3MBMA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3mbmA00
3Q8HA 3GHZA 1IV4A 3F0FA 4C8IA 1H47A 1KNKA 1W57A 1IV1A 4C8EA 3JVHA 3F6MA 1KNJA 3IEQA 1YQNA 1W55A 3ELCA 4C81A 3MBMA 1T0AA 3K2XA 1JN1A 3EORA 3F0EA 3QHDA 4C8GA 1U40A 2PMPA 3KE1A 3F0GA 1VHAA 5B8FA 1H48A 3IEWA 3F0DA 1IV2A 3IKFA 3RE3A 1U3PA 3T80A 3IKEA 3P10A 1JY8A 2GZLA 4C82A 3K14A 1VH8A 3ESJA 3B6NA 3P0ZA 1U3LA 1IV3A 1U43A 2UZHA 2AMTA 3FBAA 1GX1A 3ERNA 3FPIA
chains in the Genus database with same CATH superfamily
3N2KB 1NQ3A 2AIZP 4X1YA 3LDTA 1YQNA 5GIPC 4C81A 4BT4A 2RHHA 3G4SF 1S72F 2KTVA 4TZZA 2ZAUA 3TD5A 5GAPK 3WPXA 3NK6A 3LWOC 3WGMA 5LA6B 1K8AH 1NJIH 3K14A 3RYIB 3J80M 3U0OA 1VQ4F 5LOVA 3RYHB 3LWQC 4O2AB 3FBAA 1QD9A 4TUYA 3JALA 5GANK 1VQNF 2ZVYA 4KWEA 2WALA 1QVGF 2VGNA 4YJ3A 1UI9A 5FNVB 3CCUF 3K2XA 5EIBD 1SDSA 2RHOA 3VO8A 1PXWA 2BTOA 3S02A 5LP6C 3HKCB 5CA0B 3ZOPA 3ZO8A 5AVMA 3WGNA 2H6LA 3TD4A 5EYPA 1VQLF 4ZHWA 1OFUA 4IIJB 2BTQB 3WPWA 1CK2A 5J2TB 3JASA 4BT5A 3GHZA 3S0HA 1W581 2HVYD 3F0FA 2G9IA 1ONIA 1J7HA 3LYBA 1RQ7A 3QUWA 1NMUB 4IHJA 5JCOC 4BT6A 3VCZA 1T0KB 3ON1A 1VQVA 4G4ZA 1YHQF 2CZWA 4ZHQB 3F0DA 2JNBA 3C9SA 2CW4A 3HWUA 4I55B 2ALEA 3JATB 4EI8A 1VH8A 1VQ8F 2UYNB 3UT5A 1VQOF 1W5AA 3DC2A 1IV4A 2QI2A 4B5CA 2R751 4BY9D 2IG8A 4C8EA 2Z1EA 5KX5B 4BT3A 3MCQA 3N2GB 3R0PA 4WBNB 1SA0A 2V9YA 2LCAA 3WGLA 3VYTC 1VQKF 3OBYA 4G4WA 1X7PA 1FNJA 1GZ0A 1TUBA 2HRUA 2HP0A 1JFFA 1W5BA 2I6DA 3CC4F 2OZBA 3P10A 3G71F 5IJ9A 3HKEB 3ESJA 5CA1A 4RQOA 1FFXA 2DT4A 3D01A 2Q1XA 5HY1A 2KTUA 2ZODA 4FFBA 3P4EA 3NMUC 4O2BB 3CYPB 4YJ2B 3RA6A 1W5FA 3HKBA 4TV8B 4X1KA 2YYEA 2ZF8A 5EWRA 3HAXD 2PHNA 4R40B 3SIUA 3OONA 4X1YB 3QHDA 3ZP4A 1W2BF 3VIUA 1YJWF 4O4HA 3RYFA 1KC8H 4RHAA 1CN7A 2AMTA 4ZOLA 5EIBC 3F0EA 4HNAA 2RB9A 3JCMM 5ITZA 3CCSF 5LOVB 1DBFA 2Q1YA 4E6EA 3JAKA 2Z1UA 3VI6A 4TUYB 1E7KA 2QEXF 3J81M 2EWCA 4I50A 1X7OA 4YJ3B 5JH7A 1H48A 3E22A 1R1MA 1VK3A 2Z1FA 3I56F 3S0YA 1XV2A 4DRXA 4I4TA 3VOAA 3O85A 3P0ZA 2VAPA 1IPAA 2VXYA 2Z1TA 3EORA 2HS3A 5LXTA 3Q8HA 3CPWF 2LBWA 5EYPB 2H8CA 1QVFF 4X1IA 1H47A 2L26A 1ZWZA 1IV1A 3VOBA 4EI7A 3JARA 3S03A 3CC7F 1RQ2A 2UYPA 1W5EA 3V7QA 1T0AA 1W59A 3JASB 4B45A 5BMVA 2YXZA 3PAFA 1VQ6F 1VHAA 1YJ9F 4IHJB 5MN6A 5EB0A 2QTPA 1KQSF 3I55F 4U3JB 5JCOA 3LWVC 1KD1H 4BVQA 3VYUC 2ZOVA 2BO1A 5EAZA 3V3TA 3LWPC 3C8LA 3E1YA 3JVHA 3S06A 4LNUA 1RLUA 4O4LA 3JAWA 3KIZA 3UT5B 3CCQF 3JAMM 2CSLA 2KG4A 3RA5A 1Q81H 1QAHA 5C8YA 3FD5A 3NVKE 4BW0B 2BTUA 2F9ZC 1SA0B 5KMGA 2FC3A 3BYQA 4TV9A 3D00A 3K12A 1TUBB 4O4IA 2HP0B 3HKDA 1JFFB 2OTMA 4EB6A 1Q7YH 2LBXA 3M1XA 5JQGA 4M8IA 4NQ3A 5IJ9B 5CA1B 1VQMF 1FFXB 3WGKA 3HTNA 3MDOA 1W55A 3KJJA 5IYZA 5LYJA 4G88A 4C4WC 4FFBB 4ZHVA 3N4ZA 4ZHYB 3OBWA 3WJRA 3F0GA 3HKBB 2FGYA 3IKFA 4X1KB 3IKEA 4O4JA 2HS4A 1IV3A 1TVKA 1U43A 5MN5A 3ERNA 3LFOA 4F6RA 3CPQA 4O4HB 3RYFB 1X25A 2KGWA 3NVIB 3ELCA 4ZI7A 3JATA 3N4YA 4HNAB 5ITZB 5CB4A 1YITF 1Q86H 1Q8RA 4G4YA 3IEWA 3JAKB 2Z01A 4XCQA 2GZLA 3FFMA 3ZP7A 2UYKA 2VAMA 3VYSC 1W3EX 1YI2F 3S0WA 5GINC 1JD1A 5EZYA 1CLIA 2K1SA 4I50B 5GONA 3WGJA 4DXDA 5JH7B 2N48A 2UZHA 3E22B 5JVDA 5IJ0A 3SIVA 1RLGA 3DDNA 3WJQA 2NMUA 3OW2F 1K73H 1H7MA 4I4TB 5EO3A 2MQEA 2HRYA 3IEQA 1Z5WA 3IMPA 4X20A 3WXMB 3MBMA 5LXTB 4ERHA 3JALB 1JN1A 4X1IB 1YIJF 2ZVZA 3WJPA 3M84A 1RA4A 3JARB 5HXZA 5IT9M 3J7AR 2GVIA 5J2UA 2IQQA 5HP7A 4B46A 5BMVB 1VQPF 1YGYA 4BT2A 1YJNF 5GIOC 3GYQA 3AGKA 2R6R1 2LBTA 1DT9A 5MN4A 1FNKA 3CCRF 3RYCA 5LP6A 3CB2A 1XRGA 5HP8A 4B62A 4X3MA 3KHNA 2UYJA 2RHLA 1XBIA 2OTLF 3V7EA 4LNUB 1QU9A 4O4LB 3JAWB 3CCVF 3N2KA 4G4VA 4EI9A 1VQ7F 1M1KH 5C8YB 2CHTA 3VTIC 5FJ4C 1K9MH 2AIFA 2GLZA 4BVTA 4ZK7A 3E20B 2H8EA 1KNKA 5KMGB 2OHWA 1KNJA 4TV9B 5G4UC 3KJKA 1X52A 2HX0A 5LA6A 4O4IB 3HKDB 4NWOB 1W42A 4EB6B 5JQGB 3RYIA 3L7QA 1W40A 3RYHA 2P6YA 1XHOA 4O2AA 1VQ5F 1PF5A 3QTYA 1IV2A 1GO0A 3RE3A 1U3PA 5HY4A 5EB1B 2VAWA 5IYZB 5LYJB 3PLAC 4G4XA 1U3LA 1OAPA 1N8RH 5FNVA 3C9UA 4O4JB 2VGMA 1W57A 4X3LA 4BVSA 5G4VC 3CXCF 2B33A 3HKCA 5CA0A 3VMFB 1TVKB 3CCMF 4F6RB 4NUTA 3FD6A 4U3JA 3GTZA 3CG6A 5A2QM 4U39A 4C8GA 1U40A 4IIJA 3M4SA 3V4DA 3LWRC 1JJ2F 2CWJA 1FSZA 3T80A 4ZI7B 5J2TA 1SZQA 2RHJA 2I6RA 5CB4B 3B6NA 1VQ9F 2CHSA 1COMA 1GX1A 5HXUA 3FPIA 3MCAB 3I3FA 4C8IA 3CYQA 4BT7A 3F6MA 3LMEA 5EZYB 4ZHQA 5GONB 5HY0A 5JVDB 3C9RA 4I55A 3D54A 2CVLA 5IJ0B 4ZOLB 3K0TA 3NK7A 3IR9A 1Z5VA 2PMPA 2UYNA 5B8FA 3CD6F 4X20B 1Q82H 3CMEF 3C9TA 2W8BC 1GO1A 4BVRA 5KX5A 3TD3A 3N2GA 4WBNA 5J2UB 1ODEA 2HS0A 3CCJF 4DRXB 4PWTA 2HP3A 2IAFA 3I7TA 5HY2A 3HKEA 3G6EF 3CMAF 3RYCB 2DYYA 3KE1A 2HQSC 5LP6B 3CCEF 5DCVA 1M90H 1JY8A 3CC2F 1W41A 4C82A 2OTJF 5HWEA 4O2BA 5FLXM 4YJ2A 2QA4F 3MQWA 4TV8A 3HJWC 3CCLF 1UFYA 4LCKA
chains in the Genus database with same CATH topology
3Q8HA 3GHZA 1IV4A 3F0FA 4C8IA 1H47A 1KNKA 1W57A 1IV1A 4C8EA 3JVHA 3F6MA 1KNJA 3IEQA 1YQNA 1W55A 3ELCA 4C81A 3MBMA 1T0AA 3K2XA 1JN1A 3EORA 3F0EA 3QHDA 4C8GA 1U40A 2PMPA 3KE1A 3F0GA 1VHAA 5B8FA 1H48A 3IEWA 3F0DA 1IV2A 3IKFA 3RE3A 1U3PA 3T80A 3IKEA 3P10A 1JY8A 2GZLA 4C82A 3K14A 1VH8A 3ESJA 3B6NA 3P0ZA 1U3LA 1IV3A 1U43A 2UZHA 2AMTA 3FBAA 1GX1A 3ERNA 3FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8H A;  3GHZ A;  1IV4 A;  3F0F A;  4C8I A;  1H47 A;  1KNK A;  1W57 A;  1IV1 A;  4C8E A;  3JVH A;  3F6M A;  1KNJ A;  3IEQ A;  1YQN A;  1W55 A;  3ELC A;  4C81 A;  3MBM A;  1T0A A;  3K2X A;  1JN1 A;  3EOR A;  3F0E A;  3QHD A;  4C8G A;  1U40 A;  2PMP A;  3KE1 A;  3F0G A;  1VHA A;  5B8F A;  1H48 A;  3IEW A;  3F0D A;  1IV2 A;  3IKF A;  3RE3 A;  1U3P A;  3T80 A;  3IKE A;  3P10 A;  1JY8 A;  2GZL A;  4C82 A;  3K14 A;  1VH8 A;  3ESJ A;  3B6N A;  3P0Z A;  1U3L A;  1IV3 A;  1U43 A;  2UZH A;  2AMT A;  3FBA A;  1GX1 A;  3ERN A;  3FPI A; 
#chains in the Genus database with same CATH topology
 3N2K B;  1NQ3 A;  2AIZ P;  4X1Y A;  3LDT A;  1YQN A;  5GIP C;  4C81 A;  4BT4 A;  2RHH A;  3G4S F;  1S72 F;  2KTV A;  4TZZ A;  2ZAU A;  3TD5 A;  5GAP K;  3WPX A;  3NK6 A;  3LWO C;  3WGM A;  5LA6 B;  1K8A H;  1NJI H;  3K14 A;  3RYI B;  3J80 M;  3U0O A;  1VQ4 F;  5LOV A;  3RYH B;  3LWQ C;  4O2A B;  3FBA A;  1QD9 A;  4TUY A;  3JAL A;  5GAN K;  1VQN F;  2ZVY A;  4KWE A;  2WAL A;  1QVG F;  2VGN A;  4YJ3 A;  1UI9 A;  5FNV B;  3CCU F;  3K2X A;  5EIB D;  1SDS A;  2RHO A;  3VO8 A;  1PXW A;  2BTO A;  3S02 A;  5LP6 C;  3HKC B;  5CA0 B;  3ZOP A;  3ZO8 A;  5AVM A;  3WGN A;  2H6L A;  3TD4 A;  5EYP A;  1VQL F;  4ZHW A;  1OFU A;  4IIJ B;  2BTQ B;  3WPW A;  1CK2 A;  5J2T B;  3JAS A;  4BT5 A;  3GHZ A;  3S0H A;  1W58 1;  2HVY D;  3F0F A;  2G9I A;  1ONI A;  1J7H A;  3LYB A;  1RQ7 A;  3QUW A;  1NMU B;  4IHJ A;  5JCO C;  4BT6 A;  3VCZ A;  1T0K B;  3ON1 A;  1VQV A;  4G4Z A;  1YHQ F;  2CZW A;  4ZHQ B;  3F0D A;  2JNB A;  3C9S A;  2CW4 A;  3HWU A;  4I55 B;  2ALE A;  3JAT B;  4EI8 A;  1VH8 A;  1VQ8 F;  2UYN B;  3UT5 A;  1VQO F;  1W5A A;  3DC2 A;  1IV4 A;  2QI2 A;  4B5C A;  2R75 1;  4BY9 D;  2IG8 A;  4C8E A;  2Z1E A;  5KX5 B;  4BT3 A;  3MCQ A;  3N2G B;  3R0P A;  4WBN B;  1SA0 A;  2V9Y A;  2LCA A;  3WGL A;  3VYT C;  1VQK F;  3OBY A;  4G4W A;  1X7P A;  1FNJ A;  1GZ0 A;  1TUB A;  2HRU A;  2HP0 A;  1JFF A;  1W5B A;  2I6D A;  3CC4 F;  2OZB A;  3P10 A;  3G71 F;  5IJ9 A;  3HKE B;  3ESJ A;  5CA1 A;  4RQO A;  1FFX A;  2DT4 A;  3D01 A;  2Q1X A;  5HY1 A;  2KTU A;  2ZOD A;  4FFB A;  3P4E A;  3NMU C;  4O2B B;  3CYP B;  4YJ2 B;  3RA6 A;  1W5F A;  3HKB A;  4TV8 B;  4X1K A;  2YYE A;  2ZF8 A;  5EWR A;  3HAX D;  2PHN A;  4R40 B;  3SIU A;  3OON A;  4X1Y B;  3QHD A;  3ZP4 A;  1W2B F;  3VIU A;  1YJW F;  4O4H A;  3RYF A;  1KC8 H;  4RHA A;  1CN7 A;  2AMT A;  4ZOL A;  5EIB C;  3F0E A;  4HNA A;  2RB9 A;  3JCM M;  5ITZ A;  3CCS F;  5LOV B;  1DBF A;  2Q1Y A;  4E6E A;  3JAK A;  2Z1U A;  3VI6 A;  4TUY B;  1E7K A;  2QEX F;  3J81 M;  2EWC A;  4I50 A;  1X7O A;  4YJ3 B;  5JH7 A;  1H48 A;  3E22 A;  1R1M A;  1VK3 A;  2Z1F A;  3I56 F;  3S0Y A;  1XV2 A;  4DRX A;  4I4T A;  3VOA A;  3O85 A;  3P0Z A;  2VAP A;  1IPA A;  2VXY A;  2Z1T A;  3EOR A;  2HS3 A;  5LXT A;  3Q8H A;  3CPW F;  2LBW A;  5EYP B;  2H8C A;  1QVF F;  4X1I A;  1H47 A;  2L26 A;  1ZWZ A;  1IV1 A;  3VOB A;  4EI7 A;  3JAR A;  3S03 A;  3CC7 F;  1RQ2 A;  2UYP A;  1W5E A;  3V7Q A;  1T0A A;  1W59 A;  3JAS B;  4B45 A;  5BMV A;  2YXZ A;  3PAF A;  1VQ6 F;  1VHA A;  1YJ9 F;  4IHJ B;  5MN6 A;  5EB0 A;  2QTP A;  1KQS F;  3I55 F;  4U3J B;  5JCO A;  3LWV C;  1KD1 H;  4BVQ A;  3VYU C;  2ZOV A;  2BO1 A;  5EAZ A;  3V3T A;  3LWP C;  3C8L A;  3E1Y A;  3JVH A;  3S06 A;  4LNU A;  1RLU A;  4O4L A;  3JAW A;  3KIZ A;  3UT5 B;  3CCQ F;  3JAM M;  2CSL A;  2KG4 A;  3RA5 A;  1Q81 H;  1QAH A;  5C8Y A;  3FD5 A;  3NVK E;  4BW0 B;  2BTU A;  2F9Z C;  1SA0 B;  5KMG A;  2FC3 A;  3BYQ A;  4TV9 A;  3D00 A;  3K12 A;  1TUB B;  4O4I A;  2HP0 B;  3HKD A;  1JFF B;  2OTM A;  4EB6 A;  1Q7Y H;  2LBX A;  3M1X A;  5JQG A;  4M8I A;  4NQ3 A;  5IJ9 B;  5CA1 B;  1VQM F;  1FFX B;  3WGK A;  3HTN A;  3MDO A;  1W55 A;  3KJJ A;  5IYZ A;  5LYJ A;  4G88 A;  4C4W C;  4FFB B;  4ZHV A;  3N4Z A;  4ZHY B;  3OBW A;  3WJR A;  3F0G A;  3HKB B;  2FGY A;  3IKF A;  4X1K B;  3IKE A;  4O4J A;  2HS4 A;  1IV3 A;  1TVK A;  1U43 A;  5MN5 A;  3ERN A;  3LFO A;  4F6R A;  3CPQ A;  4O4H B;  3RYF B;  1X25 A;  2KGW A;  3NVI B;  3ELC A;  4ZI7 A;  3JAT A;  3N4Y A;  4HNA B;  5ITZ B;  5CB4 A;  1YIT F;  1Q86 H;  1Q8R A;  4G4Y A;  3IEW A;  3JAK B;  2Z01 A;  4XCQ A;  2GZL A;  3FFM A;  3ZP7 A;  2UYK A;  2VAM A;  3VYS C;  1W3E X;  1YI2 F;  3S0W A;  5GIN C;  1JD1 A;  5EZY A;  1CLI A;  2K1S A;  4I50 B;  5GON A;  3WGJ A;  4DXD A;  5JH7 B;  2N48 A;  2UZH A;  3E22 B;  5JVD A;  5IJ0 A;  3SIV A;  1RLG A;  3DDN A;  3WJQ A;  2NMU A;  3OW2 F;  1K73 H;  1H7M A;  4I4T B;  5EO3 A;  2MQE A;  2HRY A;  3IEQ A;  1Z5W A;  3IMP A;  4X20 A;  3WXM B;  3MBM A;  5LXT B;  4ERH A;  3JAL B;  1JN1 A;  4X1I B;  1YIJ F;  2ZVZ A;  3WJP A;  3M84 A;  1RA4 A;  3JAR B;  5HXZ A;  5IT9 M;  3J7A R;  2GVI A;  5J2U A;  2IQQ A;  5HP7 A;  4B46 A;  5BMV B;  1VQP F;  1YGY A;  4BT2 A;  1YJN F;  5GIO C;  3GYQ A;  3AGK A;  2R6R 1;  2LBT A;  1DT9 A;  5MN4 A;  1FNK A;  3CCR F;  3RYC A;  5LP6 A;  3CB2 A;  1XRG A;  5HP8 A;  4B62 A;  4X3M A;  3KHN A;  2UYJ A;  2RHL A;  1XBI A;  2OTL F;  3V7E A;  4LNU B;  1QU9 A;  4O4L B;  3JAW B;  3CCV F;  3N2K A;  4G4V A;  4EI9 A;  1VQ7 F;  1M1K H;  5C8Y B;  2CHT A;  3VTI C;  5FJ4 C;  1K9M H;  2AIF A;  2GLZ A;  4BVT A;  4ZK7 A;  3E20 B;  2H8E A;  1KNK A;  5KMG B;  2OHW A;  1KNJ A;  4TV9 B;  5G4U C;  3KJK A;  1X52 A;  2HX0 A;  5LA6 A;  4O4I B;  3HKD B;  4NWO B;  1W42 A;  4EB6 B;  5JQG B;  3RYI A;  3L7Q A;  1W40 A;  3RYH A;  2P6Y A;  1XHO A;  4O2A A;  1VQ5 F;  1PF5 A;  3QTY A;  1IV2 A;  1GO0 A;  3RE3 A;  1U3P A;  5HY4 A;  5EB1 B;  2VAW A;  5IYZ B;  5LYJ B;  3PLA C;  4G4X A;  1U3L A;  1OAP A;  1N8R H;  5FNV A;  3C9U A;  4O4J B;  2VGM A;  1W57 A;  4X3L A;  4BVS A;  5G4V C;  3CXC F;  2B33 A;  3HKC A;  5CA0 A;  3VMF B;  1TVK B;  3CCM F;  4F6R B;  4NUT A;  3FD6 A;  4U3J A;  3GTZ A;  3CG6 A;  5A2Q M;  4U39 A;  4C8G A;  1U40 A;  4IIJ A;  3M4S A;  3V4D A;  3LWR C;  1JJ2 F;  2CWJ A;  1FSZ A;  3T80 A;  4ZI7 B;  5J2T A;  1SZQ A;  2RHJ A;  2I6R A;  5CB4 B;  3B6N A;  1VQ9 F;  2CHS A;  1COM A;  1GX1 A;  5HXU A;  3FPI A;  3MCA B;  3I3F A;  4C8I A;  3CYQ A;  4BT7 A;  3F6M A;  3LME A;  5EZY B;  4ZHQ A;  5GON B;  5HY0 A;  5JVD B;  3C9R A;  4I55 A;  3D54 A;  2CVL A;  5IJ0 B;  4ZOL B;  3K0T A;  3NK7 A;  3IR9 A;  1Z5V A;  2PMP A;  2UYN A;  5B8F A;  3CD6 F;  4X20 B;  1Q82 H;  3CME F;  3C9T A;  2W8B C;  1GO1 A;  4BVR A;  5KX5 A;  3TD3 A;  3N2G A;  4WBN A;  5J2U B;  1ODE A;  2HS0 A;  3CCJ F;  4DRX B;  4PWT A;  2HP3 A;  2IAF A;  3I7T A;  5HY2 A;  3HKE A;  3G6E F;  3CMA F;  3RYC B;  2DYY A;  3KE1 A;  2HQS C;  5LP6 B;  3CCE F;  5DCV A;  1M90 H;  1JY8 A;  3CC2 F;  1W41 A;  4C82 A;  2OTJ F;  5HWE A;  4O2B A;  5FLX M;  4YJ2 A;  2QA4 F;  3MQW A;  4TV8 A;  3HJW C;  3CCL F;  1UFY A;  4LCK A; 
#chains in the Genus database with same CATH homology
 3Q8H A;  3GHZ A;  1IV4 A;  3F0F A;  4C8I A;  1H47 A;  1KNK A;  1W57 A;  1IV1 A;  4C8E A;  3JVH A;  3F6M A;  1KNJ A;  3IEQ A;  1YQN A;  1W55 A;  3ELC A;  4C81 A;  3MBM A;  1T0A A;  3K2X A;  1JN1 A;  3EOR A;  3F0E A;  3QHD A;  4C8G A;  1U40 A;  2PMP A;  3KE1 A;  3F0G A;  1VHA A;  5B8F A;  1H48 A;  3IEW A;  3F0D A;  1IV2 A;  3IKF A;  3RE3 A;  1U3P A;  3T80 A;  3IKE A;  3P10 A;  1JY8 A;  2GZL A;  4C82 A;  3K14 A;  1VH8 A;  3ESJ A;  3B6N A;  3P0Z A;  1U3L A;  1IV3 A;  1U43 A;  2UZH A;  2AMT A;  3FBA A;  1GX1 A;  3ERN A;  3FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...