3CYQA

The crystal structure of the complex of the c-terminal domain of helicobacter pylori motb (residues 125-256) with n-acetylmuramic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
b'GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
molecule tags Membrane protein
source organism Helicobacter pylori
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
rcsb
total genus 44
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cyqA00
2LCAA 2LBTA 3S0HA 4B62A 3CYQA 4PWTA 3S06A 3S0YA 2MQEA 4R40B 4ZHYB 3S02A 4RHAA 2L26A 4B5CA 3KHNA 1OAPA 3WPWA 2ZVYA 3S0WA 4G4XA 4ZHVA 3TD3A 3TD4A 3CYPB 4ERHA 2ZF8A 4G4ZA 4ZHWA 2W8BC 2N48A 1R1MA 2K1SA 3IMPA 4G4YA 2AIZP 4G88A 3TD5A 2ZOVA 4G4WA 5EB0A 5EAZA 3OONA 3WPXA 3S03A 3LDTA 2KGWA 5EB1B 2HQSC 4G4VA 2ZVZA
chains in the Genus database with same CATH superfamily
3FFMA 1XHOA 3C9SA 1VQ8F 1X52A 2DT4A 3FBAA 1NMUB 1JY8A 2L26A 2I6RA 5BMVA 1QVFF 3S0WA 1VQPF 1X7PA 3IEQA 3G4SF 4NWOB 1GO1A 3HKEB 4BT2A 2N48A 2K1SA 3ON1A 3LWVC 4G88A 4X1KA 2YYEA 1VQLF 3CG6A 1ODEA 2ZVZA 5LYJB 3N2GB 5EZYA 5J2UA 3VYUC 1CN7A 5CA0A 3V4DA 2CVLA 2P6YA 3CPQA 1VQMF 1QU9A 3VTIC 1VQ9F 3M4SA 3WJPA 5IYZA 5ITZB 2RHLA 3WPWA 1VQ5F 3E1YA 1COMA 4F6RB 3JAKA 3HKBA 5LP6C 2BTUA 1ZWZA 3I7TA 1CLIA 5EB0A 3CC2F 3MDOA 3O85A 3WGNA 4BVQA 3S03A 1IPAA 2UYPA 4O4IB 3GTZA 3JATA 5GONA 1UFYA 2GZLA 1H48A 3LFOA 3CCEF 4O2AB 2RB9A 2BTQB 2VGNA 3MBMA 1T0AA 4C8IA 1H47A 2DYYA 3D54A 4O2AA 4BT4A 2BTOA 4EB6A 1W5AA 1YHQF 3M84A 5A2QM 5EIBC 1XV2A 3P0ZA 2HP3A 1XRGA 4O4HA 3VOAA 5CA1A 5C8YA 2VXYA 3OBYA 3RYFB 4X1IA 2Q1YA 1JD1A 4O4HB 2ALEA 3F6MA 4X1YB 4YJ2B 3F0EA 4ZI7B 3HKEA 3JASA 4EI7A 3RYFA 2OHWA 3WGKA 5G4VC 4WBNA 5GIOC 4G4ZA 1YJWF 2Z1FA 1IV2A 2CHSA 2ZAUA 2ZOVA 3ESJA 3CC4F 1S72F 2HP0B 2CW4A 4C82A 1Q81H 4BT7A 2HX0A 2LBTA 1VK3A 1W42A 1SA0B 4BVRA 3HKCB 5ITZA 2Z1UA 3CD6F 5LOVA 1YJNF 5IJ0B 3KIZA 3WGJA 5JVDA 1DBFA 3JARB 2FGYA 5HXZA 4O4JB 5AVMA 2AMTA 4ZHVA 3WGMA 4X1IB 5HWEA 1KQSF 3ELCA 2Z1TA 1W59A 4X1KB 4BVTA 1U3PA 1KC8H 4O4JA 2AIFA 3HKDB 1W3EX 3IMPA 2LBWA 1IV3A 5KMGA 2HS3A 2GVIA 3IR9A 4C81A 4ZK7A 1W5EA 3ZP7A 5IYZB 3VO8A 3FPIA 3CYQA 3S06A 3G6EF 2G9IA 1QVGF 4X3MA 3JCMM 3NVKE 2PMPA 3N2GA 3OW2F 4FFBB 3UT5B 3LWQC 3QHDA 2Z1EA 5CA0B 5FNVB 3KJJA 2H8EA 2EWCA 3EORA 1Z5WA 1QAHA 5DCVA 3P10A 1VQ7F 5CA1B 5IJ9A 3C9RA 1FFXA 5C8YB 3MCAB 1K73H 3VCZA 4ZHQA 3LYBA 1YI2F 3P4EA 3JAWA 4I50B 4O4LA 3RA5A 4B46A 1PXWA 3CB2A 3DC2A 3S02A 1JFFA 5LA6A 5MN5A 3D01A 3DDNA 3K2XA 5LP6B 1W581 2Z01A 1JFFB 3JATB 1TVKA 3E22A 4TUYB 4TV8B 2VAPA 4U3JB 1W41A 5KX5A 3CMAF 3FD6A 1GX1A 1YQNA 5CB4A 4TV9B 2ZODA 4ZOLB 3ZP4A 3RYIA 1W55A 1T0KB 3CCMF 3AGKA 4BT6A 4B45A 1TUBB 3LWPC 4ZHYB 3HTNA 2WALA 3JALB 3RYCA 1KNKA 3D00A 4I4TA 2VGMA 3BYQA 1FNJA 1ONIA 1FNKA 4LNUB 1CK2A 3G71F 5JQGA 5JCOA 3Q8HA 3V3TA 3HAXD 1UI9A 1GO0A 3KE1A 3CCRF 3IEWA 4G4YA 5LYJA 4WBNB 4O2BA 1VQNF 4X3LA 3KJKA 3RE3A 3WPXA 3CCVF 3I3FA 4DRXB 3LWRC 3S0HA 2F9ZC 4U39A 4PWTA 1N8RH 1RQ7A 3CC7F 5CB4B 3S0YA 4IHJA 4ZOLA 2MQEA 2HRUA 3RYIB 2CZWA 1RLUA 1W5FA 1M90H 3L7QA 3HKCA 1FSZA 3FD5A 2HRYA 3MCQA 4NUTA 2Q1XA 4YJ3A 3CPWF 3TD4A 3VI6A 3RYHA 1QD9A 1Q86H 5MN4A 2UYJA 5G4UC 3ZO8A 2CWJA 5JQGB 3TD5A 2OZBA 3PAFA 2QTPA 2QA4F 3JAWB 2IAFA 4O4LB 1RLGA 1XBIA 3CCQF 5GAPK 4I55B 5J2TB 1IV1A 1Q7YH 3KHNA 1KNJA 1OAPA 3T80A 1W57A 1Q8RA 4IHJB 3TD3A 1X7OA 1YJ9F 1E7KA 3E20B 2HS4A 3V7QA 2OTJF 2PHNA 3J81M 2VAWA 2QEXF 2I6DA 5EO3A 2RHHA 3N4YA 5LXTB 2KGWA 2HQSC 3R0PA 3JALA 2H8CA 3OBWA 3WXMB 5GONB 4KWEA 5EIBD 2HVYD 3HJWC 3RA6A 5GIPC 1W2BF 2VAMA 4ZHQB 2KG4A 2GLZA 5EZYB 5J2UB 1KD1H 3F0DA 4BVSA 4O4IA 3CXCF 1U3LA 4C8GA 3VYTC 4RQOA 3J80M 2UYNB 2JNBA 3NVIB 5JCOC 3NMUC 1U40A 3CYPB 4TV9A 2UYKA 1R1MA 3VOBA 3I55F 2IQQA 4EI9A 4DXDA 2YXZA 4HNAB 3U0OA 3HKBB 2CSLA 3C9UA 5JH7B 1K8AH 5IT9M 2R751 4EB6B 1Z5VA 5BMVB 3CCUF 1YGYA 3CCJF 5FLXM 3VIUA 5FJ4C 4RHAA 4B5CA 5EYPA 1SZQA 1YIJF 1NJIH 1GZ0A 3QTYA 1VQOF 3CMEF 4I50A 1NQ3A 5LA6B 4BY9D 3ZOPA 4ZI7A 1RA4A 3JASB 5HY1A 2LBXA 3K14A 3NK7A 2W8BC 5HY4A 2OTLF 4DRXA 1M1KH 4IIJB 3PLAC 4G4WA 5HY0A 2HS0A 2UZHA 4I55A 3SIUA 4BT5A 3JARA 5KX5B 4IIJA 3JAMM 5MN6A 2KTUA 1VQ6F 4FFBA 3UT5A 1H7MA 2R6R1 5HXUA 5FNVA 4R40B 1Q82H 1OFUA 3JAKB 3JVHA 3N2KB 4NQ3A 2B33A 2ZVYA 2BO1A 5GINC 3ERNA 4X20B 5EYPB 3IKEA 3CCSF 5KMGB 3N2KA 4I4TB 1U43A 3CCLF 4ZHWA 2AIZP 1VQVA 3OONA 1VQKF 4G4VA 2OTMA 1X25A 5EWRA 4C4WC 4TZZA 2UYNA 3E22B 4TUYA 5HP7A 5IJ0A 3J7AR 3WGLA 5JVDB 5GANK 3I56F 4BW0B 4EI8A 4X20A 5HY2A 2H6LA 3IKFA 1YITF 1JJ2F 1VH8A 3RYHB 1RQ2A 3HKDA 3LDTA 2V9YA 5IJ9B 3GHZA 1FFXB 3MQWA 1K9MH 2QI2A 1IV4A 1J7HA 3F0FA 2CHTA 4G4XA 3B6NA 5J2TA 3NK6A 4U3JA 1SDSA 1DT9A 4O2BB 3V7EA 2RHJA 4BT3A 3WJQA 5LP6A 2HP0A 4E6EA 3SIVA 4F6RA 2KTVA 3VMFB 3K12A 2LCAA 3RYCB 2IG8A 4B62A 4LCKA 3F0GA 4HNAA 3N4ZA 1VQ4F 5JH7A 5LXTA 4LNUA 3GYQA 2NMUA 4M8IA 4YJ3B 2RHOA 3QUWA 3C9TA 1TUBA 3LWOC 1W40A 3C8LA 1JN1A 1VHAA 3HWUA 5HP8A 4X1YA 4YJ2A 3M1XA 1PF5A 2FC3A 3LMEA 4ERHA 2ZF8A 5B8FA 4C8EA 3K0TA 4XCQA 1SA0A 3WJRA 1TVKB 5EAZA 5LOVB 4TV8A 1W5BA 5EB1B 3VYSC
chains in the Genus database with same CATH topology
2LCAA 2LBTA 3S0HA 4B62A 3CYQA 4PWTA 3S06A 3S0YA 2MQEA 4R40B 4ZHYB 3S02A 4RHAA 2L26A 4B5CA 3KHNA 1OAPA 3WPWA 2ZVYA 3S0WA 4G4XA 4ZHVA 3TD3A 3TD4A 3CYPB 4ERHA 2ZF8A 4G4ZA 4ZHWA 2W8BC 2N48A 1R1MA 2K1SA 3IMPA 4G4YA 2AIZP 4G88A 3TD5A 2ZOVA 4G4WA 5EB0A 5EAZA 3OONA 3WPXA 3S03A 3LDTA 2KGWA 5EB1B 2HQSC 4G4VA 2ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCA A;  2LBT A;  3S0H A;  4B62 A;  3CYQ A;  4PWT A;  3S06 A;  3S0Y A;  2MQE A;  4R40 B;  4ZHY B;  3S02 A;  4RHA A;  2L26 A;  4B5C A;  3KHN A;  1OAP A;  3WPW A;  2ZVY A;  3S0W A;  4G4X A;  4ZHV A;  3TD3 A;  3TD4 A;  3CYP B;  4ERH A;  2ZF8 A;  4G4Z A;  4ZHW A;  2W8B C;  2N48 A;  1R1M A;  2K1S A;  3IMP A;  4G4Y A;  2AIZ P;  4G88 A;  3TD5 A;  2ZOV A;  4G4W A;  5EB0 A;  5EAZ A;  3OON A;  3WPX A;  3S03 A;  3LDT A;  2KGW A;  5EB1 B;  2HQS C;  4G4V A;  2ZVZ A; 
#chains in the Genus database with same CATH topology
 3FFM A;  1XHO A;  3C9S A;  1VQ8 F;  1X52 A;  2DT4 A;  3FBA A;  1NMU B;  1JY8 A;  2L26 A;  2I6R A;  5BMV A;  1QVF F;  3S0W A;  1VQP F;  1X7P A;  3IEQ A;  3G4S F;  4NWO B;  1GO1 A;  3HKE B;  4BT2 A;  2N48 A;  2K1S A;  3ON1 A;  3LWV C;  4G88 A;  4X1K A;  2YYE A;  1VQL F;  3CG6 A;  1ODE A;  2ZVZ A;  5LYJ B;  3N2G B;  5EZY A;  5J2U A;  3VYU C;  1CN7 A;  5CA0 A;  3V4D A;  2CVL A;  2P6Y A;  3CPQ A;  1VQM F;  1QU9 A;  3VTI C;  1VQ9 F;  3M4S A;  3WJP A;  5IYZ A;  5ITZ B;  2RHL A;  3WPW A;  1VQ5 F;  3E1Y A;  1COM A;  4F6R B;  3JAK A;  3HKB A;  5LP6 C;  2BTU A;  1ZWZ A;  3I7T A;  1CLI A;  5EB0 A;  3CC2 F;  3MDO A;  3O85 A;  3WGN A;  4BVQ A;  3S03 A;  1IPA A;  2UYP A;  4O4I B;  3GTZ A;  3JAT A;  5GON A;  1UFY A;  2GZL A;  1H48 A;  3LFO A;  3CCE F;  4O2A B;  2RB9 A;  2BTQ B;  2VGN A;  3MBM A;  1T0A A;  4C8I A;  1H47 A;  2DYY A;  3D54 A;  4O2A A;  4BT4 A;  2BTO A;  4EB6 A;  1W5A A;  1YHQ F;  3M84 A;  5A2Q M;  5EIB C;  1XV2 A;  3P0Z A;  2HP3 A;  1XRG A;  4O4H A;  3VOA A;  5CA1 A;  5C8Y A;  2VXY A;  3OBY A;  3RYF B;  4X1I A;  2Q1Y A;  1JD1 A;  4O4H B;  2ALE A;  3F6M A;  4X1Y B;  4YJ2 B;  3F0E A;  4ZI7 B;  3HKE A;  3JAS A;  4EI7 A;  3RYF A;  2OHW A;  3WGK A;  5G4V C;  4WBN A;  5GIO C;  4G4Z A;  1YJW F;  2Z1F A;  1IV2 A;  2CHS A;  2ZAU A;  2ZOV A;  3ESJ A;  3CC4 F;  1S72 F;  2HP0 B;  2CW4 A;  4C82 A;  1Q81 H;  4BT7 A;  2HX0 A;  2LBT A;  1VK3 A;  1W42 A;  1SA0 B;  4BVR A;  3HKC B;  5ITZ A;  2Z1U A;  3CD6 F;  5LOV A;  1YJN F;  5IJ0 B;  3KIZ A;  3WGJ A;  5JVD A;  1DBF A;  3JAR B;  2FGY A;  5HXZ A;  4O4J B;  5AVM A;  2AMT A;  4ZHV A;  3WGM A;  4X1I B;  5HWE A;  1KQS F;  3ELC A;  2Z1T A;  1W59 A;  4X1K B;  4BVT A;  1U3P A;  1KC8 H;  4O4J A;  2AIF A;  3HKD B;  1W3E X;  3IMP A;  2LBW A;  1IV3 A;  5KMG A;  2HS3 A;  2GVI A;  3IR9 A;  4C81 A;  4ZK7 A;  1W5E A;  3ZP7 A;  5IYZ B;  3VO8 A;  3FPI A;  3CYQ A;  3S06 A;  3G6E F;  2G9I A;  1QVG F;  4X3M A;  3JCM M;  3NVK E;  2PMP A;  3N2G A;  3OW2 F;  4FFB B;  3UT5 B;  3LWQ C;  3QHD A;  2Z1E A;  5CA0 B;  5FNV B;  3KJJ A;  2H8E A;  2EWC A;  3EOR A;  1Z5W A;  1QAH A;  5DCV A;  3P10 A;  1VQ7 F;  5CA1 B;  5IJ9 A;  3C9R A;  1FFX A;  5C8Y B;  3MCA B;  1K73 H;  3VCZ A;  4ZHQ A;  3LYB A;  1YI2 F;  3P4E A;  3JAW A;  4I50 B;  4O4L A;  3RA5 A;  4B46 A;  1PXW A;  3CB2 A;  3DC2 A;  3S02 A;  1JFF A;  5LA6 A;  5MN5 A;  3D01 A;  3DDN A;  3K2X A;  5LP6 B;  1W58 1;  2Z01 A;  1JFF B;  3JAT B;  1TVK A;  3E22 A;  4TUY B;  4TV8 B;  2VAP A;  4U3J B;  1W41 A;  5KX5 A;  3CMA F;  3FD6 A;  1GX1 A;  1YQN A;  5CB4 A;  4TV9 B;  2ZOD A;  4ZOL B;  3ZP4 A;  3RYI A;  1W55 A;  1T0K B;  3CCM F;  3AGK A;  4BT6 A;  4B45 A;  1TUB B;  3LWP C;  4ZHY B;  3HTN A;  2WAL A;  3JAL B;  3RYC A;  1KNK A;  3D00 A;  4I4T A;  2VGM A;  3BYQ A;  1FNJ A;  1ONI A;  1FNK A;  4LNU B;  1CK2 A;  3G71 F;  5JQG A;  5JCO A;  3Q8H A;  3V3T A;  3HAX D;  1UI9 A;  1GO0 A;  3KE1 A;  3CCR F;  3IEW A;  4G4Y A;  5LYJ A;  4WBN B;  4O2B A;  1VQN F;  4X3L A;  3KJK A;  3RE3 A;  3WPX A;  3CCV F;  3I3F A;  4DRX B;  3LWR C;  3S0H A;  2F9Z C;  4U39 A;  4PWT A;  1N8R H;  1RQ7 A;  3CC7 F;  5CB4 B;  3S0Y A;  4IHJ A;  4ZOL A;  2MQE A;  2HRU A;  3RYI B;  2CZW A;  1RLU A;  1W5F A;  1M90 H;  3L7Q A;  3HKC A;  1FSZ A;  3FD5 A;  2HRY A;  3MCQ A;  4NUT A;  2Q1X A;  4YJ3 A;  3CPW F;  3TD4 A;  3VI6 A;  3RYH A;  1QD9 A;  1Q86 H;  5MN4 A;  2UYJ A;  5G4U C;  3ZO8 A;  2CWJ A;  5JQG B;  3TD5 A;  2OZB A;  3PAF A;  2QTP A;  2QA4 F;  3JAW B;  2IAF A;  4O4L B;  1RLG A;  1XBI A;  3CCQ F;  5GAP K;  4I55 B;  5J2T B;  1IV1 A;  1Q7Y H;  3KHN A;  1KNJ A;  1OAP A;  3T80 A;  1W57 A;  1Q8R A;  4IHJ B;  3TD3 A;  1X7O A;  1YJ9 F;  1E7K A;  3E20 B;  2HS4 A;  3V7Q A;  2OTJ F;  2PHN A;  3J81 M;  2VAW A;  2QEX F;  2I6D A;  5EO3 A;  2RHH A;  3N4Y A;  5LXT B;  2KGW A;  2HQS C;  3R0P A;  3JAL A;  2H8C A;  3OBW A;  3WXM B;  5GON B;  4KWE A;  5EIB D;  2HVY D;  3HJW C;  3RA6 A;  5GIP C;  1W2B F;  2VAM A;  4ZHQ B;  2KG4 A;  2GLZ A;  5EZY B;  5J2U B;  1KD1 H;  3F0D A;  4BVS A;  4O4I A;  3CXC F;  1U3L A;  4C8G A;  3VYT C;  4RQO A;  3J80 M;  2UYN B;  2JNB A;  3NVI B;  5JCO C;  3NMU C;  1U40 A;  3CYP B;  4TV9 A;  2UYK A;  1R1M A;  3VOB A;  3I55 F;  2IQQ A;  4EI9 A;  4DXD A;  2YXZ A;  4HNA B;  3U0O A;  3HKB B;  2CSL A;  3C9U A;  5JH7 B;  1K8A H;  5IT9 M;  2R75 1;  4EB6 B;  1Z5V A;  5BMV B;  3CCU F;  1YGY A;  3CCJ F;  5FLX M;  3VIU A;  5FJ4 C;  4RHA A;  4B5C A;  5EYP A;  1SZQ A;  1YIJ F;  1NJI H;  1GZ0 A;  3QTY A;  1VQO F;  3CME F;  4I50 A;  1NQ3 A;  5LA6 B;  4BY9 D;  3ZOP A;  4ZI7 A;  1RA4 A;  3JAS B;  5HY1 A;  2LBX A;  3K14 A;  3NK7 A;  2W8B C;  5HY4 A;  2OTL F;  4DRX A;  1M1K H;  4IIJ B;  3PLA C;  4G4W A;  5HY0 A;  2HS0 A;  2UZH A;  4I55 A;  3SIU A;  4BT5 A;  3JAR A;  5KX5 B;  4IIJ A;  3JAM M;  5MN6 A;  2KTU A;  1VQ6 F;  4FFB A;  3UT5 A;  1H7M A;  2R6R 1;  5HXU A;  5FNV A;  4R40 B;  1Q82 H;  1OFU A;  3JAK B;  3JVH A;  3N2K B;  4NQ3 A;  2B33 A;  2ZVY A;  2BO1 A;  5GIN C;  3ERN A;  4X20 B;  5EYP B;  3IKE A;  3CCS F;  5KMG B;  3N2K A;  4I4T B;  1U43 A;  3CCL F;  4ZHW A;  2AIZ P;  1VQV A;  3OON A;  1VQK F;  4G4V A;  2OTM A;  1X25 A;  5EWR A;  4C4W C;  4TZZ A;  2UYN A;  3E22 B;  4TUY A;  5HP7 A;  5IJ0 A;  3J7A R;  3WGL A;  5JVD B;  5GAN K;  3I56 F;  4BW0 B;  4EI8 A;  4X20 A;  5HY2 A;  2H6L A;  3IKF A;  1YIT F;  1JJ2 F;  1VH8 A;  3RYH B;  1RQ2 A;  3HKD A;  3LDT A;  2V9Y A;  5IJ9 B;  3GHZ A;  1FFX B;  3MQW A;  1K9M H;  2QI2 A;  1IV4 A;  1J7H A;  3F0F A;  2CHT A;  4G4X A;  3B6N A;  5J2T A;  3NK6 A;  4U3J A;  1SDS A;  1DT9 A;  4O2B B;  3V7E A;  2RHJ A;  4BT3 A;  3WJQ A;  5LP6 A;  2HP0 A;  4E6E A;  3SIV A;  4F6R A;  2KTV A;  3VMF B;  3K12 A;  2LCA A;  3RYC B;  2IG8 A;  4B62 A;  4LCK A;  3F0G A;  4HNA A;  3N4Z A;  1VQ4 F;  5JH7 A;  5LXT A;  4LNU A;  3GYQ A;  2NMU A;  4M8I A;  4YJ3 B;  2RHO A;  3QUW A;  3C9T A;  1TUB A;  3LWO C;  1W40 A;  3C8L A;  1JN1 A;  1VHA A;  3HWU A;  5HP8 A;  4X1Y A;  4YJ2 A;  3M1X A;  1PF5 A;  2FC3 A;  3LME A;  4ERH A;  2ZF8 A;  5B8F A;  4C8E A;  3K0T A;  4XCQ A;  1SA0 A;  3WJR A;  1TVK B;  5EAZ A;  5LOV B;  4TV8 A;  1W5B A;  5EB1 B;  3VYS C; 
#chains in the Genus database with same CATH homology
 2LCA A;  2LBT A;  3S0H A;  4B62 A;  3CYQ A;  4PWT A;  3S06 A;  3S0Y A;  2MQE A;  4R40 B;  4ZHY B;  3S02 A;  4RHA A;  2L26 A;  4B5C A;  3KHN A;  1OAP A;  3WPW A;  2ZVY A;  3S0W A;  4G4X A;  4ZHV A;  3TD3 A;  3TD4 A;  3CYP B;  4ERH A;  2ZF8 A;  4G4Z A;  4ZHW A;  2W8B C;  2N48 A;  1R1M A;  2K1S A;  3IMP A;  4G4Y A;  2AIZ P;  4G88 A;  3TD5 A;  2ZOV A;  4G4W A;  5EB0 A;  5EAZ A;  3OON A;  3WPX A;  3S03 A;  3LDT A;  2KGW A;  5EB1 B;  2HQS C;  4G4V A;  2ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...