3CCMF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccmF00
3NVKE 2OHWA 1CK2A 1PXWA 2JNBA 1XBIA 3CD6F 1VQ6F 2KG4A 3CCLF 1W41A 1YI2F 1H7MA 3LFOA 5IT9M 1YJWF 1W40A 3IR9A 3NK6A 1VQ4F 3PLAC 1JJ2F 1VQMF 1W2BF 3OW2F 3GYQA 3CCVF 1X52A 2LBWA 3WXMB 2AIFA 3LWRC 5GIOC 5EWRA 2QI2A 1VQ8F 3CXCF 1ZWZA 3E20B 1M1KH 3JCMM 1SDSA 4LCKA 1W42A 5G4VC 1VQOF 1VQPF 1YHQF 2QEXF 2I6DA 1K73H 2HVYD 3N4YA 1GZ0A 3LWQC 3CCSF 1YJ9F 2QA4F 5FJ4C 1GO1A 3CC4F 1DT9A 1VQ7F 3G71F 3ON1A 4NUTA 1YITF 3G4SF 3CCJF 3O85A 3I55F 1T0KB 3VI6A 3HJWC 3NVIB 2CZWA 2WALA 4BY9D 1QVGF 1VQNF 1K8AH 1YIJF 4TZZA 4X3LA 1QVFF 1K9MH 1X7PA 5FLXM 2OTLF 3JAMM 3NK7A 3CG6A 5GINC 2ALEA 3LWVC 3LWPC 5GANK 3CCUF 3I56F 1N8RH 3SIUA 4X3MA 3VMFB 1CN7A 2OZBA 3N4ZA 3LWOC 1X7OA 3J81M 3RA6A 1VQLF 3AGKA 3E1YA 5G4UC 3J80M 3SIVA 3CCMF 1GO0A 5A2QM 1VQ9F 2OTJF 5DCVA 5GIPC 1Q82H 1RA4A 4C4WC 3RA5A 1YJNF 1W3EX 1VQ5F 3V7EA 1KQSF 1S72F 4BW0B 1VQKF 1NJIH 3HAXD 2BO1A 5GAPK 3OBYA 3CC2F 1Q81H 2VGNA 1M90H 1E7KA 1Q7YH 3G6EF 1Q86H 2KTUA 3CC7F 2LBXA 3PAFA 3CPQA 2FC3A 1IPAA 1KD1H 3OBWA 1NMUB 3NMUC 2KTVA 2VGMA 3CCEF 3FFMA 3MCAB 3CMEF 3CPWF 3CMAF 1KC8H 3V7QA 1RLGA 3J7AR 3CCRF 5EO3A 3CCQF
chains in the Genus database with same CATH superfamily
2R6R1 3CD6F 5KMGA 4DRXB 3JATB 5HWEA 1W40A 3K2XA 3JASB 2NMUA 3IR9A 5IJ9B 1VQ4F 3WGNA 1W5BA 2P6YA 4BVQA 1Z5WA 5GIOC 5EWRA 1ZWZA 3JCMM 3P4EA 2EWCA 1R1MA 2ZVYA 4G4ZA 4I50A 4I55B 5G4VC 3K12A 5IJ0A 2I6DA 3JARB 2HVYD 3N4YA 4ZHYB 3C9TA 2Q1XA 3LWQC 1QAHA 3S0YA 2RHHA 2ZAUA 5C8YA 5CA1B 4TUYB 1YITF 3B6NA 1T0KB 3UT5B 3NVIB 5J2UA 2CZWA 1QVGF 3S02A 1W5AA 1JFFB 4X3LA 4I4TB 5FLXM 2OTLF 3E22B 3NK7A 4R40B 5CA0B 5BMVA 3ZP7A 3FPIA 3KJJA 2CHTA 5GONA 3CCUF 3BYQA 3IKEA 1N8RH 2QTPA 4BT5A 4X3MA 4ERHA 1W55A 1IV2A 4C82A 5AVMA 4O2AA 5J2TA 3SIVA 3CCMF 2HP0B 1TUBA 3MCQA 2OTJF 5DCVA 4G4XA 3S03A 3HKCB 4X20B 1YJNF 3KHNA 1VQ5F 4TV9A 5FNVB 5EB0A 4NWOB 3HAXD 5GAPK 3JAKB 3OBYA 5EZYA 2VGNA 1H48A 1M90H 2LBTA 1IV4A 1Q86H 2HS4A 1Z5VA 3TD3A 2I6RA 3JALA 1NMUB 1YQNA 1H47A 3CYPB 2UYNB 2AMTA 1VH8A 2L26A 3D54A 5HXUA 3RYHB 2LCAA 3CMAF 3VYUC 3HKBB 3V7QA 5IYZA 5HP7A 3ZOPA 5LOVB 3KIZA 5EO3A 2G9IA 1U3LA 3CCQF 1ONIA 5KX5A 2OHWA 1CK2A 2HS3A 2HS0A 5KMGB 2KG4A 3HKDB 3JVHA 1W41A 1YI2F 3I7TA 3C9RA 3VTIC 2RHOA 3RYIA 5IT9M 1YJWF 2Z01A 3RYFB 4G88A 4LNUB 1J7HA 1IV1A 1W2BF 3GYQA 1RQ7A 4O4IA 1X52A 2LBWA 4YJ3A 2AIFA 3WXMB 4B46A 1FFXB 1TVKA 1KNJA 4PWTA 4C8GA 3K14A 2QI2A 1CLIA 3V4DA 2H6LA 3KE1A 5JH7B 4LCKA 1W42A 1VQPF 4U39A 2GVIA 5IJ0B 1K73H 5JVDA 2RHLA 1GZ0A 4ZK7A 2QA4F 2KGWA 3K0TA 4M8IA 4EB6B 1DT9A 1VQ7F 3ON1A 2BTUA 4C81A 3IEQA 3O85A 4ZOLB 3I55F 4F6RB 5LYJA 4DXDA 5HXZA 2BTQB 1U40A 4O4HB 1K9MH 3F0EA 2VAMA 3WPXA 3JAMM 2ALEA 5JCOA 5BMVB 5GONB 3VYSC 1SA0B 4IHJA 1COMA 3VMFB 1JN1A 3N4ZA 3WPWA 1X7OA 5JCOC 1VQLF 5B8FA 3E1YA 2OTMA 3J80M 1GX1A 4KWEA 3WGMA 1TUBB 1W5FA 4C4WC 1W581 3N2KA 4ZI7B 4O4LB 4HNAA 1W3EX 4RQOA 2DT4A 3V7EA 4TV9B 3WGKA 1NJIH 4BVSA 3RYCB 2BO1A 1XV2A 3CC2F 2K1SA 1E7KA 2N48A 5JQGB 2CHSA 4X1IB 2R751 4DRXA 3PAFA 3JATA 1KD1H 2VXYA 4X1KA 5IJ9A 2V9YA 2KTVA 3QTYA 2GLZA 3MDOA 3P0ZA 4TV8B 3FFMA 1PF5A 4E6EA 3CPWF 3VOBA 1KC8H 2Z1FA 4O4JA 2H8CA 1RLGA 5HY4A 3N2GB 4X1YB 1OFUA 1NQ3A 3NVKE 1PXWA 1IV3A 4U3JA 1XHOA 1VQ6F 1FNJA 4EI9A 1OAPA 3F0GA 5CA1A 4TUYA 4YJ2A 1H7MA 3LFOA 2HX0A 4O2BB 3UT5A 4BT4A 2YXZA 1VQMF 3F0DA 3OW2F 5ITZA 3CCVF 3L7QA 4BT7A 4YJ3B 4I4TA 3LWRC 3JAWA 3E22A 5CA0A 4BT6A 2H8EA 1M1KH 1RQ2A 1ODEA 1VQOF 5MN6A 1YHQF 3ERNA 3GHZA 5LXTA 4BVTA 3CCSF 1YJ9F 5FJ4C 1GO1A 3F6MA 4B62A 2ZVZA 1FNKA 4NUTA 3VO8A 3VYTC 1UI9A 4WBNA 3DC2A 3CCJF 5HY2A 1T0AA 3HKCA 4X20A 2WALA 4BY9D 1VQNF 3R0PA 2CSLA 3S06A 5FNVA 4ZHVA 1X7PA 4FFBA 1SZQA 3CG6A 3JAKA 5GINC 3HKEA 4NQ3A 4I50B 2DYYA 1VHAA 4IHJB 4ZHQA 3SIUA 2UYPA 5LA6A 3J81M 3RA6A 4BT3A 4IIJA 3ZO8A 3AGKA 3C9UA 3M1XA 5C8YB 2IQQA 2UYNA 2GZLA 3FD6A 3FD5A 5A2QM 2CW4A 2RB9A 4B45A 5EYPA 5GIPC 2Z1TA 1Q82H 5HY1A 3RA5A 1VK3A 3IMPA 5J2UB 3N2KB 5CB4A 3HKBA 1JY8A 3WGLA 1S72F 2UYKA 4BW0B 1VQKF 2IG8A 2Z1EA 2UYJA 3MQWA 2YYEA 1DBFA 3OONA 2FGYA 3HKDA 3WGJA 2LBXA 3VOAA 1IPAA 5LP6A 1Q8RA 3RYFA 4X1KB 4LNUA 4O2AB 5J2TB 3S0HA 5EAZA 1U43A 3D00A 5LP6C 2VAPA 2CWJA 1FFXA 2HQSC 3MCAB 3CMEF 2HP3A 1W5EA 2Q1YA 3WJRA 4O4JB 5JH7A 4RHAA 2F9ZC 2HRYA 4EI8A 3I3FA 5MN5A 5EZYB 3C9SA 2JNBA 1XBIA 3D01A 4U3JB 4EB6A 3CCLF 4B5CA 2HRUA 3QUWA 3V3TA 4BT2A 3WJQA 4YJ2B 4G4YA 3JALB 1W57A 3JASA 1KNKA 3NK6A 3CYQA 2UZHA 4ZOLA 4F6RA 1VQVA 3PLAC 3FBAA 1JJ2F 1X25A 2ZF8A 5ITZB 2ZODA 5EB1B 4BVRA 1W59A 4O4HA 3T80A 3JAWB 1VQ8F 3CXCF 3E20B 5IYZB 2ZOVA 3HTNA 1SDSA 4I55A 3ESJA 1QU9A 3GTZA 1SA0A 3JARA 5LXTB 2QEXF 5KX5B 2B33A 3EORA 3CC4F 3G71F 3M4SA 3VCZA 4WBNB 3RYIB 3G4SF 2CVLA 2IAFA 3TD5A 2Z1UA 1XRGA 3VI6A 3HJWC 4ZI7A 4O4LA 1U3PA 3C8LA 2PHNA 1K8AH 1YIJF 4O4IB 1JFFA 4TZZA 1QVFF 4FFBB 1TVKB 3RYCA 3LWVC 3HKEB 3LWPC 3IEWA 5GANK 1JD1A 3U0OA 5EIBD 5JQGA 3I56F 2PMPA 4X1IA 3M84A 5JVDB 4ZHQB 1CN7A 2OZBA 5LA6B 1QD9A 2AIZP 4C8EA 3LWOC 3ZP4A 3LDTA 3LYBA 1YGYA 4IIJB 4G4WA 3KJKA 4XCQA 5G4UC 2HP0A 2VAWA 4G4VA 1GO0A 3CB2A 4ZHWA 1VQ9F 3MBMA 5EYPB 1RA4A 4TV8A 5LYJB 5CB4B 4EI7A 4C8IA 5HY0A 3TD4A 5MN4A 1KQSF 3N2GA 4X1YA 3LMEA 3Q8HA 1Q81H 1Q7YH 3G6EF 2KTUA 5EIBC 3CC7F 3ELCA 1RLUA 3CPQA 2FC3A 1UFYA 5LP6B 2MQEA 4O2BA 3OBWA 3VIUA 2BTOA 3DDNA 3NMUC 2W8BC 2VGMA 5HP8A 3CCEF 3HWUA 3RYHA 4HNAB 2RHJA 3QHDA 3S0WA 3F0FA 3P10A 3J7AR 5LOVA 3CCRF 3IKFA 3RE3A 1FSZA 3WJPA
chains in the Genus database with same CATH topology
3NVKE 2OHWA 1CK2A 1PXWA 2JNBA 1XBIA 3CD6F 1VQ6F 2KG4A 3CCLF 1W41A 4EI9A 1YI2F 3V3TA 1H7MA 3LFOA 5IT9M 5HWEA 1YJWF 1W40A 3IR9A 3NK6A 1VQ4F 3PLAC 1JJ2F 1VQMF 1W2BF 3OW2F 3GYQA 3CCVF 1X52A 4BVRA 2LBWA 3WXMB 2AIFA 3LWRC 4BVQA 5GIOC 5EWRA 2QI2A 1VQ8F 3CXCF 1ZWZA 3E20B 1M1KH 3JCMM 1SDSA 4LCKA 1W42A 5G4VC 1VQOF 1VQPF 1YHQF 2QEXF 2I6DA 1K73H 2HVYD 3N4YA 1GZ0A 4BVTA 3LWQC 3CCSF 1YJ9F 2QA4F 5FJ4C 1GO1A 3CC4F 1DT9A 1VQ7F 3G71F 3ON1A 4NUTA 1YITF 3G4SF 3CCJF 3O85A 5HY2A 3I55F 1T0KB 3VI6A 3HJWC 3NVIB 2CZWA 2WALA 4BY9D 1QVGF 1VQNF 5HXZA 1K8AH 1YIJF 4TZZA 4X3LA 1QVFF 1K9MH 1X7PA 5FLXM 2OTLF 3JAMM 3NK7A 3CG6A 5GINC 2ALEA 3LWVC 3LWPC 4NQ3A 5GANK 3CCUF 3I56F 1N8RH 3SIUA 4X3MA 3VMFB 1CN7A 2OZBA 3N4ZA 3LWOC 1X7OA 3J81M 3RA6A 1VQLF 3AGKA 3E1YA 4XCQA 5G4UC 3J80M 3SIVA 3CCMF 1GO0A 5A2QM 1VQ9F 2OTJF 5DCVA 5GIPC 1Q82H 1RA4A 4C4WC 5HY1A 3RA5A 1YJNF 1W3EX 1VQ5F 4EI7A 5HY0A 3V7EA 1KQSF 1S72F 4BW0B 1VQKF 1NJIH 4BVSA 3HAXD 2BO1A 5GAPK 3OBYA 3CC2F 1Q81H 2VGNA 1M90H 1E7KA 1Q7YH 3G6EF 2FGYA 1Q86H 2KTUA 3CC7F 2LBXA 3PAFA 3CPQA 2FC3A 1IPAA 1KD1H 3OBWA 1NMUB 3NMUC 2KTVA 2VGMA 3D00A 2GLZA 3CCEF 3FFMA 5HXUA 3MCAB 3CMEF 3CPWF 3CMAF 1KC8H 3V7QA 1RLGA 5HY4A 3J7AR 3CCRF 5EO3A 2F9ZC 4EI8A 3CCQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVK E;  2OHW A;  1CK2 A;  1PXW A;  2JNB A;  1XBI A;  3CD6 F;  1VQ6 F;  2KG4 A;  3CCL F;  1W41 A;  1YI2 F;  1H7M A;  3LFO A;  5IT9 M;  1YJW F;  1W40 A;  3IR9 A;  3NK6 A;  1VQ4 F;  3PLA C;  1JJ2 F;  1VQM F;  1W2B F;  3OW2 F;  3GYQ A;  3CCV F;  1X52 A;  2LBW A;  3WXM B;  2AIF A;  3LWR C;  5GIO C;  5EWR A;  2QI2 A;  1VQ8 F;  3CXC F;  1ZWZ A;  3E20 B;  1M1K H;  3JCM M;  1SDS A;  4LCK A;  1W42 A;  5G4V C;  1VQO F;  1VQP F;  1YHQ F;  2QEX F;  2I6D A;  1K73 H;  2HVY D;  3N4Y A;  1GZ0 A;  3LWQ C;  3CCS F;  1YJ9 F;  2QA4 F;  5FJ4 C;  1GO1 A;  3CC4 F;  1DT9 A;  1VQ7 F;  3G71 F;  3ON1 A;  4NUT A;  1YIT F;  3G4S F;  3CCJ F;  3O85 A;  3I55 F;  1T0K B;  3VI6 A;  3HJW C;  3NVI B;  2CZW A;  2WAL A;  4BY9 D;  1QVG F;  1VQN F;  1K8A H;  1YIJ F;  4TZZ A;  4X3L A;  1QVF F;  1K9M H;  1X7P A;  5FLX M;  2OTL F;  3JAM M;  3NK7 A;  3CG6 A;  5GIN C;  2ALE A;  3LWV C;  3LWP C;  5GAN K;  3CCU F;  3I56 F;  1N8R H;  3SIU A;  4X3M A;  3VMF B;  1CN7 A;  2OZB A;  3N4Z A;  3LWO C;  1X7O A;  3J81 M;  3RA6 A;  1VQL F;  3AGK A;  3E1Y A;  5G4U C;  3J80 M;  3SIV A;  3CCM F;  1GO0 A;  5A2Q M;  1VQ9 F;  2OTJ F;  5DCV A;  5GIP C;  1Q82 H;  1RA4 A;  4C4W C;  3RA5 A;  1YJN F;  1W3E X;  1VQ5 F;  3V7E A;  1KQS F;  1S72 F;  4BW0 B;  1VQK F;  1NJI H;  3HAX D;  2BO1 A;  5GAP K;  3OBY A;  3CC2 F;  1Q81 H;  2VGN A;  1M90 H;  1E7K A;  1Q7Y H;  3G6E F;  1Q86 H;  2KTU A;  3CC7 F;  2LBX A;  3PAF A;  3CPQ A;  2FC3 A;  1IPA A;  1KD1 H;  3OBW A;  1NMU B;  3NMU C;  2KTV A;  2VGM A;  3CCE F;  3FFM A;  3MCA B;  3CME F;  3CPW F;  3CMA F;  1KC8 H;  3V7Q A;  1RLG A;  3J7A R;  3CCR F;  5EO3 A;  3CCQ F; 
#chains in the Genus database with same CATH topology
 2R6R 1;  3CD6 F;  5KMG A;  4DRX B;  3JAT B;  5HWE A;  1W40 A;  3K2X A;  3JAS B;  2NMU A;  3IR9 A;  5IJ9 B;  1VQ4 F;  3WGN A;  1W5B A;  2P6Y A;  4BVQ A;  1Z5W A;  5GIO C;  5EWR A;  1ZWZ A;  3JCM M;  3P4E A;  2EWC A;  1R1M A;  2ZVY A;  4G4Z A;  4I50 A;  4I55 B;  5G4V C;  3K12 A;  5IJ0 A;  2I6D A;  3JAR B;  2HVY D;  3N4Y A;  4ZHY B;  3C9T A;  2Q1X A;  3LWQ C;  1QAH A;  3S0Y A;  2RHH A;  2ZAU A;  5C8Y A;  5CA1 B;  4TUY B;  1YIT F;  3B6N A;  1T0K B;  3UT5 B;  3NVI B;  5J2U A;  2CZW A;  1QVG F;  3S02 A;  1W5A A;  1JFF B;  4X3L A;  4I4T B;  5FLX M;  2OTL F;  3E22 B;  3NK7 A;  4R40 B;  5CA0 B;  5BMV A;  3ZP7 A;  3FPI A;  3KJJ A;  2CHT A;  5GON A;  3CCU F;  3BYQ A;  3IKE A;  1N8R H;  2QTP A;  4BT5 A;  4X3M A;  4ERH A;  1W55 A;  1IV2 A;  4C82 A;  5AVM A;  4O2A A;  5J2T A;  3SIV A;  3CCM F;  2HP0 B;  1TUB A;  3MCQ A;  2OTJ F;  5DCV A;  4G4X A;  3S03 A;  3HKC B;  4X20 B;  1YJN F;  3KHN A;  1VQ5 F;  4TV9 A;  5FNV B;  5EB0 A;  4NWO B;  3HAX D;  5GAP K;  3JAK B;  3OBY A;  5EZY A;  2VGN A;  1H48 A;  1M90 H;  2LBT A;  1IV4 A;  1Q86 H;  2HS4 A;  1Z5V A;  3TD3 A;  2I6R A;  3JAL A;  1NMU B;  1YQN A;  1H47 A;  3CYP B;  2UYN B;  2AMT A;  1VH8 A;  2L26 A;  3D54 A;  5HXU A;  3RYH B;  2LCA A;  3CMA F;  3VYU C;  3HKB B;  3V7Q A;  5IYZ A;  5HP7 A;  3ZOP A;  5LOV B;  3KIZ A;  5EO3 A;  2G9I A;  1U3L A;  3CCQ F;  1ONI A;  5KX5 A;  2OHW A;  1CK2 A;  2HS3 A;  2HS0 A;  5KMG B;  2KG4 A;  3HKD B;  3JVH A;  1W41 A;  1YI2 F;  3I7T A;  3C9R A;  3VTI C;  2RHO A;  3RYI A;  5IT9 M;  1YJW F;  2Z01 A;  3RYF B;  4G88 A;  4LNU B;  1J7H A;  1IV1 A;  1W2B F;  3GYQ A;  1RQ7 A;  4O4I A;  1X52 A;  2LBW A;  4YJ3 A;  2AIF A;  3WXM B;  4B46 A;  1FFX B;  1TVK A;  1KNJ A;  4PWT A;  4C8G A;  3K14 A;  2QI2 A;  1CLI A;  3V4D A;  2H6L A;  3KE1 A;  5JH7 B;  4LCK A;  1W42 A;  1VQP F;  4U39 A;  2GVI A;  5IJ0 B;  1K73 H;  5JVD A;  2RHL A;  1GZ0 A;  4ZK7 A;  2QA4 F;  2KGW A;  3K0T A;  4M8I A;  4EB6 B;  1DT9 A;  1VQ7 F;  3ON1 A;  2BTU A;  4C81 A;  3IEQ A;  3O85 A;  4ZOL B;  3I55 F;  4F6R B;  5LYJ A;  4DXD A;  5HXZ A;  2BTQ B;  1U40 A;  4O4H B;  1K9M H;  3F0E A;  2VAM A;  3WPX A;  3JAM M;  2ALE A;  5JCO A;  5BMV B;  5GON B;  3VYS C;  1SA0 B;  4IHJ A;  1COM A;  3VMF B;  1JN1 A;  3N4Z A;  3WPW A;  1X7O A;  5JCO C;  1VQL F;  5B8F A;  3E1Y A;  2OTM A;  3J80 M;  1GX1 A;  4KWE A;  3WGM A;  1TUB B;  1W5F A;  4C4W C;  1W58 1;  3N2K A;  4ZI7 B;  4O4L B;  4HNA A;  1W3E X;  4RQO A;  2DT4 A;  3V7E A;  4TV9 B;  3WGK A;  1NJI H;  4BVS A;  3RYC B;  2BO1 A;  1XV2 A;  3CC2 F;  2K1S A;  1E7K A;  2N48 A;  5JQG B;  2CHS A;  4X1I B;  2R75 1;  4DRX A;  3PAF A;  3JAT A;  1KD1 H;  2VXY A;  4X1K A;  5IJ9 A;  2V9Y A;  2KTV A;  3QTY A;  2GLZ A;  3MDO A;  3P0Z A;  4TV8 B;  3FFM A;  1PF5 A;  4E6E A;  3CPW F;  3VOB A;  1KC8 H;  2Z1F A;  4O4J A;  2H8C A;  1RLG A;  5HY4 A;  3N2G B;  4X1Y B;  1OFU A;  1NQ3 A;  3NVK E;  1PXW A;  1IV3 A;  4U3J A;  1XHO A;  1VQ6 F;  1FNJ A;  4EI9 A;  1OAP A;  3F0G A;  5CA1 A;  4TUY A;  4YJ2 A;  1H7M A;  3LFO A;  2HX0 A;  4O2B B;  3UT5 A;  4BT4 A;  2YXZ A;  1VQM F;  3F0D A;  3OW2 F;  5ITZ A;  3CCV F;  3L7Q A;  4BT7 A;  4YJ3 B;  4I4T A;  3LWR C;  3JAW A;  3E22 A;  5CA0 A;  4BT6 A;  2H8E A;  1M1K H;  1RQ2 A;  1ODE A;  1VQO F;  5MN6 A;  1YHQ F;  3ERN A;  3GHZ A;  5LXT A;  4BVT A;  3CCS F;  1YJ9 F;  5FJ4 C;  1GO1 A;  3F6M A;  4B62 A;  2ZVZ A;  1FNK A;  4NUT A;  3VO8 A;  3VYT C;  1UI9 A;  4WBN A;  3DC2 A;  3CCJ F;  5HY2 A;  1T0A A;  3HKC A;  4X20 A;  2WAL A;  4BY9 D;  1VQN F;  3R0P A;  2CSL A;  3S06 A;  5FNV A;  4ZHV A;  1X7P A;  4FFB A;  1SZQ A;  3CG6 A;  3JAK A;  5GIN C;  3HKE A;  4NQ3 A;  4I50 B;  2DYY A;  1VHA A;  4IHJ B;  4ZHQ A;  3SIU A;  2UYP A;  5LA6 A;  3J81 M;  3RA6 A;  4BT3 A;  4IIJ A;  3ZO8 A;  3AGK A;  3C9U A;  3M1X A;  5C8Y B;  2IQQ A;  2UYN A;  2GZL A;  3FD6 A;  3FD5 A;  5A2Q M;  2CW4 A;  2RB9 A;  4B45 A;  5EYP A;  5GIP C;  2Z1T A;  1Q82 H;  5HY1 A;  3RA5 A;  1VK3 A;  3IMP A;  5J2U B;  3N2K B;  5CB4 A;  3HKB A;  1JY8 A;  3WGL A;  1S72 F;  2UYK A;  4BW0 B;  1VQK F;  2IG8 A;  2Z1E A;  2UYJ A;  3MQW A;  2YYE A;  1DBF A;  3OON A;  2FGY A;  3HKD A;  3WGJ A;  2LBX A;  3VOA A;  1IPA A;  5LP6 A;  1Q8R A;  3RYF A;  4X1K B;  4LNU A;  4O2A B;  5J2T B;  3S0H A;  5EAZ A;  1U43 A;  3D00 A;  5LP6 C;  2VAP A;  2CWJ A;  1FFX A;  2HQS C;  3MCA B;  3CME F;  2HP3 A;  1W5E A;  2Q1Y A;  3WJR A;  4O4J B;  5JH7 A;  4RHA A;  2F9Z C;  2HRY A;  4EI8 A;  3I3F A;  5MN5 A;  5EZY B;  3C9S A;  2JNB A;  1XBI A;  3D01 A;  4U3J B;  4EB6 A;  3CCL F;  4B5C A;  2HRU A;  3QUW A;  3V3T A;  4BT2 A;  3WJQ A;  4YJ2 B;  4G4Y A;  3JAL B;  1W57 A;  3JAS A;  1KNK A;  3NK6 A;  3CYQ A;  2UZH A;  4ZOL A;  4F6R A;  1VQV A;  3PLA C;  3FBA A;  1JJ2 F;  1X25 A;  2ZF8 A;  5ITZ B;  2ZOD A;  5EB1 B;  4BVR A;  1W59 A;  4O4H A;  3T80 A;  3JAW B;  1VQ8 F;  3CXC F;  3E20 B;  5IYZ B;  2ZOV A;  3HTN A;  1SDS A;  4I55 A;  3ESJ A;  1QU9 A;  3GTZ A;  1SA0 A;  3JAR A;  5LXT B;  2QEX F;  5KX5 B;  2B33 A;  3EOR A;  3CC4 F;  3G71 F;  3M4S A;  3VCZ A;  4WBN B;  3RYI B;  3G4S F;  2CVL A;  2IAF A;  3TD5 A;  2Z1U A;  1XRG A;  3VI6 A;  3HJW C;  4ZI7 A;  4O4L A;  1U3P A;  3C8L A;  2PHN A;  1K8A H;  1YIJ F;  4O4I B;  1JFF A;  4TZZ A;  1QVF F;  4FFB B;  1TVK B;  3RYC A;  3LWV C;  3HKE B;  3LWP C;  3IEW A;  5GAN K;  1JD1 A;  3U0O A;  5EIB D;  5JQG A;  3I56 F;  2PMP A;  4X1I A;  3M84 A;  5JVD B;  4ZHQ B;  1CN7 A;  2OZB A;  5LA6 B;  1QD9 A;  2AIZ P;  4C8E A;  3LWO C;  3ZP4 A;  3LDT A;  3LYB A;  1YGY A;  4IIJ B;  4G4W A;  3KJK A;  4XCQ A;  5G4U C;  2HP0 A;  2VAW A;  4G4V A;  1GO0 A;  3CB2 A;  4ZHW A;  1VQ9 F;  3MBM A;  5EYP B;  1RA4 A;  4TV8 A;  5LYJ B;  5CB4 B;  4EI7 A;  4C8I A;  5HY0 A;  3TD4 A;  5MN4 A;  1KQS F;  3N2G A;  4X1Y A;  3LME A;  3Q8H A;  1Q81 H;  1Q7Y H;  3G6E F;  2KTU A;  5EIB C;  3CC7 F;  3ELC A;  1RLU A;  3CPQ A;  2FC3 A;  1UFY A;  5LP6 B;  2MQE A;  4O2B A;  3OBW A;  3VIU A;  2BTO A;  3DDN A;  3NMU C;  2W8B C;  2VGM A;  5HP8 A;  3CCE F;  3HWU A;  3RYH A;  4HNA B;  2RHJ A;  3QHD A;  3S0W A;  3F0F A;  3P10 A;  3J7A R;  5LOV A;  3CCR F;  3IKF A;  3RE3 A;  1FSZ A;  3WJP A; 
#chains in the Genus database with same CATH homology
 3NVK E;  2OHW A;  1CK2 A;  1PXW A;  2JNB A;  1XBI A;  3CD6 F;  1VQ6 F;  2KG4 A;  3CCL F;  1W41 A;  4EI9 A;  1YI2 F;  3V3T A;  1H7M A;  3LFO A;  5IT9 M;  5HWE A;  1YJW F;  1W40 A;  3IR9 A;  3NK6 A;  1VQ4 F;  3PLA C;  1JJ2 F;  1VQM F;  1W2B F;  3OW2 F;  3GYQ A;  3CCV F;  1X52 A;  4BVR A;  2LBW A;  3WXM B;  2AIF A;  3LWR C;  4BVQ A;  5GIO C;  5EWR A;  2QI2 A;  1VQ8 F;  3CXC F;  1ZWZ A;  3E20 B;  1M1K H;  3JCM M;  1SDS A;  4LCK A;  1W42 A;  5G4V C;  1VQO F;  1VQP F;  1YHQ F;  2QEX F;  2I6D A;  1K73 H;  2HVY D;  3N4Y A;  1GZ0 A;  4BVT A;  3LWQ C;  3CCS F;  1YJ9 F;  2QA4 F;  5FJ4 C;  1GO1 A;  3CC4 F;  1DT9 A;  1VQ7 F;  3G71 F;  3ON1 A;  4NUT A;  1YIT F;  3G4S F;  3CCJ F;  3O85 A;  5HY2 A;  3I55 F;  1T0K B;  3VI6 A;  3HJW C;  3NVI B;  2CZW A;  2WAL A;  4BY9 D;  1QVG F;  1VQN F;  5HXZ A;  1K8A H;  1YIJ F;  4TZZ A;  4X3L A;  1QVF F;  1K9M H;  1X7P A;  5FLX M;  2OTL F;  3JAM M;  3NK7 A;  3CG6 A;  5GIN C;  2ALE A;  3LWV C;  3LWP C;  4NQ3 A;  5GAN K;  3CCU F;  3I56 F;  1N8R H;  3SIU A;  4X3M A;  3VMF B;  1CN7 A;  2OZB A;  3N4Z A;  3LWO C;  1X7O A;  3J81 M;  3RA6 A;  1VQL F;  3AGK A;  3E1Y A;  4XCQ A;  5G4U C;  3J80 M;  3SIV A;  3CCM F;  1GO0 A;  5A2Q M;  1VQ9 F;  2OTJ F;  5DCV A;  5GIP C;  1Q82 H;  1RA4 A;  4C4W C;  5HY1 A;  3RA5 A;  1YJN F;  1W3E X;  1VQ5 F;  4EI7 A;  5HY0 A;  3V7E A;  1KQS F;  1S72 F;  4BW0 B;  1VQK F;  1NJI H;  4BVS A;  3HAX D;  2BO1 A;  5GAP K;  3OBY A;  3CC2 F;  1Q81 H;  2VGN A;  1M90 H;  1E7K A;  1Q7Y H;  3G6E F;  2FGY A;  1Q86 H;  2KTU A;  3CC7 F;  2LBX A;  3PAF A;  3CPQ A;  2FC3 A;  1IPA A;  1KD1 H;  3OBW A;  1NMU B;  3NMU C;  2KTV A;  2VGM A;  3D00 A;  2GLZ A;  3CCE F;  3FFM A;  5HXU A;  3MCA B;  3CME F;  3CPW F;  3CMA F;  1KC8 H;  3V7Q A;  1RLG A;  5HY4 A;  3J7A R;  3CCR F;  5EO3 A;  2F9Z C;  4EI8 A;  3CCQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...