3MBMA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3mbmA00
1IV2A 3IEQA 1U3PA 3T80A 1U43A 3K14A 1W57A 3FBAA 3FPIA 3JVHA 4C81A 4C82A 3RE3A 1KNJA 3QHDA 3F0FA 3K2XA 2GZLA 3KE1A 3F0EA 1H47A 1T0AA 3F0DA 4C8EA 1U3LA 5B8FA 3Q8HA 1JY8A 1U40A 1VHAA 1H48A 3MBMA 2UZHA 1IV4A 1GX1A 3ESJA 3GHZA 4C8GA 3IKFA 3ELCA 3IEWA 1VH8A 4C8IA 3B6NA 3ERNA 3F0GA 1JN1A 2PMPA 3EORA 3P0ZA 3P10A 1KNKA 1YQNA 2AMTA 1IV1A 1W55A 3F6MA 1IV3A 3IKEA
chains in the Genus database with same CATH superfamily
2CHTA 1YJNF 3S0HA 2BTQB 3JALB 4NWOB 5GIOC 1N8RH 4C4WC 5CA1B 4O2AB 1W581 1J7HA 3VYTC 2GZLA 2ZODA 3J80M 3BYQA 3I3FA 5HP7A 5HY1A 1FFXB 2BTUA 4O4IB 1VH8A 2VGNA 3RYIB 4HNAA 1W3EX 2MQEA 3JASB 4G4ZA 3WGJA 1W41A 2JNBA 3E22A 1U3PA 3P4EA 2FC3A 2B33A 3LYBA 3SIVA 5CA0B 4LCKA 1ODEA 3KE1A 3F0EA 3G4SF 3Q8HA 3V3TA 3ZP7A 3I56F 4PWTA 4YJ2B 1OFUA 4C8GA 4F6RB 2VXYA 3IEWA 3MQWA 2UYNB 1CK2A 5IYZA 1W5FA 3VO8A 1VQKF 3CMEF 4ZHQA 4IHJB 5MN5A 3FFMA 2RB9A 5MN6A 5JQGB 2CSLA 4I4TB 1SA0B 5IT9M 3WJPA 2CWJA 2HP0A 1S72F 4U39A 5EZYB 3K2XA 5EO3A 1VQ6F 1T0AA 2G9IA 4FFBB 2IQQA 2OTJF 2OTMA 4I55A 1VHAA 2AIFA 4O2BB 5EYPB 5IJ9A 3C9RA 5GANK 1VQ5F 2LBXA 3MCQA 4ZI7A 3NK7A 1OAPA 1SZQA 4RQOA 2Q1YA 3D54A 5LXTB 3TD3A 1ONIA 3CCMF 3QHDA 3IR9A 3JCMM 3F0FA 2QI2A 4YJ3B 3JARB 3WGKA 3RYCB 2DYYA 1H48A 2HP3A 1R1MA 3ESJA 1TUBB 5LOVB 4RHAA 3NK6A 4BT3A 3CPWF 5EB0A 3LWQC 3CCUF 4X1YB 5LA6B 5MN4A 3ZOPA 1XV2A 4E6EA 4EB6B 1IPAA 3HKDB 2H8EA 3CCLF 5HY0A 1VQMF 3CCQF 4BVSA 2RHHA 1YI2F 4BVTA 3JVHA 2AIZP 3OONA 3CG6A 4BW0B 4C81A 3RA6A 3WGLA 1GZ0A 2L26A 3S0WA 2PHNA 2Q1XA 3OW2F 5G4VC 3M1XA 2QTPA 4X3MA 1SDSA 2YXZA 1W42A 4X1IB 1NQ3A 1VQ4F 4I50A 5FLXM 3ZO8A 3KJKA 4G4XA 3CB2A 2ZF8A 3N2KB 3CXCF 3RYHB 4EI9A 5BMVA 1IV2A 3V7QA 2HRUA 4BY9D 3K12A 2RHOA 3T80A 3HJWC 5GONB 5DCVA 3FBAA 4LNUA 4TV9A 4U3JB 5JVDA 1KNJA 3WJRA 4XCQA 4BT2A 5JH7A 5KMGA 1FNJA 1Q86H 4O4LB 5J2TB 2HS4A 4B62A 1JY8A 1XRGA 1U40A 3OBWA 1TVKA 3HKBA 1RQ2A 2FGYA 1RLGA 3RYFB 3KHNA 1QD9A 4TUYA 2CZWA 1Z5WA 1CN7A 3N2GA 3HTNA 5HXUA 1VK3A 1IV1A 4HNAB 1W55A 3F6MA 1IV3A 4WBNA 1K8AH 3KJJA 4O2AA 2H6LA 1RA4A 3C9TA 2UYKA 4X1KB 3M4SA 3JATB 1H47A 3ON1A 1X7OA 1FFXA 3RYIA 2P6YA 3CC4F 2R6R1 4X20A 4TV8A 2OHWA 3JASA 1X52A 2PMPA 3WPXA 5GAPK 1YQNA 3S02A 4DRXA 5FNVB 1XBIA 3MBMA 3VMFB 3E20B 2LBWA 5CA0A 2GLZA 3IEQA 1COMA 3M84A 4ZHQB 3SIUA 2ZAUA 3C8LA 4BT4A 3RE3A 1X25A 2HP0B 4YJ2A 1JFFB 3CCRF 3CCSF 3F0DA 2W8BC 1YHQF 1T0KB 3HKCB 2UYNA 3JAKA 4G88A 1NMUB 1GX1A 2UZHA 3AGKA 3LWOC 3WPWA 4ZHVA 2HS3A 1Q7YH 5J2UA 1W5EA 4IIJB 4IHJA 3LDTA 3HKEA 2WALA 5JQGA 2ZOVA 5LP6A 4I4TA 1SA0A 2K1SA 2AMTA 5C8YB 3K0TA 3CCEF 3UT5B 5EZYA 3QTYA 4ZI7B 5G4UC 4M8IA 5A2QM 5CB4A 1KQSF 5EIBC 1K73H 4FFBA 3G71F 5IJ0B 2I6RA 3JAMM 3NMUC 4O2BA 5EYPA 3CMAF 4TZZA 1ZWZA 1QVFF 4O4JA 4G4VA 5LP6C 2CHSA 2DT4A 3I7TA 3WJQA 4NQ3A 2ALEA 3ERNA 4B45A 2KGWA 5LXTA 2VAMA 1PF5A 4BT7A 5HWEA 3CYPB 3MDOA 1XHOA 3O85A 5JCOA 3HWUA 5AVMA 4BT5A 5GIPC 1FSZA 4YJ3A 1U43A 3JARA 5FJ4C 2HVYD 4ZOLB 1K9MH 2V9YA 1TUBA 2VAPA 3NVKE 4NUTA 5LYJB 2GVIA 2BTOA 3DC2A 5KX5A 5LA6A 4BT6A 2LBTA 5ITZB 3I55F 3HKDA 3ELCA 5JCOC 3LWPC 3S06A 3JAWA 1GO0A 3WGMA 4B46A 3U0OA 1W40A 3VOAA 2VAWA 4O4HA 4B5CA 1YITF 1KD1H 5BMVB 3HAXD 3GTZA 1M1KH 3E1YA 1X7PA 3TD4A 3GYQA 3CCJF 2N48A 4G4YA 4LNUB 5JVDB 3CPQA 3RA5A 5KMGB 1JJ2F 3NVIB 3D00A 4X1IA 4EI8A 4EI7A 1VQPF 3ZP4A 2EWCA 2IG8A 5GINC 1JN1A 3EORA 4TUYB 3RYHA 2VGMA 4ZHYB 1H7MA 3G6EF 2BO1A 4U3JA 2RHLA 3JALA 4WBNB 2IAFA 3K14A 5CA1A 1M90H 2HX0A 4O4LA 5J2TA 4BVQA 3E22B 5EAZA 4KWEA 3RYFA 1VQOF 4C8EA 1VQ9F 2NMUA 3QUWA 2QA4F 1YJWF 1IV4A 4O4IA 1W2BF 4X3LA 1RQ7A 1VQ8F 4X20B 4TV8B 5IYZB 1VQ7F 3IKEA 1Q82H 1UFYA 4DRXB 3LFOA 4X1KA 3CC2F 3JATA 1DT9A 3FPIA 2ZVYA 4C82A 2R751 5HY4A 3CYQA 3CC7F 2UYPA 5HY2A 2H8CA 1Q81H 2CW4A 4DXDA 5B8FA 2I6DA 1Z5VA 4F6RA 3LWVC 2Z1TA 4R40B 3JAKB 4I55B 4C8IA 5EB1B 5FNVA 3C9SA 5IJ9B 5J2UB 1JD1A 3P10A 1W5BA 3N4ZA 3HKEB 2ZVZA 5LP6B 3VI6A 3TD5A 1GO1A 2HRYA 3PLAC 1JFFA 2YYEA 3V4DA 3J7AR 1FNKA 3VYUC 3CCVF 5CB4B 3HKCA 2QEXF 3KIZA 4IIJA 2KTUA 2LCAA 1UI9A 3GHZA 3L7QA 4O4JB 1CLIA 5HXZA 2OTLF 5C8YA 1QAHA 3B6NA 3UT5A 3LWRC 3MCAB 2Z1UA 4BVRA 3FD6A 3PAFA 2F9ZC 3C9UA 1RLUA 5IJ0A 3IMPA 3VIUA 1W57A 4G4WA 2Z01A 3CD6F 1YGYA 3RYCA 1YIJF 4ZHWA 5LOVA 1E7KA 3VCZA 1Q8RA 4X1YA 5KX5B 4EB6A 3S03A 1YJ9F 3WGNA 1PXWA 3F0GA 2HQSC 2KTVA 3P0ZA 1QU9A 1VQNF 1VQVA 3JAWB 1KC8H 5HP8A 2UYJA 4ZOLA 4I50B 3LMEA 2RHJA 3J81M 3V7EA 1QVGF 4O4HB 5EWRA 5EIBD 5LYJA 2OZBA 3D01A 2KG4A 1VQLF 2CVLA 5ITZA 4TV9B 1W5AA 1U3LA 5JH7B 3VTIC 3N4YA 2Z1FA 3VYSC 1W59A 2Z1EA 3S0YA 1DBFA 3IKFA 2HS0A 3DDNA 4ZK7A 3OBYA 1TVKB 3HKBB 3WXMB 3R0PA 3N2KA 3VOBA 1KNKA 3FD5A 4ERHA 1NJIH 3N2GB 5GONA
chains in the Genus database with same CATH topology
1IV2A 3IEQA 1U3PA 3T80A 1U43A 3K14A 1W57A 3FBAA 3FPIA 3JVHA 4C81A 4C82A 3RE3A 1KNJA 3QHDA 3F0FA 3K2XA 2GZLA 3KE1A 3F0EA 1H47A 1T0AA 3F0DA 4C8EA 1U3LA 5B8FA 3Q8HA 1JY8A 1U40A 1VHAA 1H48A 3MBMA 2UZHA 1IV4A 1GX1A 3ESJA 3GHZA 4C8GA 3IKFA 3ELCA 3IEWA 1VH8A 4C8IA 3B6NA 3ERNA 3F0GA 1JN1A 2PMPA 3EORA 3P0ZA 3P10A 1KNKA 1YQNA 2AMTA 1IV1A 1W55A 3F6MA 1IV3A 3IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV2 A;  3IEQ A;  1U3P A;  3T80 A;  1U43 A;  3K14 A;  1W57 A;  3FBA A;  3FPI A;  3JVH A;  4C81 A;  4C82 A;  3RE3 A;  1KNJ A;  3QHD A;  3F0F A;  3K2X A;  2GZL A;  3KE1 A;  3F0E A;  1H47 A;  1T0A A;  3F0D A;  4C8E A;  1U3L A;  5B8F A;  3Q8H A;  1JY8 A;  1U40 A;  1VHA A;  1H48 A;  3MBM A;  2UZH A;  1IV4 A;  1GX1 A;  3ESJ A;  3GHZ A;  4C8G A;  3IKF A;  3ELC A;  3IEW A;  1VH8 A;  4C8I A;  3B6N A;  3ERN A;  3F0G A;  1JN1 A;  2PMP A;  3EOR A;  3P0Z A;  3P10 A;  1KNK A;  1YQN A;  2AMT A;  1IV1 A;  1W55 A;  3F6M A;  1IV3 A;  3IKE A; 
#chains in the Genus database with same CATH topology
 2CHT A;  1YJN F;  3S0H A;  2BTQ B;  3JAL B;  4NWO B;  5GIO C;  1N8R H;  4C4W C;  5CA1 B;  4O2A B;  1W58 1;  1J7H A;  3VYT C;  2GZL A;  2ZOD A;  3J80 M;  3BYQ A;  3I3F A;  5HP7 A;  5HY1 A;  1FFX B;  2BTU A;  4O4I B;  1VH8 A;  2VGN A;  3RYI B;  4HNA A;  1W3E X;  2MQE A;  3JAS B;  4G4Z A;  3WGJ A;  1W41 A;  2JNB A;  3E22 A;  1U3P A;  3P4E A;  2FC3 A;  2B33 A;  3LYB A;  3SIV A;  5CA0 B;  4LCK A;  1ODE A;  3KE1 A;  3F0E A;  3G4S F;  3Q8H A;  3V3T A;  3ZP7 A;  3I56 F;  4PWT A;  4YJ2 B;  1OFU A;  4C8G A;  4F6R B;  2VXY A;  3IEW A;  3MQW A;  2UYN B;  1CK2 A;  5IYZ A;  1W5F A;  3VO8 A;  1VQK F;  3CME F;  4ZHQ A;  4IHJ B;  5MN5 A;  3FFM A;  2RB9 A;  5MN6 A;  5JQG B;  2CSL A;  4I4T B;  1SA0 B;  5IT9 M;  3WJP A;  2CWJ A;  2HP0 A;  1S72 F;  4U39 A;  5EZY B;  3K2X A;  5EO3 A;  1VQ6 F;  1T0A A;  2G9I A;  4FFB B;  2IQQ A;  2OTJ F;  2OTM A;  4I55 A;  1VHA A;  2AIF A;  4O2B B;  5EYP B;  5IJ9 A;  3C9R A;  5GAN K;  1VQ5 F;  2LBX A;  3MCQ A;  4ZI7 A;  3NK7 A;  1OAP A;  1SZQ A;  4RQO A;  2Q1Y A;  3D54 A;  5LXT B;  3TD3 A;  1ONI A;  3CCM F;  3QHD A;  3IR9 A;  3JCM M;  3F0F A;  2QI2 A;  4YJ3 B;  3JAR B;  3WGK A;  3RYC B;  2DYY A;  1H48 A;  2HP3 A;  1R1M A;  3ESJ A;  1TUB B;  5LOV B;  4RHA A;  3NK6 A;  4BT3 A;  3CPW F;  5EB0 A;  3LWQ C;  3CCU F;  4X1Y B;  5LA6 B;  5MN4 A;  3ZOP A;  1XV2 A;  4E6E A;  4EB6 B;  1IPA A;  3HKD B;  2H8E A;  3CCL F;  5HY0 A;  1VQM F;  3CCQ F;  4BVS A;  2RHH A;  1YI2 F;  4BVT A;  3JVH A;  2AIZ P;  3OON A;  3CG6 A;  4BW0 B;  4C81 A;  3RA6 A;  3WGL A;  1GZ0 A;  2L26 A;  3S0W A;  2PHN A;  2Q1X A;  3OW2 F;  5G4V C;  3M1X A;  2QTP A;  4X3M A;  1SDS A;  2YXZ A;  1W42 A;  4X1I B;  1NQ3 A;  1VQ4 F;  4I50 A;  5FLX M;  3ZO8 A;  3KJK A;  4G4X A;  3CB2 A;  2ZF8 A;  3N2K B;  3CXC F;  3RYH B;  4EI9 A;  5BMV A;  1IV2 A;  3V7Q A;  2HRU A;  4BY9 D;  3K12 A;  2RHO A;  3T80 A;  3HJW C;  5GON B;  5DCV A;  3FBA A;  4LNU A;  4TV9 A;  4U3J B;  5JVD A;  1KNJ A;  3WJR A;  4XCQ A;  4BT2 A;  5JH7 A;  5KMG A;  1FNJ A;  1Q86 H;  4O4L B;  5J2T B;  2HS4 A;  4B62 A;  1JY8 A;  1XRG A;  1U40 A;  3OBW A;  1TVK A;  3HKB A;  1RQ2 A;  2FGY A;  1RLG A;  3RYF B;  3KHN A;  1QD9 A;  4TUY A;  2CZW A;  1Z5W A;  1CN7 A;  3N2G A;  3HTN A;  5HXU A;  1VK3 A;  1IV1 A;  4HNA B;  1W55 A;  3F6M A;  1IV3 A;  4WBN A;  1K8A H;  3KJJ A;  4O2A A;  2H6L A;  1RA4 A;  3C9T A;  2UYK A;  4X1K B;  3M4S A;  3JAT B;  1H47 A;  3ON1 A;  1X7O A;  1FFX A;  3RYI A;  2P6Y A;  3CC4 F;  2R6R 1;  4X20 A;  4TV8 A;  2OHW A;  3JAS A;  1X52 A;  2PMP A;  3WPX A;  5GAP K;  1YQN A;  3S02 A;  4DRX A;  5FNV B;  1XBI A;  3MBM A;  3VMF B;  3E20 B;  2LBW A;  5CA0 A;  2GLZ A;  3IEQ A;  1COM A;  3M84 A;  4ZHQ B;  3SIU A;  2ZAU A;  3C8L A;  4BT4 A;  3RE3 A;  1X25 A;  2HP0 B;  4YJ2 A;  1JFF B;  3CCR F;  3CCS F;  3F0D A;  2W8B C;  1YHQ F;  1T0K B;  3HKC B;  2UYN A;  3JAK A;  4G88 A;  1NMU B;  1GX1 A;  2UZH A;  3AGK A;  3LWO C;  3WPW A;  4ZHV A;  2HS3 A;  1Q7Y H;  5J2U A;  1W5E A;  4IIJ B;  4IHJ A;  3LDT A;  3HKE A;  2WAL A;  5JQG A;  2ZOV A;  5LP6 A;  4I4T A;  1SA0 A;  2K1S A;  2AMT A;  5C8Y B;  3K0T A;  3CCE F;  3UT5 B;  5EZY A;  3QTY A;  4ZI7 B;  5G4U C;  4M8I A;  5A2Q M;  5CB4 A;  1KQS F;  5EIB C;  1K73 H;  4FFB A;  3G71 F;  5IJ0 B;  2I6R A;  3JAM M;  3NMU C;  4O2B A;  5EYP A;  3CMA F;  4TZZ A;  1ZWZ A;  1QVF F;  4O4J A;  4G4V A;  5LP6 C;  2CHS A;  2DT4 A;  3I7T A;  3WJQ A;  4NQ3 A;  2ALE A;  3ERN A;  4B45 A;  2KGW A;  5LXT A;  2VAM A;  1PF5 A;  4BT7 A;  5HWE A;  3CYP B;  3MDO A;  1XHO A;  3O85 A;  5JCO A;  3HWU A;  5AVM A;  4BT5 A;  5GIP C;  1FSZ A;  4YJ3 A;  1U43 A;  3JAR A;  5FJ4 C;  2HVY D;  4ZOL B;  1K9M H;  2V9Y A;  1TUB A;  2VAP A;  3NVK E;  4NUT A;  5LYJ B;  2GVI A;  2BTO A;  3DC2 A;  5KX5 A;  5LA6 A;  4BT6 A;  2LBT A;  5ITZ B;  3I55 F;  3HKD A;  3ELC A;  5JCO C;  3LWP C;  3S06 A;  3JAW A;  1GO0 A;  3WGM A;  4B46 A;  3U0O A;  1W40 A;  3VOA A;  2VAW A;  4O4H A;  4B5C A;  1YIT F;  1KD1 H;  5BMV B;  3HAX D;  3GTZ A;  1M1K H;  3E1Y A;  1X7P A;  3TD4 A;  3GYQ A;  3CCJ F;  2N48 A;  4G4Y A;  4LNU B;  5JVD B;  3CPQ A;  3RA5 A;  5KMG B;  1JJ2 F;  3NVI B;  3D00 A;  4X1I A;  4EI8 A;  4EI7 A;  1VQP F;  3ZP4 A;  2EWC A;  2IG8 A;  5GIN C;  1JN1 A;  3EOR A;  4TUY B;  3RYH A;  2VGM A;  4ZHY B;  1H7M A;  3G6E F;  2BO1 A;  4U3J A;  2RHL A;  3JAL A;  4WBN B;  2IAF A;  3K14 A;  5CA1 A;  1M90 H;  2HX0 A;  4O4L A;  5J2T A;  4BVQ A;  3E22 B;  5EAZ A;  4KWE A;  3RYF A;  1VQO F;  4C8E A;  1VQ9 F;  2NMU A;  3QUW A;  2QA4 F;  1YJW F;  1IV4 A;  4O4I A;  1W2B F;  4X3L A;  1RQ7 A;  1VQ8 F;  4X20 B;  4TV8 B;  5IYZ B;  1VQ7 F;  3IKE A;  1Q82 H;  1UFY A;  4DRX B;  3LFO A;  4X1K A;  3CC2 F;  3JAT A;  1DT9 A;  3FPI A;  2ZVY A;  4C82 A;  2R75 1;  5HY4 A;  3CYQ A;  3CC7 F;  2UYP A;  5HY2 A;  2H8C A;  1Q81 H;  2CW4 A;  4DXD A;  5B8F A;  2I6D A;  1Z5V A;  4F6R A;  3LWV C;  2Z1T A;  4R40 B;  3JAK B;  4I55 B;  4C8I A;  5EB1 B;  5FNV A;  3C9S A;  5IJ9 B;  5J2U B;  1JD1 A;  3P10 A;  1W5B A;  3N4Z A;  3HKE B;  2ZVZ A;  5LP6 B;  3VI6 A;  3TD5 A;  1GO1 A;  2HRY A;  3PLA C;  1JFF A;  2YYE A;  3V4D A;  3J7A R;  1FNK A;  3VYU C;  3CCV F;  5CB4 B;  3HKC A;  2QEX F;  3KIZ A;  4IIJ A;  2KTU A;  2LCA A;  1UI9 A;  3GHZ A;  3L7Q A;  4O4J B;  1CLI A;  5HXZ A;  2OTL F;  5C8Y A;  1QAH A;  3B6N A;  3UT5 A;  3LWR C;  3MCA B;  2Z1U A;  4BVR A;  3FD6 A;  3PAF A;  2F9Z C;  3C9U A;  1RLU A;  5IJ0 A;  3IMP A;  3VIU A;  1W57 A;  4G4W A;  2Z01 A;  3CD6 F;  1YGY A;  3RYC A;  1YIJ F;  4ZHW A;  5LOV A;  1E7K A;  3VCZ A;  1Q8R A;  4X1Y A;  5KX5 B;  4EB6 A;  3S03 A;  1YJ9 F;  3WGN A;  1PXW A;  3F0G A;  2HQS C;  2KTV A;  3P0Z A;  1QU9 A;  1VQN F;  1VQV A;  3JAW B;  1KC8 H;  5HP8 A;  2UYJ A;  4ZOL A;  4I50 B;  3LME A;  2RHJ A;  3J81 M;  3V7E A;  1QVG F;  4O4H B;  5EWR A;  5EIB D;  5LYJ A;  2OZB A;  3D01 A;  2KG4 A;  1VQL F;  2CVL A;  5ITZ A;  4TV9 B;  1W5A A;  1U3L A;  5JH7 B;  3VTI C;  3N4Y A;  2Z1F A;  3VYS C;  1W59 A;  2Z1E A;  3S0Y A;  1DBF A;  3IKF A;  2HS0 A;  3DDN A;  4ZK7 A;  3OBY A;  1TVK B;  3HKB B;  3WXM B;  3R0P A;  3N2K A;  3VOB A;  1KNK A;  3FD5 A;  4ERH A;  1NJI H;  3N2G B;  5GON A; 
#chains in the Genus database with same CATH homology
 1IV2 A;  3IEQ A;  1U3P A;  3T80 A;  1U43 A;  3K14 A;  1W57 A;  3FBA A;  3FPI A;  3JVH A;  4C81 A;  4C82 A;  3RE3 A;  1KNJ A;  3QHD A;  3F0F A;  3K2X A;  2GZL A;  3KE1 A;  3F0E A;  1H47 A;  1T0A A;  3F0D A;  4C8E A;  1U3L A;  5B8F A;  3Q8H A;  1JY8 A;  1U40 A;  1VHA A;  1H48 A;  3MBM A;  2UZH A;  1IV4 A;  1GX1 A;  3ESJ A;  3GHZ A;  4C8G A;  3IKF A;  3ELC A;  3IEW A;  1VH8 A;  4C8I A;  3B6N A;  3ERN A;  3F0G A;  1JN1 A;  2PMP A;  3EOR A;  3P0Z A;  3P10 A;  1KNK A;  1YQN A;  2AMT A;  1IV1 A;  1W55 A;  3F6M A;  1IV3 A;  3IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...