3CCMF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccmF00
3VMFB 3E20B 1IPAA 3CD6F 3OW2F 1M90H 3E1YA 2VGMA 1H7MA 1K8AH 2LBXA 2OTJF 2OTLF 3N4YA 3NK6A 5EWRA 3CCLF 5GAPK 3GYQA 5G4UC 1W3EX 1VQ6F 1QVGF 2AIFA 3G6EF 1YITF 1GO0A 2LBWA 1YJ9F 2QEXF 1W41A 3CPQA 3NK7A 3G71F 3CPWF 3I56F 1N8RH 4C4WC 1X7PA 1SDSA 3N4ZA 2OZBA 5GIOC 5DCVA 3NVKE 1YJWF 3LWQC 3CG6A 5GANK 1Q86H 2CZWA 2JNBA 3CCJF 3RA5A 2KTUA 3LWOC 5FLXM 1RLGA 3IR9A 4BY9D 3LWPC 2QA4F 5EO3A 3J7AR 3NVIB 3V7EA 3O85A 3HAXD 1XBIA 4BW0B 3MCAB 1E7KA 2KG4A 2OHWA 2KTVA 1KD1H 1QVFF 1NJIH 1T0KB 3V7QA 5GINC 1VQKF 1X52A 1Q82H 2WALA 3WXMB 1NMUB 5GIPC 1K9MH 3AGKA 3RA6A 3JAMM 1JJ2F 3PLAC 1VQMF 3CCUF 2FC3A 1CN7A 3VI6A 1VQ4F 1VQ9F 1W2BF 1M1KH 2HVYD 3ON1A 3CMAF 3OBWA 3CCQF 1YI2F 3CC4F 4LCKA 3CCRF 5G4VC 1YJNF 4NUTA 4TZZA 1YIJF 1X7OA 1S72F 1Q81H 3SIVA 3I55F 3LWVC 3SIUA 3J80M 1KC8H 1ZWZA 1VQLF 4X3LA 1K73H 2I6DA 3HJWC 3CCSF 5FJ4C 1VQ7F 3CXCF 1GO1A 1GZ0A 3NMUC 3G4SF 3FFMA 2ALEA 5A2QM 1PXWA 3PAFA 2QI2A 3JCMM 3LWRC 3CCVF 1VQ5F 2BO1A 3CC2F 1YHQF 1Q7YH 1W40A 1CK2A 3J81M 5IT9M 1VQ8F 3CMEF 1DT9A 1RA4A 3OBYA 3CCMF 2VGNA 1VQNF 1VQOF 4X3MA 3CC7F 1VQPF 1W42A 3CCEF 3LFOA 1KQSF
chains in the Genus database with same CATH superfamily
4BT3A 3CYPB 3I3FA 2H8CA 2QTPA 3CD6F 2CWJA 3K2XA 4R40B 3OW2F 3E1YA 2VGMA 4IIJB 4BVSA 4YJ3B 3N2KA 1H7MA 3I7TA 3WGNA 2LBXA 2OTJF 3WPXA 3N4YA 3JARA 5GAPK 3GYQA 1W3EX 1QVGF 2ZVZA 3VOAA 5J2UA 1Z5VA 3DC2A 5LA6A 3RYCA 3HKCA 3N2KB 1N8RH 3I56F 1FNKA 1Z5WA 4RHAA 5GIOC 3JARB 5CA0A 3RYIA 3NVKE 3HTNA 1COMA 3EORA 5J2UB 3IKEA 4X1IA 3S02A 3HKEA 3F0DA 5LA6B 4EI9A 3RYCB 3HKCB 3DDNA 2R6R1 2CZWA 2JNBA 3CCJF 2KTUA 5CA0B 3LWPC 2HQSC 3RYIB 3J7AR 1FFXA 4X1IB 3HKEB 3MDOA 2ZODA 3O85A 4YJ2A 2ZF8A 5B8FA 3S03A 2GLZA 1E7KA 4E6EA 4TV9A 1FFXB 3WGLA 3RYFA 5GINC 3VOBA 4YJ2B 2PHNA 3HKBA 4X1KB 2GVIA 1NMUB 3JAMM 4IHJA 1U40A 2FC3A 2GZLA 4TV9B 3VIUA 4BVQA 3CCUF 2G9IA 3RYFB 1M1KH 1W5EA 3S0WA 5JCOA 1U3PA 2RB9A 3HKBB 4RQOA 4G4XA 2CSLA 3WPWA 4LCKA 4IHJB 3S0YA 2DYYA 2CHTA 1NQ3A 2ZAUA 1Q81H 3GHZA 5EB1B 3WGJA 1JY8A 4XCQA 1ZWZA 1IV1A 2N48A 1X25A 3C8LA 1IV3A 5EB0A 3HJWC 1ODEA 2MQEA 3CCSF 4LNUA 3F0EA 2CW4A 4G4ZA 1GZ0A 4ERHA 3FFMA 4O2AA 2ALEA 3PAFA 1CLIA 2QI2A 3K12A 1U3LA 5HY2A 2P6YA 4PWTA 1IV4A 4LNUB 3V4DA 1VQ8F 3CMEF 1DT9A 1RQ7A 2YYEA 3JVHA 4O2AB 4O4LA 2NMUA 2LBTA 4O4HA 3HKDA 2VAPA 3CCMF 2VGNA 2UYJA 2PMPA 4O2BA 1Q8RA 1XV2A 2ZOVA 2Z1EA 4O4LB 3VO8A 1OFUA 4O4HB 3HKDB 4O2BB 2OTLF 3NK6A 5J2TA 3OONA 3G6EF 1GO0A 1ONIA 2LBWA 5GONA 1VQVA 1YJ9F 4M8IA 4NWOB 2QEXF 1W41A 3CPQA 3NK7A 3G71F 3CPWF 2BTQB 3F0GA 3N4ZA 5J2TB 2VAWA 1YJWF 2KGWA 3D54A 1W5BA 5GONB 5JVDA 2R751 1W5AA 3UT5A 2LCAA 5LXTA 2HP0A 2QA4F 2OTMA 5JVDB 2HS0A 4EI8A 2CHSA 4BW0B 3S0HA 3MCAB 3WJRA 3UT5B 5BMVA 2KG4A 1KD1H 4C8EA 1NJIH 5LXTB 1W57A 2HP0B 2L26A 3VYTC 5JCOC 2CVLA 1X52A 2HRUA 2BTOA 2WALA 1W55A 3K14A 1SA0A 3RA6A 5BMVB 4C8IA 3RYHA 1OAPA 1JJ2F 4WBNA 2UYPA 2HP3A 1VQ4F 1W2BF 5HWEA 1RQ2A 4G4WA 3CMAF 5JQGA 1YI2F 1SA0B 1T0AA 3VYSC 3RYHB 4BVTA 3GTZA 3RE3A 1YJNF 4WBNB 1X7OA 1S72F 3SIVA 1IV2A 4O4IA 3LWVC 5JQGB 3TD4A 1VQLF 4X3LA 2I6DA 3V3TA 4ZK7A 4EI7A 3ERNA 1GO1A 4O4IB 3CYQA 3ESJA 1H47A 3G4SF 3FD5A 3NMUC 3QTYA 1J7HA 2B33A 3CCVF 1VQ5F 2BO1A 3CC2F 1JD1A 3C9TA 3J81M 3K0TA 3OBYA 3FPIA 4X3MA 1W5FA 1VQPF 3WJQA 1KQSF 3VMFB 4B5CA 3TD5A 4NQ3A 3P0ZA 5MN6A 5HP7A 5G4UC 5EZYA 3VTIC 3M84A 3MBMA 5EYPA 4C4WC 1X7PA 4KWEA 1SDSA 5LP6A 1XRGA 4ZHWA 5DCVA 5EZYB 4I4TA 5EIBD 4BT2A 3CG6A 4TV8A 5GANK 2Q1XA 3JAWA 2RHHA 5HY4A 5HXUA 1Q86H 5EYPB 4B46A 4X20A 1W59A 1GX1A 5LP6B 3KHNA 3IR9A 4BY9D 3E22A 3S06A 3M1XA 4BT5A 5AVMA 3HWUA 4I4TB 3WJPA 3V7EA 4TV8B 3HAXD 3JAWB 2F9ZC 1XBIA 4X20B 3CB2A 4ZHVA 1PF5A 3KE1A 3E22B 3B6NA 4B62A 1T0KB 1VQKF 5EIBC 4B45A 5HY0A 5CB4A 3WXMB 1Q82H 4I55A 5GIPC 1K9MH 3FBAA 3QHDA 3VI6A 3WGKA 1JN1A 5CB4B 3Q8HA 2HVYD 4I55B 3OBWA 2V9YA 3T80A 3ELCA 3CC4F 1U43A 3CCRF 2HS3A 5ITZA 2AIZP 2FGYA 1YGYA 1DBFA 3ZP7A 4NUTA 4TZZA 1YIJF 2UYKA 1FNJA 3SIUA 3J80M 2AMTA 1KC8H 5ITZB 5FJ4C 3ZOPA 4U3JA 1VQ7F 3CXCF 5A2QM 1PXWA 4HNAA 4C81A 4X1YA 3C9SA 3LWRC 3IEQA 3IEWA 3JATA 3FD6A 1Q7YH 1UFYA 4U3JB 4BT4A 5MN4A 5IT9M 1VK3A 1XHOA 4HNAB 4X1YB 5EAZA 3C9UA 1VQOF 2Z01A 3CC7F 3BYQA 3JATB 1W42A 3CCEF 1YITF 3VCZA 4DXDA 3LDTA 2IAFA 3F0FA 3TD3A 3E20B 5FNVA 1UI9A 1IPAA 3D01A 2K1SA 5JH7A 5C8YA 3U0OA 2IG8A 5LOVA 1M90H 5LYJA 1R1MA 2RHOA 1K8AH 5LP6C 4ZI7A 2HS4A 4ZOLA 1RLUA 5EWRA 3CCLF 5FNVB 3MQWA 4X1KA 1VQ6F 2YXZA 2IQQA 4FFBA 5JH7B 2AIFA 5C8YB 3N2GA 5LOVB 5LYJB 5IJ0A 2HRYA 3R0PA 5IJ9A 4C8GA 4ZI7B 4ZOLB 3JAKA 2OZBA 3IMPA 4EB6A 1TUBA 4F6RA 4FFBB 3N2GB 5KX5A 3LWQC 1KNKA 3JASA 5IJ0B 3F6MA 4I50A 5IJ9B 2Z1UA 3RA5A 3JAKB 3LWOC 1RLGA 5FLXM 1YQNA 2VAMA 4EB6B 1TUBB 4F6RB 5EO3A 3C9RA 3NVIB 5KX5B 3JASB 4BT7A 4I50B 1SZQA 2UZHA 3KJJA 4BT6A 2OHWA 2KTVA 1QVFF 1QD9A 1KNJA 3KJKA 2RHLA 3V7QA 2H8EA 2Q1YA 4BVRA 4TUYA 5MN5A 4DRXA 3AGKA 1H48A 5CA1A 3PLAC 1VQMF 1TVKA 1CN7A 3L7QA 4G4VA 4O4JA 2EWCA 1VQ9F 3LMEA 3ZO8A 4G88A 3M4SA 3ON1A 1QAHA 2UYNA 4TUYB 3VYUC 4DRXB 3CCQF 5CA1B 3LYBA 5G4VC 1TVKB 3WGMA 4O4JB 3IKFA 3ZP4A 5HP8A 4C82A 2I6RA 3I55F 3KIZA 1VH8A 5IYZA 3P4EA 1VHAA 2UYNB 2Z1TA 3JALA 2Z1FA 1K73H 5HXZA 4ZHYB 3D00A 2ZVYA 5HY1A 2BTUA 5IYZB 1JFFA 3MCQA 3JALB 3JCMM 3P10A 4U39A 1W581 1YHQF 1W40A 4ZHQA 2H6LA 5KMGA 2DT4A 1CK2A 1FSZA 1JFFB 1RA4A 1QU9A 1VQNF 2W8BC 2HX0A 4IIJA 2VXYA 4YJ3A 2RHJA 3QUWA 4ZHQB 4G4YA 5KMGB 3LFOA
chains in the Genus database with same CATH topology
3VMFB 3E20B 1IPAA 3CD6F 3OW2F 4NQ3A 1M90H 3E1YA 2VGMA 4BVSA 1H7MA 1K8AH 2LBXA 2OTJF 2OTLF 3N4YA 3NK6A 5EWRA 3CCLF 5GAPK 3GYQA 5G4UC 1W3EX 1VQ6F 1QVGF 2AIFA 3G6EF 1YITF 1GO0A 2LBWA 1YJ9F 2QEXF 1W41A 3CPQA 3NK7A 3G71F 3CPWF 3I56F 1N8RH 4C4WC 1X7PA 1SDSA 3N4ZA 2OZBA 5GIOC 5DCVA 3NVKE 1YJWF 3LWQC 3CG6A 4EI9A 5GANK 5HY4A 5HXUA 1Q86H 2CZWA 2JNBA 3CCJF 3RA5A 2KTUA 3LWOC 5FLXM 1RLGA 3IR9A 4BY9D 3LWPC 2QA4F 5EO3A 3J7AR 3NVIB 3V7EA 3O85A 3HAXD 2F9ZC 4EI8A 1XBIA 4BW0B 2GLZA 3MCAB 1E7KA 2KG4A 2OHWA 2KTVA 1KD1H 1QVFF 1NJIH 1T0KB 3V7QA 5GINC 1VQKF 1X52A 5HY0A 2WALA 3WXMB 4BVRA 1Q82H 1NMUB 5GIPC 1K9MH 3AGKA 3RA6A 3JAMM 1JJ2F 3PLAC 1VQMF 3CCUF 2FC3A 4BVQA 1CN7A 3VI6A 1VQ4F 1VQ9F 1W2BF 1M1KH 5HWEA 2HVYD 3ON1A 3CMAF 3OBWA 3CCQF 1YI2F 3CC4F 4LCKA 3CCRF 2FGYA 4BVTA 5G4VC 1YJNF 4NUTA 4TZZA 1YIJF 1X7OA 1S72F 1Q81H 3SIVA 3I55F 3LWVC 3SIUA 4XCQA 3J80M 1KC8H 1ZWZA 1VQLF 4X3LA 1K73H 5HXZA 3D00A 2I6DA 3HJWC 3CCSF 5FJ4C 3V3TA 4EI7A 1VQ7F 5HY1A 1GO1A 3CXCF 1GZ0A 3NMUC 3G4SF 3FFMA 2ALEA 5A2QM 1PXWA 3PAFA 2QI2A 3JCMM 3LWRC 5HY2A 3CCVF 1VQ5F 2BO1A 3CC2F 1YHQF 1Q7YH 1W40A 1CK2A 3J81M 5IT9M 1VQ8F 3CMEF 1DT9A 1RA4A 3OBYA 3CCMF 2VGNA 1VQNF 1VQOF 4X3MA 3CC7F 1VQPF 1W42A 3CCEF 3LFOA 1KQSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMF B;  3E20 B;  1IPA A;  3CD6 F;  3OW2 F;  1M90 H;  3E1Y A;  2VGM A;  1H7M A;  1K8A H;  2LBX A;  2OTJ F;  2OTL F;  3N4Y A;  3NK6 A;  5EWR A;  3CCL F;  5GAP K;  3GYQ A;  5G4U C;  1W3E X;  1VQ6 F;  1QVG F;  2AIF A;  3G6E F;  1YIT F;  1GO0 A;  2LBW A;  1YJ9 F;  2QEX F;  1W41 A;  3CPQ A;  3NK7 A;  3G71 F;  3CPW F;  3I56 F;  1N8R H;  4C4W C;  1X7P A;  1SDS A;  3N4Z A;  2OZB A;  5GIO C;  5DCV A;  3NVK E;  1YJW F;  3LWQ C;  3CG6 A;  5GAN K;  1Q86 H;  2CZW A;  2JNB A;  3CCJ F;  3RA5 A;  2KTU A;  3LWO C;  5FLX M;  1RLG A;  3IR9 A;  4BY9 D;  3LWP C;  2QA4 F;  5EO3 A;  3J7A R;  3NVI B;  3V7E A;  3O85 A;  3HAX D;  1XBI A;  4BW0 B;  3MCA B;  1E7K A;  2KG4 A;  2OHW A;  2KTV A;  1KD1 H;  1QVF F;  1NJI H;  1T0K B;  3V7Q A;  5GIN C;  1VQK F;  1X52 A;  1Q82 H;  2WAL A;  3WXM B;  1NMU B;  5GIP C;  1K9M H;  3AGK A;  3RA6 A;  3JAM M;  1JJ2 F;  3PLA C;  1VQM F;  3CCU F;  2FC3 A;  1CN7 A;  3VI6 A;  1VQ4 F;  1VQ9 F;  1W2B F;  1M1K H;  2HVY D;  3ON1 A;  3CMA F;  3OBW A;  3CCQ F;  1YI2 F;  3CC4 F;  4LCK A;  3CCR F;  5G4V C;  1YJN F;  4NUT A;  4TZZ A;  1YIJ F;  1X7O A;  1S72 F;  1Q81 H;  3SIV A;  3I55 F;  3LWV C;  3SIU A;  3J80 M;  1KC8 H;  1ZWZ A;  1VQL F;  4X3L A;  1K73 H;  2I6D A;  3HJW C;  3CCS F;  5FJ4 C;  1VQ7 F;  3CXC F;  1GO1 A;  1GZ0 A;  3NMU C;  3G4S F;  3FFM A;  2ALE A;  5A2Q M;  1PXW A;  3PAF A;  2QI2 A;  3JCM M;  3LWR C;  3CCV F;  1VQ5 F;  2BO1 A;  3CC2 F;  1YHQ F;  1Q7Y H;  1W40 A;  1CK2 A;  3J81 M;  5IT9 M;  1VQ8 F;  3CME F;  1DT9 A;  1RA4 A;  3OBY A;  3CCM F;  2VGN A;  1VQN F;  1VQO F;  4X3M A;  3CC7 F;  1VQP F;  1W42 A;  3CCE F;  3LFO A;  1KQS F; 
#chains in the Genus database with same CATH topology
 4BT3 A;  3CYP B;  3I3F A;  2H8C A;  2QTP A;  3CD6 F;  2CWJ A;  3K2X A;  4R40 B;  3OW2 F;  3E1Y A;  2VGM A;  4IIJ B;  4BVS A;  4YJ3 B;  3N2K A;  1H7M A;  3I7T A;  3WGN A;  2LBX A;  2OTJ F;  3WPX A;  3N4Y A;  3JAR A;  5GAP K;  3GYQ A;  1W3E X;  1QVG F;  2ZVZ A;  3VOA A;  5J2U A;  1Z5V A;  3DC2 A;  5LA6 A;  3RYC A;  3HKC A;  3N2K B;  1N8R H;  3I56 F;  1FNK A;  1Z5W A;  4RHA A;  5GIO C;  3JAR B;  5CA0 A;  3RYI A;  3NVK E;  3HTN A;  1COM A;  3EOR A;  5J2U B;  3IKE A;  4X1I A;  3S02 A;  3HKE A;  3F0D A;  5LA6 B;  4EI9 A;  3RYC B;  3HKC B;  3DDN A;  2R6R 1;  2CZW A;  2JNB A;  3CCJ F;  2KTU A;  5CA0 B;  3LWP C;  2HQS C;  3RYI B;  3J7A R;  1FFX A;  4X1I B;  3HKE B;  3MDO A;  2ZOD A;  3O85 A;  4YJ2 A;  2ZF8 A;  5B8F A;  3S03 A;  2GLZ A;  1E7K A;  4E6E A;  4TV9 A;  1FFX B;  3WGL A;  3RYF A;  5GIN C;  3VOB A;  4YJ2 B;  2PHN A;  3HKB A;  4X1K B;  2GVI A;  1NMU B;  3JAM M;  4IHJ A;  1U40 A;  2FC3 A;  2GZL A;  4TV9 B;  3VIU A;  4BVQ A;  3CCU F;  2G9I A;  3RYF B;  1M1K H;  1W5E A;  3S0W A;  5JCO A;  1U3P A;  2RB9 A;  3HKB B;  4RQO A;  4G4X A;  2CSL A;  3WPW A;  4LCK A;  4IHJ B;  3S0Y A;  2DYY A;  2CHT A;  1NQ3 A;  2ZAU A;  1Q81 H;  3GHZ A;  5EB1 B;  3WGJ A;  1JY8 A;  4XCQ A;  1ZWZ A;  1IV1 A;  2N48 A;  1X25 A;  3C8L A;  1IV3 A;  5EB0 A;  3HJW C;  1ODE A;  2MQE A;  3CCS F;  4LNU A;  3F0E A;  2CW4 A;  4G4Z A;  1GZ0 A;  4ERH A;  3FFM A;  4O2A A;  2ALE A;  3PAF A;  1CLI A;  2QI2 A;  3K12 A;  1U3L A;  5HY2 A;  2P6Y A;  4PWT A;  1IV4 A;  4LNU B;  3V4D A;  1VQ8 F;  3CME F;  1DT9 A;  1RQ7 A;  2YYE A;  3JVH A;  4O2A B;  4O4L A;  2NMU A;  2LBT A;  4O4H A;  3HKD A;  2VAP A;  3CCM F;  2VGN A;  2UYJ A;  2PMP A;  4O2B A;  1Q8R A;  1XV2 A;  2ZOV A;  2Z1E A;  4O4L B;  3VO8 A;  1OFU A;  4O4H B;  3HKD B;  4O2B B;  2OTL F;  3NK6 A;  5J2T A;  3OON A;  3G6E F;  1GO0 A;  1ONI A;  2LBW A;  5GON A;  1VQV A;  1YJ9 F;  4M8I A;  4NWO B;  2QEX F;  1W41 A;  3CPQ A;  3NK7 A;  3G71 F;  3CPW F;  2BTQ B;  3F0G A;  3N4Z A;  5J2T B;  2VAW A;  1YJW F;  2KGW A;  3D54 A;  1W5B A;  5GON B;  5JVD A;  2R75 1;  1W5A A;  3UT5 A;  2LCA A;  5LXT A;  2HP0 A;  2QA4 F;  2OTM A;  5JVD B;  2HS0 A;  4EI8 A;  2CHS A;  4BW0 B;  3S0H A;  3MCA B;  3WJR A;  3UT5 B;  5BMV A;  2KG4 A;  1KD1 H;  4C8E A;  1NJI H;  5LXT B;  1W57 A;  2HP0 B;  2L26 A;  3VYT C;  5JCO C;  2CVL A;  1X52 A;  2HRU A;  2BTO A;  2WAL A;  1W55 A;  3K14 A;  1SA0 A;  3RA6 A;  5BMV B;  4C8I A;  3RYH A;  1OAP A;  1JJ2 F;  4WBN A;  2UYP A;  2HP3 A;  1VQ4 F;  1W2B F;  5HWE A;  1RQ2 A;  4G4W A;  3CMA F;  5JQG A;  1YI2 F;  1SA0 B;  1T0A A;  3VYS C;  3RYH B;  4BVT A;  3GTZ A;  3RE3 A;  1YJN F;  4WBN B;  1X7O A;  1S72 F;  3SIV A;  1IV2 A;  4O4I A;  3LWV C;  5JQG B;  3TD4 A;  1VQL F;  4X3L A;  2I6D A;  3V3T A;  4ZK7 A;  4EI7 A;  3ERN A;  1GO1 A;  4O4I B;  3CYQ A;  3ESJ A;  1H47 A;  3G4S F;  3FD5 A;  3NMU C;  3QTY A;  1J7H A;  2B33 A;  3CCV F;  1VQ5 F;  2BO1 A;  3CC2 F;  1JD1 A;  3C9T A;  3J81 M;  3K0T A;  3OBY A;  3FPI A;  4X3M A;  1W5F A;  1VQP F;  3WJQ A;  1KQS F;  3VMF B;  4B5C A;  3TD5 A;  4NQ3 A;  3P0Z A;  5MN6 A;  5HP7 A;  5G4U C;  5EZY A;  3VTI C;  3M84 A;  3MBM A;  5EYP A;  4C4W C;  1X7P A;  4KWE A;  1SDS A;  5LP6 A;  1XRG A;  4ZHW A;  5DCV A;  5EZY B;  4I4T A;  5EIB D;  4BT2 A;  3CG6 A;  4TV8 A;  5GAN K;  2Q1X A;  3JAW A;  2RHH A;  5HY4 A;  5HXU A;  1Q86 H;  5EYP B;  4B46 A;  4X20 A;  1W59 A;  1GX1 A;  5LP6 B;  3KHN A;  3IR9 A;  4BY9 D;  3E22 A;  3S06 A;  3M1X A;  4BT5 A;  5AVM A;  3HWU A;  4I4T B;  3WJP A;  3V7E A;  4TV8 B;  3HAX D;  3JAW B;  2F9Z C;  1XBI A;  4X20 B;  3CB2 A;  4ZHV A;  1PF5 A;  3KE1 A;  3E22 B;  3B6N A;  4B62 A;  1T0K B;  1VQK F;  5EIB C;  4B45 A;  5HY0 A;  5CB4 A;  3WXM B;  1Q82 H;  4I55 A;  5GIP C;  1K9M H;  3FBA A;  3QHD A;  3VI6 A;  3WGK A;  1JN1 A;  5CB4 B;  3Q8H A;  2HVY D;  4I55 B;  3OBW A;  2V9Y A;  3T80 A;  3ELC A;  3CC4 F;  1U43 A;  3CCR F;  2HS3 A;  5ITZ A;  2AIZ P;  2FGY A;  1YGY A;  1DBF A;  3ZP7 A;  4NUT A;  4TZZ A;  1YIJ F;  2UYK A;  1FNJ A;  3SIU A;  3J80 M;  2AMT A;  1KC8 H;  5ITZ B;  5FJ4 C;  3ZOP A;  4U3J A;  1VQ7 F;  3CXC F;  5A2Q M;  1PXW A;  4HNA A;  4C81 A;  4X1Y A;  3C9S A;  3LWR C;  3IEQ A;  3IEW A;  3JAT A;  3FD6 A;  1Q7Y H;  1UFY A;  4U3J B;  4BT4 A;  5MN4 A;  5IT9 M;  1VK3 A;  1XHO A;  4HNA B;  4X1Y B;  5EAZ A;  3C9U A;  1VQO F;  2Z01 A;  3CC7 F;  3BYQ A;  3JAT B;  1W42 A;  3CCE F;  1YIT F;  3VCZ A;  4DXD A;  3LDT A;  2IAF A;  3F0F A;  3TD3 A;  3E20 B;  5FNV A;  1UI9 A;  1IPA A;  3D01 A;  2K1S A;  5JH7 A;  5C8Y A;  3U0O A;  2IG8 A;  5LOV A;  1M90 H;  5LYJ A;  1R1M A;  2RHO A;  1K8A H;  5LP6 C;  4ZI7 A;  2HS4 A;  4ZOL A;  1RLU A;  5EWR A;  3CCL F;  5FNV B;  3MQW A;  4X1K A;  1VQ6 F;  2YXZ A;  2IQQ A;  4FFB A;  5JH7 B;  2AIF A;  5C8Y B;  3N2G A;  5LOV B;  5LYJ B;  5IJ0 A;  2HRY A;  3R0P A;  5IJ9 A;  4C8G A;  4ZI7 B;  4ZOL B;  3JAK A;  2OZB A;  3IMP A;  4EB6 A;  1TUB A;  4F6R A;  4FFB B;  3N2G B;  5KX5 A;  3LWQ C;  1KNK A;  3JAS A;  5IJ0 B;  3F6M A;  4I50 A;  5IJ9 B;  2Z1U A;  3RA5 A;  3JAK B;  3LWO C;  1RLG A;  5FLX M;  1YQN A;  2VAM A;  4EB6 B;  1TUB B;  4F6R B;  5EO3 A;  3C9R A;  3NVI B;  5KX5 B;  3JAS B;  4BT7 A;  4I50 B;  1SZQ A;  2UZH A;  3KJJ A;  4BT6 A;  2OHW A;  2KTV A;  1QVF F;  1QD9 A;  1KNJ A;  3KJK A;  2RHL A;  3V7Q A;  2H8E A;  2Q1Y A;  4BVR A;  4TUY A;  5MN5 A;  4DRX A;  3AGK A;  1H48 A;  5CA1 A;  3PLA C;  1VQM F;  1TVK A;  1CN7 A;  3L7Q A;  4G4V A;  4O4J A;  2EWC A;  1VQ9 F;  3LME A;  3ZO8 A;  4G88 A;  3M4S A;  3ON1 A;  1QAH A;  2UYN A;  4TUY B;  3VYU C;  4DRX B;  3CCQ F;  5CA1 B;  3LYB A;  5G4V C;  1TVK B;  3WGM A;  4O4J B;  3IKF A;  3ZP4 A;  5HP8 A;  4C82 A;  2I6R A;  3I55 F;  3KIZ A;  1VH8 A;  5IYZ A;  3P4E A;  1VHA A;  2UYN B;  2Z1T A;  3JAL A;  2Z1F A;  1K73 H;  5HXZ A;  4ZHY B;  3D00 A;  2ZVY A;  5HY1 A;  2BTU A;  5IYZ B;  1JFF A;  3MCQ A;  3JAL B;  3JCM M;  3P10 A;  4U39 A;  1W58 1;  1YHQ F;  1W40 A;  4ZHQ A;  2H6L A;  5KMG A;  2DT4 A;  1CK2 A;  1FSZ A;  1JFF B;  1RA4 A;  1QU9 A;  1VQN F;  2W8B C;  2HX0 A;  4IIJ A;  2VXY A;  4YJ3 A;  2RHJ A;  3QUW A;  4ZHQ B;  4G4Y A;  5KMG B;  3LFO A; 
#chains in the Genus database with same CATH homology
 3VMF B;  3E20 B;  1IPA A;  3CD6 F;  3OW2 F;  4NQ3 A;  1M90 H;  3E1Y A;  2VGM A;  4BVS A;  1H7M A;  1K8A H;  2LBX A;  2OTJ F;  2OTL F;  3N4Y A;  3NK6 A;  5EWR A;  3CCL F;  5GAP K;  3GYQ A;  5G4U C;  1W3E X;  1VQ6 F;  1QVG F;  2AIF A;  3G6E F;  1YIT F;  1GO0 A;  2LBW A;  1YJ9 F;  2QEX F;  1W41 A;  3CPQ A;  3NK7 A;  3G71 F;  3CPW F;  3I56 F;  1N8R H;  4C4W C;  1X7P A;  1SDS A;  3N4Z A;  2OZB A;  5GIO C;  5DCV A;  3NVK E;  1YJW F;  3LWQ C;  3CG6 A;  4EI9 A;  5GAN K;  5HY4 A;  5HXU A;  1Q86 H;  2CZW A;  2JNB A;  3CCJ F;  3RA5 A;  2KTU A;  3LWO C;  5FLX M;  1RLG A;  3IR9 A;  4BY9 D;  3LWP C;  2QA4 F;  5EO3 A;  3J7A R;  3NVI B;  3V7E A;  3O85 A;  3HAX D;  2F9Z C;  4EI8 A;  1XBI A;  4BW0 B;  2GLZ A;  3MCA B;  1E7K A;  2KG4 A;  2OHW A;  2KTV A;  1KD1 H;  1QVF F;  1NJI H;  1T0K B;  3V7Q A;  5GIN C;  1VQK F;  1X52 A;  5HY0 A;  2WAL A;  3WXM B;  4BVR A;  1Q82 H;  1NMU B;  5GIP C;  1K9M H;  3AGK A;  3RA6 A;  3JAM M;  1JJ2 F;  3PLA C;  1VQM F;  3CCU F;  2FC3 A;  4BVQ A;  1CN7 A;  3VI6 A;  1VQ4 F;  1VQ9 F;  1W2B F;  1M1K H;  5HWE A;  2HVY D;  3ON1 A;  3CMA F;  3OBW A;  3CCQ F;  1YI2 F;  3CC4 F;  4LCK A;  3CCR F;  2FGY A;  4BVT A;  5G4V C;  1YJN F;  4NUT A;  4TZZ A;  1YIJ F;  1X7O A;  1S72 F;  1Q81 H;  3SIV A;  3I55 F;  3LWV C;  3SIU A;  4XCQ A;  3J80 M;  1KC8 H;  1ZWZ A;  1VQL F;  4X3L A;  1K73 H;  5HXZ A;  3D00 A;  2I6D A;  3HJW C;  3CCS F;  5FJ4 C;  3V3T A;  4EI7 A;  1VQ7 F;  5HY1 A;  1GO1 A;  3CXC F;  1GZ0 A;  3NMU C;  3G4S F;  3FFM A;  2ALE A;  5A2Q M;  1PXW A;  3PAF A;  2QI2 A;  3JCM M;  3LWR C;  5HY2 A;  3CCV F;  1VQ5 F;  2BO1 A;  3CC2 F;  1YHQ F;  1Q7Y H;  1W40 A;  1CK2 A;  3J81 M;  5IT9 M;  1VQ8 F;  3CME F;  1DT9 A;  1RA4 A;  3OBY A;  3CCM F;  2VGN A;  1VQN F;  1VQO F;  4X3M A;  3CC7 F;  1VQP F;  1W42 A;  3CCE F;  3LFO A;  1KQS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...