3MBMA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3mbmA00
1U3LA 4C8EA 1W55A 4C8GA 3Q8HA 3RE3A 3P0ZA 3ELCA 1JY8A 3IEQA 3IKFA 3GHZA 3IKEA 1KNKA 3KE1A 3F0GA 1U3PA 2PMPA 5B8FA 3F0EA 3F0FA 1IV1A 1T0AA 1VHAA 1VH8A 1H47A 3F6MA 3EORA 3QHDA 3IEWA 3FPIA 3F0DA 1IV4A 3K14A 2GZLA 3B6NA 1W57A 1JN1A 2AMTA 3ESJA 3ERNA 3K2XA 3MBMA 3P10A 1KNJA 4C81A 3JVHA 1YQNA 1GX1A 4C8IA 4C82A 1H48A 1U43A 1U40A 1IV3A 3FBAA 1IV2A 2UZHA 3T80A
chains in the Genus database with same CATH superfamily
5CB4B 2IG8A 5LXTB 3JAWA 4X1YB 2ZVZA 5HXUA 1X7OA 3RA5A 1XRGA 4X3MA 3CG6A 3VIUA 1YHQF 3LDTA 5EAZA 3WPXA 2FC3A 3QUWA 3VYSC 3WJPA 1NQ3A 2LBTA 2KTVA 3K0TA 4ZHYB 3P4EA 1QVGF 2BTUA 3HKBA 4I50B 3NK6A 1VQ8F 2KGWA 5GINC 3JVHA 1U43A 1QD9A 3E1YA 2CSLA 4EI7A 1FFXB 1GO1A 1H7MA 2VAPA 3D01A 5A2QM 3MCQA 1XHOA 1VQLF 1T0KB 3WGLA 3J80M 3JCMM 3I55F 3HJWC 1QVFF 2RHOA 5G4VC 4BT6A 3LWRC 1YJWF 1TUBA 3D54A 3MQWA 4DXDA 5LYJA 1CLIA 1W59A 3CCJF 2H8CA 1KNJA 3C9UA 1GX1A 1SA0A 3FBAA 2UZHA 3C9RA 1VQ6F 2R6R1 4BT5A 1W55A 2I6DA 4YJ2A 3S03A 4I4TB 3VYTC 4ZHWA 2CZWA 1Q82H 4I55A 3S0WA 1RQ7A 3FD5A 3CPWF 4G4XA 1U3PA 3LMEA 5FLXM 1JJ2F 3BYQA 2DYYA 3F0FA 3FFMA 3VTIC 2VAWA 3UT5A 2RHLA 3WGNA 3G71F 3HKEA 3LWOC 2K1SA 5CA0B 1SA0B 3K14A 4HNAB 1VQMF 3QTYA 1VQNF 3KJJA 5CA1A 2CW4A 4C82A 5HP8A 2QTPA 2OTLF 1OAPA 3NK7A 4FFBA 3G4SF 1KQSF 3IR9A 4TV9A 3RYFB 4EI9A 4B5CA 5IJ9A 4X20B 3RYHB 1FNJA 1XV2A 1S72F 3UT5B 3J7AR 4ZHQB 2WALA 5J2TA 3HKEB 1IV1A 2BTOA 3J81M 1NMUB 1VHAA 2UYNA 3WJQA 3WPWA 4LNUB 1VQVA 5CA1B 3M1XA 1W3EX 2IAFA 3ESJA 1IV3A 3CC4F 4EB6A 2BTQB 3CC7F 4FFBB 2HS3A 3Q8HA 2H6LA 4DRXA 5DCVA 2P6YA 4O2AB 2VGNA 5HXZA 2HX0A 3CD6F 4M8IA 1GO0A 2FGYA 2YXZA 5B8FA 1FSZA 3CB2A 2KG4A 4KWEA 5BMVA 3DC2A 3V7QA 3FD6A 2HRYA 1IV4A 5GANK 2VGMA 3AGKA 1NJIH 4U3JB 2VAMA 2L26A 2ZOVA 3VMFB 4BT7A 1K9MH 4F6RA 4U39A 1RLUA 5JQGB 1U3LA 3GYQA 3GTZA 3HAXD 5EZYA 4ZK7A 4ZI7B 1JY8A 1VQ7F 3IKFA 3HKDB 3WGKA 3C8LA 3HKCA 4G88A 4BVQA 1KNKA 1PXWA 2PMPA 3JASB 1GZ0A 2HP3A 5FNVA 3L7QA 5J2UB 4YJ3A 3DDNA 2Q1YA 2IQQA 2EWCA 4F6RB 3P10A 1CK2A 4C8IA 3LWVC 3JAWB 4BW0B 1VQ4F 2Z1EA 5EIBC 1ONIA 2AIZP 3S0HA 2H8EA 2HRUA 5MN4A 4G4YA 1VQKF 5FJ4C 4O4LA 5JCOC 5LP6A 3WJRA 1YITF 4YJ3B 3V3TA 3CYQA 1JD1A 2OTJF 3CCUF 2HQSC 5JH7A 1H47A 3F6MA 3HKBB 5EYPA 3NMUC 2GLZA 2VXYA 4C81A 2Q1XA 4O4IA 5EIBD 3KE1A 2V9YA 3T80A 2RB9A 4C4WC 1FNKA 5C8YA 4LCKA 3RE3A 4O2BA 3TD3A 1YJ9F 5LP6B 1COMA 5ITZA 2MQEA 3F0GA 1TUBB 1W5AA 3RYIA 5JH7B 1K73H 4XCQA 2N48A 1T0AA 5HY1A 2PHNA 5JVDA 4B46A 5LYJB 3CPQA 2Z1FA 4E6EA 5GONA 4G4ZA 4IHJA 4O4JA 1H48A 5HY0A 4YJ2B 4G4VA 1DBFA 3O85A 4I55B 3ELCA 3IEQA 3CCQF 3VOBA 5ITZB 3E20B 1W581 4BT2A 3RYIB 5GIPC 4WBNA 4B62A 4IIJA 5JVDB 4EI8A 3CMAF 3VYUC 3JARA 1UI9A 2Z01A 3M4SA 1W2BF 5GONB 2HS4A 1Q81H 1ODEA 2ZVYA 2W8BC 3IEWA 3N2KA 3B6NA 5EO3A 4BVSA 1W41A 3OBYA 3TD5A 1RA4A 4X1KA 4C8GA 5MN5A 2UYPA 4TV9B 3HTNA 3S0YA 5IYZA 4WBNB 5IJ9B 3MDOA 3JARB 3LFOA 5J2TB 1ZWZA 3HWUA 3WGMA 3SIUA 2UYNB 3F0EA 2RHJA 3PAFA 2CWJA 3ZO8A 3KJKA 4PWTA 3CXCF 2DT4A 1PF5A 1QAHA 3ZOPA 2UYJA 3F0DA 4G4WA 2KTUA 2LBWA 1W42A 3D00A 1VQ5F 1KD1H 4X1KB 5LP6C 4EB6B 1E7KA 4DRXB 4X1IA 3WXMB 3R0PA 5CB4A 3KIZA 5IT9M 1SZQA 5LXTA 3RA6A 4X1YA 3JAKA 3CMEF 2OHWA 1X25A 3CCEF 1OFUA 1VK3A 2UYKA 4TZZA 1RLGA 3I3FA 2ZODA 5BMVB 3PLAC 5HWEA 3K12A 1Z5WA 1R1MA 1VH8A 1VQPF 2BO1A 1YI2F 1VQ9F 3V7EA 2GVIA 3ERNA 3K2XA 4X1IB 2CHSA 5HY4A 4I50A 3S02A 2QI2A 1RQ2A 5EZYB 1TVKA 3JAKB 2CVLA 4TV8A 5HP7A 1FFXA 3TD4A 3HKCB 1Z5VA 4RHAA 4B45A 4ERHA 2Z1UA 4BVTA 2ZF8A 5G4UC 5LOVA 5FNVB 4RQOA 2Z1TA 3CCLF 1Q7YH 2AIFA 5IJ0A 3QHDA 4TUYA 1W5EA 3N4ZA 2GZLA 1W57A 1JN1A 3MBMA 3JAMM 2ALEA 4BT3A 3CYPB 1TVKB 1Q8RA 4TV8B 1YGYA 1IV2A 2LBXA 4BY9D 3OBWA 1M1KH 3OONA 4NWOB 1J7HA 5KX5A 4I4TA 4O4LB 2F9ZC 4ZHVA 5LOVB 3JATA 1W5BA 2OTMA 1XBIA 1JFFA 4O4HA 5IJ0B 4TUYB 3MCAB 5EYPB 3ZP7A 3EORA 4BVRA 4O4IB 5GIOC 3G6EF 5CA0A 3CCRF 4HNAA 2JNBA 1N8RH 3ZP4A 3I56F 1M90H 2ZAUA 5C8YB 3NVIB 1X7PA 4O2BB 5KX5B 1IPAA 3P0ZA 4BT4A 3JATB 3GHZA 1JFFB 2B33A 4O4HB 2RHHA 3OW2F 1VQOF 3RYFA 3RYCA 5GAPK 5LA6A 3VOAA 4X20A 4X3LA 3LYBA 3RYHA 3C9SA 5EB0A 4ZHQA 5MN6A 2NMUA 3U0OA 2G9IA 1W40A 4IHJB 4LNUA 5JCOA 4O4JB 3V4DA 3LWPC 1YQNA 2I6RA 3CCSF 3JALA 3VI6A 1CN7A 2R751 1K8AH 2OZBA 5AVMA 3CCVF 4NQ3A 3M84A 3RYCB 4O2AA 5LA6B 4IIJB 3S06A 5KMGA 3N4YA 4ZOLA 1UFYA 1QU9A 3NVKE 3I7TA 2LCAA 3N2KB 1DT9A 3IMPA 1Q86H 2HVYD 3N2GA 2AMTA 3JALB 5EWRA 3E22A 1U40A 4U3JA 2HP0A 1SDSA 1X52A 2QA4F 1YIJF 4NUTA 4C8EA 3WGJA 5JQGA 5IYZB 3VCZA 4ZI7A 3C9TA 5KMGB 3ON1A 2YYEA 4ZOLB 3IKEA 3HKDA 3CCMF 3LWQC 3CC2F 3VO8A 2QEXF 3SIVA 3JASA 4R40B 3N2GB 5J2UA 5EB1B 3FPIA 3E22B 2HP0B 3KHNA 1W5FA 2HS0A 2CHTA 1YJNF 5HY2A 1KC8H
chains in the Genus database with same CATH topology
1U3LA 4C8EA 1W55A 4C8GA 3Q8HA 3RE3A 3P0ZA 3ELCA 1JY8A 3IEQA 3IKFA 3GHZA 3IKEA 1KNKA 3KE1A 3F0GA 1U3PA 2PMPA 5B8FA 3F0EA 3F0FA 1IV1A 1T0AA 1VHAA 1VH8A 1H47A 3F6MA 3EORA 3QHDA 3IEWA 3FPIA 3F0DA 1IV4A 3K14A 2GZLA 3B6NA 1W57A 1JN1A 2AMTA 3ESJA 3ERNA 3K2XA 3MBMA 3P10A 1KNJA 4C81A 3JVHA 1YQNA 1GX1A 4C8IA 4C82A 1H48A 1U43A 1U40A 1IV3A 3FBAA 1IV2A 2UZHA 3T80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  4C8E A;  1W55 A;  4C8G A;  3Q8H A;  3RE3 A;  3P0Z A;  3ELC A;  1JY8 A;  3IEQ A;  3IKF A;  3GHZ A;  3IKE A;  1KNK A;  3KE1 A;  3F0G A;  1U3P A;  2PMP A;  5B8F A;  3F0E A;  3F0F A;  1IV1 A;  1T0A A;  1VHA A;  1VH8 A;  1H47 A;  3F6M A;  3EOR A;  3QHD A;  3IEW A;  3FPI A;  3F0D A;  1IV4 A;  3K14 A;  2GZL A;  3B6N A;  1W57 A;  1JN1 A;  2AMT A;  3ESJ A;  3ERN A;  3K2X A;  3MBM A;  3P10 A;  1KNJ A;  4C81 A;  3JVH A;  1YQN A;  1GX1 A;  4C8I A;  4C82 A;  1H48 A;  1U43 A;  1U40 A;  1IV3 A;  3FBA A;  1IV2 A;  2UZH A;  3T80 A; 
#chains in the Genus database with same CATH topology
 5CB4 B;  2IG8 A;  5LXT B;  3JAW A;  4X1Y B;  2ZVZ A;  5HXU A;  1X7O A;  3RA5 A;  1XRG A;  4X3M A;  3CG6 A;  3VIU A;  1YHQ F;  3LDT A;  5EAZ A;  3WPX A;  2FC3 A;  3QUW A;  3VYS C;  3WJP A;  1NQ3 A;  2LBT A;  2KTV A;  3K0T A;  4ZHY B;  3P4E A;  1QVG F;  2BTU A;  3HKB A;  4I50 B;  3NK6 A;  1VQ8 F;  2KGW A;  5GIN C;  3JVH A;  1U43 A;  1QD9 A;  3E1Y A;  2CSL A;  4EI7 A;  1FFX B;  1GO1 A;  1H7M A;  2VAP A;  3D01 A;  5A2Q M;  3MCQ A;  1XHO A;  1VQL F;  1T0K B;  3WGL A;  3J80 M;  3JCM M;  3I55 F;  3HJW C;  1QVF F;  2RHO A;  5G4V C;  4BT6 A;  3LWR C;  1YJW F;  1TUB A;  3D54 A;  3MQW A;  4DXD A;  5LYJ A;  1CLI A;  1W59 A;  3CCJ F;  2H8C A;  1KNJ A;  3C9U A;  1GX1 A;  1SA0 A;  3FBA A;  2UZH A;  3C9R A;  1VQ6 F;  2R6R 1;  4BT5 A;  1W55 A;  2I6D A;  4YJ2 A;  3S03 A;  4I4T B;  3VYT C;  4ZHW A;  2CZW A;  1Q82 H;  4I55 A;  3S0W A;  1RQ7 A;  3FD5 A;  3CPW F;  4G4X A;  1U3P A;  3LME A;  5FLX M;  1JJ2 F;  3BYQ A;  2DYY A;  3F0F A;  3FFM A;  3VTI C;  2VAW A;  3UT5 A;  2RHL A;  3WGN A;  3G71 F;  3HKE A;  3LWO C;  2K1S A;  5CA0 B;  1SA0 B;  3K14 A;  4HNA B;  1VQM F;  3QTY A;  1VQN F;  3KJJ A;  5CA1 A;  2CW4 A;  4C82 A;  5HP8 A;  2QTP A;  2OTL F;  1OAP A;  3NK7 A;  4FFB A;  3G4S F;  1KQS F;  3IR9 A;  4TV9 A;  3RYF B;  4EI9 A;  4B5C A;  5IJ9 A;  4X20 B;  3RYH B;  1FNJ A;  1XV2 A;  1S72 F;  3UT5 B;  3J7A R;  4ZHQ B;  2WAL A;  5J2T A;  3HKE B;  1IV1 A;  2BTO A;  3J81 M;  1NMU B;  1VHA A;  2UYN A;  3WJQ A;  3WPW A;  4LNU B;  1VQV A;  5CA1 B;  3M1X A;  1W3E X;  2IAF A;  3ESJ A;  1IV3 A;  3CC4 F;  4EB6 A;  2BTQ B;  3CC7 F;  4FFB B;  2HS3 A;  3Q8H A;  2H6L A;  4DRX A;  5DCV A;  2P6Y A;  4O2A B;  2VGN A;  5HXZ A;  2HX0 A;  3CD6 F;  4M8I A;  1GO0 A;  2FGY A;  2YXZ A;  5B8F A;  1FSZ A;  3CB2 A;  2KG4 A;  4KWE A;  5BMV A;  3DC2 A;  3V7Q A;  3FD6 A;  2HRY A;  1IV4 A;  5GAN K;  2VGM A;  3AGK A;  1NJI H;  4U3J B;  2VAM A;  2L26 A;  2ZOV A;  3VMF B;  4BT7 A;  1K9M H;  4F6R A;  4U39 A;  1RLU A;  5JQG B;  1U3L A;  3GYQ A;  3GTZ A;  3HAX D;  5EZY A;  4ZK7 A;  4ZI7 B;  1JY8 A;  1VQ7 F;  3IKF A;  3HKD B;  3WGK A;  3C8L A;  3HKC A;  4G88 A;  4BVQ A;  1KNK A;  1PXW A;  2PMP A;  3JAS B;  1GZ0 A;  2HP3 A;  5FNV A;  3L7Q A;  5J2U B;  4YJ3 A;  3DDN A;  2Q1Y A;  2IQQ A;  2EWC A;  4F6R B;  3P10 A;  1CK2 A;  4C8I A;  3LWV C;  3JAW B;  4BW0 B;  1VQ4 F;  2Z1E A;  5EIB C;  1ONI A;  2AIZ P;  3S0H A;  2H8E A;  2HRU A;  5MN4 A;  4G4Y A;  1VQK F;  5FJ4 C;  4O4L A;  5JCO C;  5LP6 A;  3WJR A;  1YIT F;  4YJ3 B;  3V3T A;  3CYQ A;  1JD1 A;  2OTJ F;  3CCU F;  2HQS C;  5JH7 A;  1H47 A;  3F6M A;  3HKB B;  5EYP A;  3NMU C;  2GLZ A;  2VXY A;  4C81 A;  2Q1X A;  4O4I A;  5EIB D;  3KE1 A;  2V9Y A;  3T80 A;  2RB9 A;  4C4W C;  1FNK A;  5C8Y A;  4LCK A;  3RE3 A;  4O2B A;  3TD3 A;  1YJ9 F;  5LP6 B;  1COM A;  5ITZ A;  2MQE A;  3F0G A;  1TUB B;  1W5A A;  3RYI A;  5JH7 B;  1K73 H;  4XCQ A;  2N48 A;  1T0A A;  5HY1 A;  2PHN A;  5JVD A;  4B46 A;  5LYJ B;  3CPQ A;  2Z1F A;  4E6E A;  5GON A;  4G4Z A;  4IHJ A;  4O4J A;  1H48 A;  5HY0 A;  4YJ2 B;  4G4V A;  1DBF A;  3O85 A;  4I55 B;  3ELC A;  3IEQ A;  3CCQ F;  3VOB A;  5ITZ B;  3E20 B;  1W58 1;  4BT2 A;  3RYI B;  5GIP C;  4WBN A;  4B62 A;  4IIJ A;  5JVD B;  4EI8 A;  3CMA F;  3VYU C;  3JAR A;  1UI9 A;  2Z01 A;  3M4S A;  1W2B F;  5GON B;  2HS4 A;  1Q81 H;  1ODE A;  2ZVY A;  2W8B C;  3IEW A;  3N2K A;  3B6N A;  5EO3 A;  4BVS A;  1W41 A;  3OBY A;  3TD5 A;  1RA4 A;  4X1K A;  4C8G A;  5MN5 A;  2UYP A;  4TV9 B;  3HTN A;  3S0Y A;  5IYZ A;  4WBN B;  5IJ9 B;  3MDO A;  3JAR B;  3LFO A;  5J2T B;  1ZWZ A;  3HWU A;  3WGM A;  3SIU A;  2UYN B;  3F0E A;  2RHJ A;  3PAF A;  2CWJ A;  3ZO8 A;  3KJK A;  4PWT A;  3CXC F;  2DT4 A;  1PF5 A;  1QAH A;  3ZOP A;  2UYJ A;  3F0D A;  4G4W A;  2KTU A;  2LBW A;  1W42 A;  3D00 A;  1VQ5 F;  1KD1 H;  4X1K B;  5LP6 C;  4EB6 B;  1E7K A;  4DRX B;  4X1I A;  3WXM B;  3R0P A;  5CB4 A;  3KIZ A;  5IT9 M;  1SZQ A;  5LXT A;  3RA6 A;  4X1Y A;  3JAK A;  3CME F;  2OHW A;  1X25 A;  3CCE F;  1OFU A;  1VK3 A;  2UYK A;  4TZZ A;  1RLG A;  3I3F A;  2ZOD A;  5BMV B;  3PLA C;  5HWE A;  3K12 A;  1Z5W A;  1R1M A;  1VH8 A;  1VQP F;  2BO1 A;  1YI2 F;  1VQ9 F;  3V7E A;  2GVI A;  3ERN A;  3K2X A;  4X1I B;  2CHS A;  5HY4 A;  4I50 A;  3S02 A;  2QI2 A;  1RQ2 A;  5EZY B;  1TVK A;  3JAK B;  2CVL A;  4TV8 A;  5HP7 A;  1FFX A;  3TD4 A;  3HKC B;  1Z5V A;  4RHA A;  4B45 A;  4ERH A;  2Z1U A;  4BVT A;  2ZF8 A;  5G4U C;  5LOV A;  5FNV B;  4RQO A;  2Z1T A;  3CCL F;  1Q7Y H;  2AIF A;  5IJ0 A;  3QHD A;  4TUY A;  1W5E A;  3N4Z A;  2GZL A;  1W57 A;  1JN1 A;  3MBM A;  3JAM M;  2ALE A;  4BT3 A;  3CYP B;  1TVK B;  1Q8R A;  4TV8 B;  1YGY A;  1IV2 A;  2LBX A;  4BY9 D;  3OBW A;  1M1K H;  3OON A;  4NWO B;  1J7H A;  5KX5 A;  4I4T A;  4O4L B;  2F9Z C;  4ZHV A;  5LOV B;  3JAT A;  1W5B A;  2OTM A;  1XBI A;  1JFF A;  4O4H A;  5IJ0 B;  4TUY B;  3MCA B;  5EYP B;  3ZP7 A;  3EOR A;  4BVR A;  4O4I B;  5GIO C;  3G6E F;  5CA0 A;  3CCR F;  4HNA A;  2JNB A;  1N8R H;  3ZP4 A;  3I56 F;  1M90 H;  2ZAU A;  5C8Y B;  3NVI B;  1X7P A;  4O2B B;  5KX5 B;  1IPA A;  3P0Z A;  4BT4 A;  3JAT B;  3GHZ A;  1JFF B;  2B33 A;  4O4H B;  2RHH A;  3OW2 F;  1VQO F;  3RYF A;  3RYC A;  5GAP K;  5LA6 A;  3VOA A;  4X20 A;  4X3L A;  3LYB A;  3RYH A;  3C9S A;  5EB0 A;  4ZHQ A;  5MN6 A;  2NMU A;  3U0O A;  2G9I A;  1W40 A;  4IHJ B;  4LNU A;  5JCO A;  4O4J B;  3V4D A;  3LWP C;  1YQN A;  2I6R A;  3CCS F;  3JAL A;  3VI6 A;  1CN7 A;  2R75 1;  1K8A H;  2OZB A;  5AVM A;  3CCV F;  4NQ3 A;  3M84 A;  3RYC B;  4O2A A;  5LA6 B;  4IIJ B;  3S06 A;  5KMG A;  3N4Y A;  4ZOL A;  1UFY A;  1QU9 A;  3NVK E;  3I7T A;  2LCA A;  3N2K B;  1DT9 A;  3IMP A;  1Q86 H;  2HVY D;  3N2G A;  2AMT A;  3JAL B;  5EWR A;  3E22 A;  1U40 A;  4U3J A;  2HP0 A;  1SDS A;  1X52 A;  2QA4 F;  1YIJ F;  4NUT A;  4C8E A;  3WGJ A;  5JQG A;  5IYZ B;  3VCZ A;  4ZI7 A;  3C9T A;  5KMG B;  3ON1 A;  2YYE A;  4ZOL B;  3IKE A;  3HKD A;  3CCM F;  3LWQ C;  3CC2 F;  3VO8 A;  2QEX F;  3SIV A;  3JAS A;  4R40 B;  3N2G B;  5J2U A;  5EB1 B;  3FPI A;  3E22 B;  2HP0 B;  3KHN A;  1W5F A;  2HS0 A;  2CHT A;  1YJN F;  5HY2 A;  1KC8 H; 
#chains in the Genus database with same CATH homology
 1U3L A;  4C8E A;  1W55 A;  4C8G A;  3Q8H A;  3RE3 A;  3P0Z A;  3ELC A;  1JY8 A;  3IEQ A;  3IKF A;  3GHZ A;  3IKE A;  1KNK A;  3KE1 A;  3F0G A;  1U3P A;  2PMP A;  5B8F A;  3F0E A;  3F0F A;  1IV1 A;  1T0A A;  1VHA A;  1VH8 A;  1H47 A;  3F6M A;  3EOR A;  3QHD A;  3IEW A;  3FPI A;  3F0D A;  1IV4 A;  3K14 A;  2GZL A;  3B6N A;  1W57 A;  1JN1 A;  2AMT A;  3ESJ A;  3ERN A;  3K2X A;  3MBM A;  3P10 A;  1KNJ A;  4C81 A;  3JVH A;  1YQN A;  1GX1 A;  4C8I A;  4C82 A;  1H48 A;  1U43 A;  1U40 A;  1IV3 A;  3FBA A;  1IV2 A;  2UZH A;  3T80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...