3CCMF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccmF00
1YHQF 1QVGF 5GIOC 3CXCF 3G6EF 3OBYA 3CC7F 3NMUC 1YIJF 1K8AH 3G71F 3V7QA 1VQNF 1W41A 3CCVF 5G4VC 1W2BF 3IR9A 3CMAF 3CCUF 1E7KA 1CN7A 2OTLF 1X7OA 1K9MH 3HAXD 1VQMF 5FLXM 3CD6F 3V7EA 3J80M 3CPWF 4NUTA 3PAFA 3NVIB 3NK7A 5EWRA 3HJWC 1PXWA 2KG4A 5GANK 5A2QM 3VI6A 1KD1H 5GAPK 3SIUA 2QEXF 1YI2F 1IPAA 3CC4F 3J7AR 1W42A 1VQ9F 1KQSF 3LWPC 4C4WC 1YITF 2KTUA 3I55F 3ON1A 3GYQA 3RA5A 1VQ4F 4BY9D 2LBWA 3JCMM 3O85A 2ALEA 1M1KH 1YJWF 2FC3A 1VQ6F 1GO1A 2VGNA 1W3EX 1W40A 4BW0B 1KC8H 3LWRC 3CCJF 1VQ8F 2BO1A 2KTVA 1VQ5F 3JAMM 5FJ4C 3J81M 3CCEF 1Q86H 1YJ9F 2QI2A 1VQPF 1GZ0A 5GINC 1RA4A 1M90H 3E20B 3LWOC 1T0KB 3CCMF 2AIFA 5DCVA 3RA6A 1X52A 3AGKA 3N4YA 3NK6A 3MCAB 3PLAC 2OTJF 1H7MA 2VGMA 1CK2A 2JNBA 3CPQA 3LWVC 1VQKF 1XBIA 1NJIH 1S72F 3CMEF 1N8RH 3CCLF 2WALA 1YJNF 1DT9A 1VQ7F 2LBXA 5G4UC 3E1YA 2QA4F 5EO3A 1JJ2F 3I56F 3CCRF 1VQLF 4TZZA 2HVYD 2OZBA 2CZWA 3FFMA 3CCQF 3SIVA 1VQOF 1Q82H 3N4ZA 1GO0A 1QVFF 3NVKE 1X7PA 3OW2F 3CC2F 1K73H 3WXMB 3OBWA 4LCKA 1Q81H 1Q7YH 5GIPC 2I6DA 3CCSF 3LWQC 3LFOA 3G4SF 1SDSA 5IT9M 2OHWA 4X3LA 4X3MA 1RLGA 3CG6A 3VMFB 1NMUB 1ZWZA
chains in the Genus database with same CATH superfamily
1TVKA 2Z1EA 2HQSC 3QUWA 1QVGF 3D00A 3JAKB 5J2UA 3OBYA 4O2AA 1U3PA 3CC7F 4O4LB 1YIJF 2CVLA 5LP6C 1K8AH 2KGWA 1QU9A 2N48A 5GONB 3VIUA 3CCVF 5G4VC 5ITZA 1KNKA 1W55A 3F0DA 3RYFB 2G9IA 3WJPA 2OTLF 4I50B 1DBFA 1VHAA 2CWJA 3IEWA 3T80A 3IKEA 1XRGA 2UYKA 3ZP7A 1SA0A 4NUTA 3PAFA 3NVIB 3HJWC 2KG4A 5A2QM 4RQOA 5GAPK 1OFUA 4X1KB 4FFBA 5IJ9A 1IPAA 4X1YA 3J7AR 1W42A 2UYJA 1IV4A 1FFXA 1H47A 5KMGA 3VOAA 3S03A 1FNJA 1U3LA 4G4YA 4B5CA 3M4SA 3GYQA 1VQ4F 2LBWA 5IYZB 3RYIA 3P4EA 1CLIA 4YJ3A 4ZHVA 1VQ6F 2K1SA 4ZI7A 2RHHA 1W40A 1FNKA 3OONA 4IIJB 5CB4B 1W59A 3JASA 3HKEA 2LCAA 5FJ4C 2MQEA 3CCEF 5JH7B 2QI2A 2HX0A 1RA4A 1Z5WA 2H6LA 4EI7A 3LWOC 5LP6B 4G4ZA 2H8EA 4BT6A 2BTUA 4HNAA 5MN5A 3S0YA 2VXYA 1JD1A 4YJ3B 3VYTC 2JNBA 1VQKF 3HKCB 1N8RH 3CCLF 2PHNA 4IIJA 3WPXA 5G4UC 3E1YA 2IAFA 3UT5B 4X1IB 3C8LA 1JJ2F 3F0EA 3IEQA 3VYUC 3HKDA 1VQLF 3FFMA 3WJRA 2ZVZA 2H8CA 2Z1FA 3P0ZA 5HY4A 1QVFF 1PF5A 4BVTA 1Q7YH 1TVKB 5LOVA 5HP7A 3CCSF 4X1KA 1JFFB 2L26A 2HRYA 3JVHA 2OHWA 4TUYA 4ZI7B 5IT9M 1X25A 5EYPB 3RYIB 2ZVYA 3WGLA 4EB6A 4U39A 3GTZA 2ZODA 5GONA 4O4JB 3G71F 1VQNF 1OAPA 1JY8A 1RLUA 4ERHA 3IR9A 4O2AB 3CMAF 1CN7A 1JFFA 5JCOA 1X7OA 5LYJA 5JVDB 1VQMF 4X1IA 3N2KA 2ZF8A 1W5AA 2YXZA 3CPWF 2RB9A 3S02A 3ZOPA 1PXWA 4XCQA 1R1MA 2AIZP 1YI2F 1H48A 4O4LA 1VQ9F 5JQGA 5HY1A 4F6RA 2RHLA 2RHOA 3KJKA 4IHJA 5FNVB 3I55F 3RA5A 3BYQA 4BY9D 5CA1B 2R751 5CA0B 2I6RA 1VK3A 4TV9A 2ALEA 1M1KH 2ZOVA 3M84A 1YJWF 1VH8A 2VGNA 4RHAA 1W3EX 1VQ8F 4I55A 2B33A 5IYZA 2BO1A 2HP0B 2Z1TA 5EAZA 2AMTA 1VQVA 3LYBA 1YJ9F 3JALA 4C8IA 5LP6A 1VQPF 1GZ0A 4DRXB 1T0KB 2V9YA 5J2TA 2UYNB 3F0FA 4ZHQA 2IG8A 1W5EA 5BMVB 1NQ3A 3CB2A 3CYQA 5C8YB 3F0GA 5LXTB 3MCAB 2OTJF 3MCQA 2UYNA 3VOBA 2FGYA 1H7MA 1TUBB 1XHOA 3RE3A 2VGMA 1FSZA 3P10A 1NJIH 3V3TA 2WALA 1SA0B 4ZOLB 5EIBC 5J2UB 4TUYB 4G4VA 5EO3A 3I56F 4KWEA 3I3FA 5LOVB 1JN1A 5HXUA 4TZZA 2HVYD 4BVRA 1VQOF 1T0AA 3N4ZA 1GO0A 3NVKE 1X7PA 4EI9A 1K73H 3WXMB 5LXTA 1Q81H 1W5FA 3ERNA 1W581 1QAHA 1RQ2A 2I6DA 3LWQC 3LFOA 3G4SF 1SDSA 4I50A 4I4TB 3LDTA 5ITZB 2LBTA 3HKBB 1ZWZA 5EZYB 3JARB 5LA6B 3RYHB 1YHQF 3CXCF 4O2BB 4C8EA 5KX5A 3NMUC 2EWCA 1UFYA 3MBMA 2CHTA 2Q1YA 3K2XA 2IQQA 3KE1A 4I55B 3RYCA 1W41A 3K14A 4WBNB 4X20B 3CCUF 1E7KA 3HKEB 3HKBA 4O4JA 1K9MH 3HAXD 3KJJA 5CA1A 3I7TA 4BT4A 5AVMA 3CD6F 3V7EA 3J80M 2OTMA 3WGMA 2BTOA 2Q1XA 5EWRA 3VI6A 3CC4F 3HTNA 3LWPC 4C4WC 1YITF 2KTUA 3ON1A 3ZP4A 4I4TA 4U3JA 4O4IA 3JCMM 3O85A 4ZHQB 3TD5A 2FC3A 2HS0A 3LMEA 4BW0B 5EYPA 3DDNA 4O4HA 1KC8H 4NWOB 3LWRC 4BT5A 4FFBB 5EZYA 3TD4A 4DRXA 5IJ9B 1J7HA 2KTVA 4BT7A 1VQ5F 2PMPA 3JAWB 4B45A 3KIZA 3K0TA 3K12A 3C9UA 3WPWA 2DT4A 5EIBD 1COMA 1W5BA 5GINC 2Z01A 1M90H 1ODEA 3IKFA 3JAWA 3ELCA 5IJ0A 3JAKA 3Q8HA 4DXDA 2ZAUA 5DCVA 3V4DA 4E6EA 2YYEA 3C9TA 2W8BC 3FPIA 1X52A 3AGKA 2Z1UA 4O4HB 3RA6A 3NK6A 3WGKA 3PLAC 5EB1B 4ZHWA 4O4IB 2UYPA 1CK2A 3CPQA 3LWVC 3HKDB 1S72F 1VQ7F 1UI9A 1YJNF 1DT9A 2LBXA 2GLZA 2QA4F 4TV9B 2CW4A 4LNUB 3HKCA 4G4WA 4ZHYB 2OZBA 3VCZA 5BMVA 5MN6A 3CCQF 2BTQB 4O2BA 3OW2F 3CC2F 3MQWA 3OBWA 1IV1A 3U0OA 3D54A 3JARA 5LA6A 5GIPC 2QTPA 1IV3A 3JALB 4HNAB 1W57A 4M8IA 3C9RA 3RYCB 5JCOC 4X3LA 5HP8A 3N2GB 4X3MA 1RLGA 3CG6A 5JQGB 5LYJB 4LNUA 1NMUB 1YQNA 3N2GA 5GIOC 3G6EF 2NMUA 4X20A 2P6YA 4C82A 5KMGB 3RYFA 4X1YB 3V7QA 1RQ7A 4IHJB 5FNVA 3FBAA 1Q8RA 1W2BF 3B6NA 5KX5B 3JATB 4G88A 5FLXM 2R6R1 1XV2A 3TD3A 3NK7A 2GZLA 3VYSC 5GANK 1KD1H 3SIUA 2UZHA 2QEXF 3S06A 3IMPA 5JVDA 1KQSF 1GX1A 1Z5VA 4BT2A 2VAPA 3WGJA 3ESJA 4ZK7A 1KNJA 5HXZA 3GHZA 2F9ZC 2HS3A 5EB0A 1GO1A 1YGYA 3MDOA 1U43A 4PWTA 4B62A 3WJQA 4EB6B 3CCJF 3WGNA 4ZOLA 2HRUA 4U3JB 2CHSA 5JH7A 2CSLA 3JATA 4YJ2B 3HWUA 1U40A 3D01A 4EI8A 3JAMM 1TUBA 3J81M 5HWEA 1Q86H 2RHJA 5IJ0B 3E20B 3CCMF 2AIFA 4F6RB 2HP3A 3CYPB 5J2TB 3KHNA 3L7QA 3N4YA 4TV8A 4C8GA 3UT5A 3EORA 5CA0A 1FFXB 4BVQA 3M1XA 5CB4A 3E22A 3R0PA 5C8YA 1XBIA 4NQ3A 3CMEF 4C81A 4YJ2A 2DYYA 1QD9A 2VAMA 4BT3A 3QHDA 3S0HA 3CCRF 3E22B 4WBNA 2GVIA 3FD5A 2CZWA 3ZO8A 4G4XA 3VTIC 3SIVA 1Q82H 3N2KB 1SZQA 2HP0A 3F6MA 3DC2A 4TV8B 4LCKA 4BVSA 5HY2A 3FD6A 2VAWA 3VO8A 5MN4A 3C9SA 3RYHA 3QTYA 1ONIA 4B46A 5B8FA 3VMFB 4R40B 3S0WA 5HY0A 1IV2A 2HS4A 3JASB
chains in the Genus database with same CATH topology
1YHQF 1QVGF 3D00A 5GIOC 3CXCF 3G6EF 3OBYA 3CC7F 3NMUC 1YIJF 1K8AH 3G71F 3V7QA 1VQNF 1W41A 3CCVF 5G4VC 1W2BF 3IR9A 3CMAF 3CCUF 1E7KA 1CN7A 2OTLF 1X7OA 1K9MH 3HAXD 1VQMF 5FLXM 3CD6F 3V7EA 3J80M 3CPWF 4NUTA 3PAFA 3NVIB 3NK7A 5EWRA 3HJWC 1PXWA 4XCQA 2KG4A 5A2QM 5GANK 3VI6A 1KD1H 5GAPK 3SIUA 2QEXF 1YI2F 1IPAA 3CC4F 3J7AR 1W42A 1VQ9F 1KQSF 5HY1A 3LWPC 4C4WC 1YITF 2KTUA 3I55F 3ON1A 3GYQA 3RA5A 1VQ4F 4BY9D 2LBWA 5HXZA 3JCMM 2F9ZC 2ALEA 3O85A 1M1KH 1YJWF 2FC3A 1VQ6F 1GO1A 2VGNA 1W3EX 1W40A 4BW0B 1KC8H 3LWRC 3CCJF 1VQ8F 2BO1A 2KTVA 1VQ5F 4EI8A 3JAMM 5FJ4C 3J81M 5HWEA 3CCEF 1Q86H 1YJ9F 2QI2A 1VQPF 1GZ0A 5GINC 1RA4A 1M90H 4EI7A 3E20B 3LWOC 1T0KB 3CCMF 2AIFA 5DCVA 3RA6A 1X52A 3AGKA 3N4YA 3NK6A 3MCAB 3PLAC 2OTJF 2FGYA 1H7MA 2VGMA 4BVQA 1CK2A 2JNBA 3CPQA 3LWVC 1VQKF 1XBIA 1NJIH 3V3TA 4NQ3A 3CMEF 1S72F 3CCLF 2WALA 1YJNF 1DT9A 1N8RH 1VQ7F 2LBXA 5G4UC 3E1YA 2GLZA 2QA4F 5EO3A 1JJ2F 3I56F 3CCRF 1VQLF 5HXUA 4TZZA 2HVYD 2OZBA 2CZWA 3FFMA 4BVRA 3CCQF 3SIVA 1VQOF 1Q82H 3N4ZA 1GO0A 5HY4A 1QVFF 1X7PA 4EI9A 3CC2F 3OW2F 1K73H 3WXMB 3OBWA 3NVKE 1Q81H 4LCKA 4BVTA 4BVSA 5HY2A 1Q7YH 5GIPC 2I6DA 3CCSF 3LWQC 3LFOA 3G4SF 1SDSA 5IT9M 2OHWA 4X3LA 4X3MA 1RLGA 3CG6A 3VMFB 5HY0A 1NMUB 1ZWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ F;  1QVG F;  5GIO C;  3CXC F;  3G6E F;  3OBY A;  3CC7 F;  3NMU C;  1YIJ F;  1K8A H;  3G71 F;  3V7Q A;  1VQN F;  1W41 A;  3CCV F;  5G4V C;  1W2B F;  3IR9 A;  3CMA F;  3CCU F;  1E7K A;  1CN7 A;  2OTL F;  1X7O A;  1K9M H;  3HAX D;  1VQM F;  5FLX M;  3CD6 F;  3V7E A;  3J80 M;  3CPW F;  4NUT A;  3PAF A;  3NVI B;  3NK7 A;  5EWR A;  3HJW C;  1PXW A;  2KG4 A;  5GAN K;  5A2Q M;  3VI6 A;  1KD1 H;  5GAP K;  3SIU A;  2QEX F;  1YI2 F;  1IPA A;  3CC4 F;  3J7A R;  1W42 A;  1VQ9 F;  1KQS F;  3LWP C;  4C4W C;  1YIT F;  2KTU A;  3I55 F;  3ON1 A;  3GYQ A;  3RA5 A;  1VQ4 F;  4BY9 D;  2LBW A;  3JCM M;  3O85 A;  2ALE A;  1M1K H;  1YJW F;  2FC3 A;  1VQ6 F;  1GO1 A;  2VGN A;  1W3E X;  1W40 A;  4BW0 B;  1KC8 H;  3LWR C;  3CCJ F;  1VQ8 F;  2BO1 A;  2KTV A;  1VQ5 F;  3JAM M;  5FJ4 C;  3J81 M;  3CCE F;  1Q86 H;  1YJ9 F;  2QI2 A;  1VQP F;  1GZ0 A;  5GIN C;  1RA4 A;  1M90 H;  3E20 B;  3LWO C;  1T0K B;  3CCM F;  2AIF A;  5DCV A;  3RA6 A;  1X52 A;  3AGK A;  3N4Y A;  3NK6 A;  3MCA B;  3PLA C;  2OTJ F;  1H7M A;  2VGM A;  1CK2 A;  2JNB A;  3CPQ A;  3LWV C;  1VQK F;  1XBI A;  1NJI H;  1S72 F;  3CME F;  1N8R H;  3CCL F;  2WAL A;  1YJN F;  1DT9 A;  1VQ7 F;  2LBX A;  5G4U C;  3E1Y A;  2QA4 F;  5EO3 A;  1JJ2 F;  3I56 F;  3CCR F;  1VQL F;  4TZZ A;  2HVY D;  2OZB A;  2CZW A;  3FFM A;  3CCQ F;  3SIV A;  1VQO F;  1Q82 H;  3N4Z A;  1GO0 A;  1QVF F;  3NVK E;  1X7P A;  3OW2 F;  3CC2 F;  1K73 H;  3WXM B;  3OBW A;  4LCK A;  1Q81 H;  1Q7Y H;  5GIP C;  2I6D A;  3CCS F;  3LWQ C;  3LFO A;  3G4S F;  1SDS A;  5IT9 M;  2OHW A;  4X3L A;  4X3M A;  1RLG A;  3CG6 A;  3VMF B;  1NMU B;  1ZWZ A; 
#chains in the Genus database with same CATH topology
 1TVK A;  2Z1E A;  2HQS C;  3QUW A;  1QVG F;  3D00 A;  3JAK B;  5J2U A;  3OBY A;  4O2A A;  1U3P A;  3CC7 F;  4O4L B;  1YIJ F;  2CVL A;  5LP6 C;  1K8A H;  2KGW A;  1QU9 A;  2N48 A;  5GON B;  3VIU A;  3CCV F;  5G4V C;  5ITZ A;  1KNK A;  1W55 A;  3F0D A;  3RYF B;  2G9I A;  3WJP A;  2OTL F;  4I50 B;  1DBF A;  1VHA A;  2CWJ A;  3IEW A;  3T80 A;  3IKE A;  1XRG A;  2UYK A;  3ZP7 A;  1SA0 A;  4NUT A;  3PAF A;  3NVI B;  3HJW C;  2KG4 A;  5A2Q M;  4RQO A;  5GAP K;  1OFU A;  4X1K B;  4FFB A;  5IJ9 A;  1IPA A;  4X1Y A;  3J7A R;  1W42 A;  2UYJ A;  1IV4 A;  1FFX A;  1H47 A;  5KMG A;  3VOA A;  3S03 A;  1FNJ A;  1U3L A;  4G4Y A;  4B5C A;  3M4S A;  3GYQ A;  1VQ4 F;  2LBW A;  5IYZ B;  3RYI A;  3P4E A;  1CLI A;  4YJ3 A;  4ZHV A;  1VQ6 F;  2K1S A;  4ZI7 A;  2RHH A;  1W40 A;  1FNK A;  3OON A;  4IIJ B;  5CB4 B;  1W59 A;  3JAS A;  3HKE A;  2LCA A;  5FJ4 C;  2MQE A;  3CCE F;  5JH7 B;  2QI2 A;  2HX0 A;  1RA4 A;  1Z5W A;  2H6L A;  4EI7 A;  3LWO C;  5LP6 B;  4G4Z A;  2H8E A;  4BT6 A;  2BTU A;  4HNA A;  5MN5 A;  3S0Y A;  2VXY A;  1JD1 A;  4YJ3 B;  3VYT C;  2JNB A;  1VQK F;  3HKC B;  1N8R H;  3CCL F;  2PHN A;  4IIJ A;  3WPX A;  5G4U C;  3E1Y A;  2IAF A;  3UT5 B;  4X1I B;  3C8L A;  1JJ2 F;  3F0E A;  3IEQ A;  3VYU C;  3HKD A;  1VQL F;  3FFM A;  3WJR A;  2ZVZ A;  2H8C A;  2Z1F A;  3P0Z A;  5HY4 A;  1QVF F;  1PF5 A;  4BVT A;  1Q7Y H;  1TVK B;  5LOV A;  5HP7 A;  3CCS F;  4X1K A;  1JFF B;  2L26 A;  2HRY A;  3JVH A;  2OHW A;  4TUY A;  4ZI7 B;  5IT9 M;  1X25 A;  5EYP B;  3RYI B;  2ZVY A;  3WGL A;  4EB6 A;  4U39 A;  3GTZ A;  2ZOD A;  5GON A;  4O4J B;  3G71 F;  1VQN F;  1OAP A;  1JY8 A;  1RLU A;  4ERH A;  3IR9 A;  4O2A B;  3CMA F;  1CN7 A;  1JFF A;  5JCO A;  1X7O A;  5LYJ A;  5JVD B;  1VQM F;  4X1I A;  3N2K A;  2ZF8 A;  1W5A A;  2YXZ A;  3CPW F;  2RB9 A;  3S02 A;  3ZOP A;  1PXW A;  4XCQ A;  1R1M A;  2AIZ P;  1YI2 F;  1H48 A;  4O4L A;  1VQ9 F;  5JQG A;  5HY1 A;  4F6R A;  2RHL A;  2RHO A;  3KJK A;  4IHJ A;  5FNV B;  3I55 F;  3RA5 A;  3BYQ A;  4BY9 D;  5CA1 B;  2R75 1;  5CA0 B;  2I6R A;  1VK3 A;  4TV9 A;  2ALE A;  1M1K H;  2ZOV A;  3M84 A;  1YJW F;  1VH8 A;  2VGN A;  4RHA A;  1W3E X;  1VQ8 F;  4I55 A;  2B33 A;  5IYZ A;  2BO1 A;  2HP0 B;  2Z1T A;  5EAZ A;  2AMT A;  1VQV A;  3LYB A;  1YJ9 F;  3JAL A;  4C8I A;  5LP6 A;  1VQP F;  1GZ0 A;  4DRX B;  1T0K B;  2V9Y A;  5J2T A;  2UYN B;  3F0F A;  4ZHQ A;  2IG8 A;  1W5E A;  5BMV B;  1NQ3 A;  3CB2 A;  3CYQ A;  5C8Y B;  3F0G A;  5LXT B;  3MCA B;  2OTJ F;  3MCQ A;  2UYN A;  3VOB A;  2FGY A;  1H7M A;  1TUB B;  1XHO A;  3RE3 A;  2VGM A;  1FSZ A;  3P10 A;  1NJI H;  3V3T A;  2WAL A;  1SA0 B;  4ZOL B;  5EIB C;  5J2U B;  4TUY B;  4G4V A;  5EO3 A;  3I56 F;  4KWE A;  3I3F A;  5LOV B;  1JN1 A;  5HXU A;  4TZZ A;  2HVY D;  4BVR A;  1VQO F;  1T0A A;  3N4Z A;  1GO0 A;  3NVK E;  1X7P A;  4EI9 A;  1K73 H;  3WXM B;  5LXT A;  1Q81 H;  1W5F A;  3ERN A;  1W58 1;  1QAH A;  1RQ2 A;  2I6D A;  3LWQ C;  3LFO A;  3G4S F;  1SDS A;  4I50 A;  4I4T B;  3LDT A;  5ITZ B;  2LBT A;  3HKB B;  1ZWZ A;  5EZY B;  3JAR B;  5LA6 B;  3RYH B;  1YHQ F;  3CXC F;  4O2B B;  4C8E A;  5KX5 A;  3NMU C;  2EWC A;  1UFY A;  3MBM A;  2CHT A;  2Q1Y A;  3K2X A;  2IQQ A;  3KE1 A;  4I55 B;  3RYC A;  1W41 A;  3K14 A;  4WBN B;  4X20 B;  3CCU F;  1E7K A;  3HKE B;  3HKB A;  4O4J A;  1K9M H;  3HAX D;  3KJJ A;  5CA1 A;  3I7T A;  4BT4 A;  5AVM A;  3CD6 F;  3V7E A;  3J80 M;  2OTM A;  3WGM A;  2BTO A;  2Q1X A;  5EWR A;  3VI6 A;  3CC4 F;  3HTN A;  3LWP C;  4C4W C;  1YIT F;  2KTU A;  3ON1 A;  3ZP4 A;  4I4T A;  4U3J A;  4O4I A;  3JCM M;  3O85 A;  4ZHQ B;  3TD5 A;  2FC3 A;  2HS0 A;  3LME A;  4BW0 B;  5EYP A;  3DDN A;  4O4H A;  1KC8 H;  4NWO B;  3LWR C;  4BT5 A;  4FFB B;  5EZY A;  3TD4 A;  4DRX A;  5IJ9 B;  1J7H A;  2KTV A;  4BT7 A;  1VQ5 F;  2PMP A;  3JAW B;  4B45 A;  3KIZ A;  3K0T A;  3K12 A;  3C9U A;  3WPW A;  2DT4 A;  5EIB D;  1COM A;  1W5B A;  5GIN C;  2Z01 A;  1M90 H;  1ODE A;  3IKF A;  3JAW A;  3ELC A;  5IJ0 A;  3JAK A;  3Q8H A;  4DXD A;  2ZAU A;  5DCV A;  3V4D A;  4E6E A;  2YYE A;  3C9T A;  2W8B C;  3FPI A;  1X52 A;  3AGK A;  2Z1U A;  4O4H B;  3RA6 A;  3NK6 A;  3WGK A;  3PLA C;  5EB1 B;  4ZHW A;  4O4I B;  2UYP A;  1CK2 A;  3CPQ A;  3LWV C;  3HKD B;  1S72 F;  1VQ7 F;  1UI9 A;  1YJN F;  1DT9 A;  2LBX A;  2GLZ A;  2QA4 F;  4TV9 B;  2CW4 A;  4LNU B;  3HKC A;  4G4W A;  4ZHY B;  2OZB A;  3VCZ A;  5BMV A;  5MN6 A;  3CCQ F;  2BTQ B;  4O2B A;  3OW2 F;  3CC2 F;  3MQW A;  3OBW A;  1IV1 A;  3U0O A;  3D54 A;  3JAR A;  5LA6 A;  5GIP C;  2QTP A;  1IV3 A;  3JAL B;  4HNA B;  1W57 A;  4M8I A;  3C9R A;  3RYC B;  5JCO C;  4X3L A;  5HP8 A;  3N2G B;  4X3M A;  1RLG A;  3CG6 A;  5JQG B;  5LYJ B;  4LNU A;  1NMU B;  1YQN A;  3N2G A;  5GIO C;  3G6E F;  2NMU A;  4X20 A;  2P6Y A;  4C82 A;  5KMG B;  3RYF A;  4X1Y B;  3V7Q A;  1RQ7 A;  4IHJ B;  5FNV A;  3FBA A;  1Q8R A;  1W2B F;  3B6N A;  5KX5 B;  3JAT B;  4G88 A;  5FLX M;  2R6R 1;  1XV2 A;  3TD3 A;  3NK7 A;  2GZL A;  3VYS C;  5GAN K;  1KD1 H;  3SIU A;  2UZH A;  2QEX F;  3S06 A;  3IMP A;  5JVD A;  1KQS F;  1GX1 A;  1Z5V A;  4BT2 A;  2VAP A;  3WGJ A;  3ESJ A;  4ZK7 A;  1KNJ A;  5HXZ A;  3GHZ A;  2F9Z C;  2HS3 A;  5EB0 A;  1GO1 A;  1YGY A;  3MDO A;  1U43 A;  4PWT A;  4B62 A;  3WJQ A;  4EB6 B;  3CCJ F;  3WGN A;  4ZOL A;  2HRU A;  4U3J B;  2CHS A;  5JH7 A;  2CSL A;  3JAT A;  4YJ2 B;  3HWU A;  1U40 A;  3D01 A;  4EI8 A;  3JAM M;  1TUB A;  3J81 M;  5HWE A;  1Q86 H;  2RHJ A;  5IJ0 B;  3E20 B;  3CCM F;  2AIF A;  4F6R B;  2HP3 A;  3CYP B;  5J2T B;  3KHN A;  3L7Q A;  3N4Y A;  4TV8 A;  4C8G A;  3UT5 A;  3EOR A;  5CA0 A;  1FFX B;  4BVQ A;  3M1X A;  5CB4 A;  3E22 A;  3R0P A;  5C8Y A;  1XBI A;  4NQ3 A;  3CME F;  4C81 A;  4YJ2 A;  2DYY A;  1QD9 A;  2VAM A;  4BT3 A;  3QHD A;  3S0H A;  3CCR F;  3E22 B;  4WBN A;  2GVI A;  3FD5 A;  2CZW A;  3ZO8 A;  4G4X A;  3VTI C;  3SIV A;  1Q82 H;  3N2K B;  1SZQ A;  2HP0 A;  3F6M A;  3DC2 A;  4TV8 B;  4LCK A;  4BVS A;  5HY2 A;  3FD6 A;  2VAW A;  3VO8 A;  5MN4 A;  3C9S A;  3RYH A;  3QTY A;  1ONI A;  4B46 A;  5B8F A;  3VMF B;  4R40 B;  3S0W A;  5HY0 A;  1IV2 A;  2HS4 A;  3JAS B; 
#chains in the Genus database with same CATH homology
 1YHQ F;  1QVG F;  3D00 A;  5GIO C;  3CXC F;  3G6E F;  3OBY A;  3CC7 F;  3NMU C;  1YIJ F;  1K8A H;  3G71 F;  3V7Q A;  1VQN F;  1W41 A;  3CCV F;  5G4V C;  1W2B F;  3IR9 A;  3CMA F;  3CCU F;  1E7K A;  1CN7 A;  2OTL F;  1X7O A;  1K9M H;  3HAX D;  1VQM F;  5FLX M;  3CD6 F;  3V7E A;  3J80 M;  3CPW F;  4NUT A;  3PAF A;  3NVI B;  3NK7 A;  5EWR A;  3HJW C;  1PXW A;  4XCQ A;  2KG4 A;  5A2Q M;  5GAN K;  3VI6 A;  1KD1 H;  5GAP K;  3SIU A;  2QEX F;  1YI2 F;  1IPA A;  3CC4 F;  3J7A R;  1W42 A;  1VQ9 F;  1KQS F;  5HY1 A;  3LWP C;  4C4W C;  1YIT F;  2KTU A;  3I55 F;  3ON1 A;  3GYQ A;  3RA5 A;  1VQ4 F;  4BY9 D;  2LBW A;  5HXZ A;  3JCM M;  2F9Z C;  2ALE A;  3O85 A;  1M1K H;  1YJW F;  2FC3 A;  1VQ6 F;  1GO1 A;  2VGN A;  1W3E X;  1W40 A;  4BW0 B;  1KC8 H;  3LWR C;  3CCJ F;  1VQ8 F;  2BO1 A;  2KTV A;  1VQ5 F;  4EI8 A;  3JAM M;  5FJ4 C;  3J81 M;  5HWE A;  3CCE F;  1Q86 H;  1YJ9 F;  2QI2 A;  1VQP F;  1GZ0 A;  5GIN C;  1RA4 A;  1M90 H;  4EI7 A;  3E20 B;  3LWO C;  1T0K B;  3CCM F;  2AIF A;  5DCV A;  3RA6 A;  1X52 A;  3AGK A;  3N4Y A;  3NK6 A;  3MCA B;  3PLA C;  2OTJ F;  2FGY A;  1H7M A;  2VGM A;  4BVQ A;  1CK2 A;  2JNB A;  3CPQ A;  3LWV C;  1VQK F;  1XBI A;  1NJI H;  3V3T A;  4NQ3 A;  3CME F;  1S72 F;  3CCL F;  2WAL A;  1YJN F;  1DT9 A;  1N8R H;  1VQ7 F;  2LBX A;  5G4U C;  3E1Y A;  2GLZ A;  2QA4 F;  5EO3 A;  1JJ2 F;  3I56 F;  3CCR F;  1VQL F;  5HXU A;  4TZZ A;  2HVY D;  2OZB A;  2CZW A;  3FFM A;  4BVR A;  3CCQ F;  3SIV A;  1VQO F;  1Q82 H;  3N4Z A;  1GO0 A;  5HY4 A;  1QVF F;  1X7P A;  4EI9 A;  3CC2 F;  3OW2 F;  1K73 H;  3WXM B;  3OBW A;  3NVK E;  1Q81 H;  4LCK A;  4BVT A;  4BVS A;  5HY2 A;  1Q7Y H;  5GIP C;  2I6D A;  3CCS F;  3LWQ C;  3LFO A;  3G4S F;  1SDS A;  5IT9 M;  2OHW A;  4X3L A;  4X3M A;  1RLG A;  3CG6 A;  3VMF B;  5HY0 A;  1NMU B;  1ZWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...