  4TUY A;  3EOR A;  5GIO C;  1E7K A;  3JAR B;  2H6L A;  3RYC A;  3CCQ F;  1J7H A;  3C9S A;  1Q7Y H;  5HWE A;  5HP8 A;  3VMF B;  3M4S A;  2RHO A;  1JD1 A;  5KMG A;  1Q86 H;  1NMU B;  5ITZ A;  3MBM A;  2V9Y A;  4U3J A;  3VO8 A;  1QU9 A;  5LP6 A;  5EO3 A;  3T80 A;  1R1M A;  3FFM A;  2AIZ P;  3N2K B;  3HKE B;  3KJK A;  2HP0 A;  3RYF B;  3WGK A;  5G4V C;  1VQK F;  3F0E A;  2W8B C;  2L26 A;  5KX5 A;  3ZO8 A;  2CSL A;  5IJ9 A;  4ZI7 B;  3WPX A;  4BVT A;  2OTL F;  3NVI B;  1GO0 A;  2QA4 F;  1QVF F;  3JVH A;  2KTU A;  2Z01 A;  3CPQ A;  2IAF A;  3C9U A;  3C9T A;  1TUB A;  4O4L A;  2QI2 A;  2ALE A;  3VOA A;  2KGW A;  1XV2 A;  2CHS A;  4B45 A;  3N2K A;  1S72 F;  3IEQ A;  1VQ6 F;  1U40 A;  3K12 A;  3K0T A;  1VQ7 F;  1XBI A;  3HKB A;  5JVD A;  1Z5V A;  3I3F A;  1QD9 A;  5LOV A;  4TZZ A;  1Z5W A;  3N4Y A;  3JAS A;  5HXU A;  3G4S F;  3MDO A;  5IYZ A;  1RA4 A;  1VQO F;  3N2G A;  4YJ3 B;  5JQG B;  1SA0 B;  4O4J B;  4ZK7 A;  2HS3 A;  2K1S A;  2H8C A;  3HKD A;  2RHL A;  4X3M A;  5JH7 B;  1CN7 A;  4X3L A;  5HY1 A;  3RYH A;  1VQ8 F;  3CC7 F;  5IJ0 A;  3CCJ F;  1FSZ A;  2HS0 A;  2Z1T A;  5EB1 B;  4O4J A;  4I55 A;  1K8A H;  4ZOL A;  5GON B;  2HQS C;  2Q1Y A;  2Z1E A;  4YJ2 A;  2HRU A;  4HNA A;  3VI6 A;  1W5A A;  3UT5 A;  1X7O A;  3WGN A;  4B5C A;  2FC3 A;  5J2U B;  3E22 B;  2CWJ A;  4G4X A;  1KNK A;  2WAL A;  3ZP7 A;  3G6E F;  5BMV A;  1YJN F;  3M84 A;  3HWU A;  4I4T B;  5HY4 A;  4ZHQ A;  2Z1U A;  2LBT A;  3F0F A;  2YYE A;  2CZW A;  1XRG A;  5J2U A;  1YQN A;  3HAX D;  3JAK A;  4BVR A;  5MN5 A;  2VGM A;  2LBW A;  4LCK A;  3HKD B;  5HP7 A;  4ERH A;  4G4W A;  4I4T A;  3GTZ A;  1W5F A;  4ZHQ B;  5LXT A;  5FJ4 C;  1XHO A;  4BT7 A;  3QHD A;  2I6R A;  3F6M A;  4C8I A;  1Q82 H;  3NK7 A;  2JNB A;  4BT6 A;  1VQ5 F;  3JAL A;  3WGL A;  2VGN A;  2NMU A;  3RYI A;  3U0O A;  2RB9 A;  1X7P A;  1VQP F;  3UT5 B;  3CC2 F;  1FFX B;  3S0W A;  5C8Y A;  1TVK A;  2LCA A;  1RLG A;  4BW0 B;  1KNJ A;  1W3E X;  1IV2 A;  4X1I A;  5JCO C;  2R75 1;  3C8L A;  4NUT A;  5CB4 B;  5EIB D;  4ZHY B;  5EYP B;  3HKE A;  3OBW A;  2G9I A;  4O4H A;  3LWO C;  3LWR C;  1VQM F;  1T0K B;  1NJI H;  3LFO A;  5FNV A;  4C8E A;  1FFX A;  5CA0 B;  5EZY B;  4O2B A;  2UYK A;  1SZQ A;  3S0Y A;  4X1Y B;  2AIF A;  2P6Y A;  4X20 A;  3AGK A;  1YIT F;  4O4L B;  1VQL F;  5LP6 C;  1U3P A;  5AVM A;  5EYP A;  5LXT B;  3CCL F;  3CCS F;  1K73 H;  3QTY A;  4IHJ A;  1YGY A;  1YI2 F;  3LDT A;  3HKB B;  3JAW A;  2VAW A;  3P10 A;  4U3J B;  5JVD B;  5LA6 B;  2Z1F A;  1VQ9 F;  3TD3 A;  3IMP A;  3JAL B;  1YJ9 F;  3VYT C;  3QUW A;  3K2X A;  4E6E A;  3FD6 A;  5LYJ A;  3RYI B;  2HRY A;  2UYP A;  1ODE A;  4DRX A;  5HY2 A;  2DT4 A;  5IJ9 B;  3VYU C;  4IHJ B;  3RE3 A;  3MCA B;  3SIV A;  3CD6 F;  1X52 A;  5EAZ A;  4O4I A;  1RQ2 A;  3WPW A;  1PF5 A;  2R6R 1;  2QEX F;  3J7A R;  3CB2 A;  2CVL A;  1UFY A;  2FGY A;  4EI7 A;  1W2B F;  1OFU A;  3B6N A;  3N4Z A;  3HTN A;  4YJ2 B;  3GYQ A;  4HNA B;  1KQS F;  4O4I B;  1VHA A;  1W59 A;  4X20 B;  3LME A;  1DBF A;  1QAH A;  4IIJ A;  1DT9 A;  3KIZ A;  3G71 F;  3CC4 F;  3RYH B;  4R40 B;  5FLX M;  4YJ3 A;  3RA5 A;  3CCV F;  4I55 B;  5LA6 A;  3D54 A;  3FD5 A;  1SDS A;  4EB6 A;  2OTM A;  4PWT A;  1VH8 A;  1JJ2 F;  2ZOV A;  1VQV A;  3CMA F;  1Q81 H;  2HP3 A;  1H7M A;  3RYC B;  5DCV A;  2CW4 A;  3E20 B;  2GVI A;  2HX0 A;  1Q8R A;  2IG8 A;  5G4U C;  2VXY A;  3NMU C;  1W58 1;  1W42 A;  5CA1 B;  1JY8 A;  1FNJ A;  4DXD A;  1CK2 A;  1U3L A;  4ZHW A;  1JN1 A;  3IR9 A;  1IV3 A;  1PXW A;  1W5E A;  3FPI A;  3D01 A;  3V4D A;  3WJP A;  4BT5 A;  3CCE F;  3LWQ C;  3CCU F;  1N8R H;  3KE1 A;  1H48 A;  1TVK B;  2AMT A;  2UYN A;  2F9Z C;  4BVS A;  2VAM A;  3KHN A;  5CB4 A;  3J80 M;  2N48 A;  3LYB A;  3ZOP A;  4U39 A;  2ZVY A;  3CPW F;  4G4V A;  4WBN B;  5IYZ B;  1NQ3 A;  1YHQ F;  5EB0 A;  3VTI C;  3WGJ A;  4RQO A;  3WJR A;  5J2T B;  3O85 A;  4NWO B;  3CCM F;  5IT9 M;  3M1X A;  4LNU B;  1OAP A;  4EB6 B;  4O2B B;  2ZOD A;  4G4Y A;  1IPA A;  1U43 A;  2GZL A;  1RLU A;  3JAM M;  3K14 A;  2H8E A;  1IV4 A;  1T0A A;  3E1Y A;  4B62 A;  5JH7 A;  2RHJ A;  4EI8 A;  4FFB B;  3JCM M;  2ZVZ A;  2HVY D;  3C9R A;  3JAW B;  3CYQ A;  1ONI A;  3MCQ A;  4TV9 A;  4TUY B;  3TD5 A;  4XCQ A;  5LYJ B;  1W5B A;  5GIP C;  3IEW A;  4F6R A;  3JAR A;  1QVG F;  4ZHV A;  4X1Y A;  1JFF B;  5EZY A;  2GLZ A;  1M1K H;  4FFB A;  3E22 A;  5KMG B;  3ON1 A;  3OON A;  3NK6 A;  2UYN B;  3L7Q A;  3P4E A;  3F0G A;  5JQG A;  4WBN A;  1W40 A;  4ZI7 A;  3ERN A;  5KX5 B;  2HS4 A;  4BY9 D;  3V7E A;  1JFF A;  5J2T A;  3PLA C;  3JAK B;  4NQ3 A;  5JCO A;  1K9M H;  3CG6 A;  2ZF8 A;  3TD4 A;  4RHA A;  2KTV A;  3I55 F;  5ITZ B;  4B46 A;  4C81 A;  1W41 A;  2KG4 A;  3VYS C;  4EI9 A;  1CLI A;  1VQN F;  2HP0 B;  3RYF A;  1IV1 A;  3JAS B;  4TV9 B;  3SIU A;  3HKC B;  2OTJ F;  4BT3 A;  1YIJ F;  2UZH A;  3LWP C;  3R0P A;  3WGM A;  2IQQ A;  5C8Y B;  4G88 A;  4F6R B;  2BTO A;  5HXZ A;  3CCR F;  2OZB A;  3WJQ A;  1TUB B;  1ZWZ A;  4IIJ B;  2BTQ B;  3HKC A;  2CHT A;  4X1I B;  1COM A;  4C82 A;  3MQW A;  1VQ4 F;  2QTP A;  4X1K A;  5HY0 A;  4I50 A;  4O4H B;  3S0H A;  4G4Z A;  3VOB A;  2BTU A;  3CME F;  5CA0 A;  1VK3 A;  3N2G B;  1SA0 A;  2B33 A;  2LBX A; 
#chains in the Genus database with same CATH homology
 4G4V A;  1R1M A;  5EAZ A;  4G88 A;  2AIZ P;  2HQS C;  4R40 B;  5EB0 A;  3S0W A;  3WPW A;  4ZHW A;  2W8B C;  2LCA A;  2ZF8 A;  1OAP A;  4RHA A;  2L26 A;  3TD4 A;  3TD5 A;  4ZHV A;  4B5C A;  2K1S A;  3LDT A;  4G4Y A;  3WPX A;  4ERH A;  4PWT A;  4G4X A;  4G4W A;  3TD3 A;  4ZHY B;  3IMP A;  2ZOV A;  3OON A;  3S02 A;  3CYP B;  4B62 A;  2KGW A;  3S0H A;  2ZVZ A;  4G4Z A;  3KHN A;  5EB1 B;  2LBT A;  3S03 A;  3CYQ A;  3S0Y A;  2MQE A;  2N48 A;  2ZVY A;  3S06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...