4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
4E6EA 3V3TA 4O4IB 1W5FA 5CA1B 5JVDB 2GVIA 4ZI7A 4ZHQB 1Z5WA 5ITZA 2R6R1 5LP6A 4XCQA 5EZYA 1Z5VA 2BTQA 1TUBB 4O4HA 4TV9B 5EIBD 1RQ7A 5EYPB 4B45A 3RYHB 5J2UB 3HKEA 3HKBB 4X20A 5IJ0B 4IIJA 5GONB 5IJ9A 4EI8A 4X1IB 5LA6B 5CA1A 4O2AA 3RYIB 1TVKA 3JARB 3RB8A 3JAWB 4WBNA 2XKAA 4TV8B 2BTOA 4TV9A 5KX5B 5FNVB 3WGKA 4FFBA 5EYPA 5C8YB 5IYZB 1RQ2A 5MN5A 4HNAB 4I55B 5CA0B 4EB6B 4LNUA 1FSZA 1W5EA 5MN4A 3HKDB 5GONA 5LXTA 1W5AA 3C8LA 5LA6A 2VAWA 3N2GA 3UT5A 5LOVB 3JALB 3RYFA 3JASA 3JATA 4IHJB 4X1KA 4KWEA 3RYIA 3JARA 3RYCB 1FFXB 3E22B 3JAWA 4O4JB 5BMVB 5J2TB 5EIBC 3WGJA 1W581 3JAKB 3WGNA 4DRXB 5CB4B 5KMGA 2VAMA 4HNAA 4M8IA 4I55A 5JCOC 3WGMA 4O4IA 5JVDA 5CA0A 4EB6A 1W59A 4ZHQA 2VAPA 5JQGB 3HKDA 4B46A 5LYJB 4F6RB 4O4LB 4EI9A 4I4TB 2XKBA 3JALA 4IHJA 3N2KB 5JH7B 1TUBA 1FFXA 5J2TA 1JFFB 5LP6C 4X1YB 5BMVA 2RHLA 3JAKA 4O2BB 3RYHA 5J2UA 4ZOLB 4DRXA 3HKBA 5IJ0A 3WGLA 5MN6A 4X1IA 1SA0B 4YJ3B 4I50B 5JQGA 5LYJA 4F6RA 2R751 4ZI7B 5M7EA 3ZBPA 3N2KA 4TV8A 5ITZB 5JH7A 5KX5A 5FNVA 5IYZA 1JFFA 5C8YA 3R4VA 2BTQB 4O4HB 4DXDA 3VOAA 3HKCB 2RHHA 3HKEB 3M89A 4YJ3A 4I50A 5LOVA 3VPAA 5IJ9B 4YJ2B 2VXYA 3RYCA 1OFUA 3E22A 4O2AB 4O4JA 3VO8A 2RHOA 3M8KA 1TVKB 2Q1YA 4U3JB 3VO9A 4WBNB 5CB4A 3CB2A 2Q1XA 4FFBB 4TUYB 3HKCA 4O4LA 4I4TA 1RLUA 4LNUB 5LXTB 4YJ2A 4U39A 5LP6B 3N2GB 3UT5B 3RYFB 3JASB 3JATB 4X1KB 4X1YA 5EZYB 4O2BA 3VOBA 3ZIDA 3ZBQA 4U3JA 4ZOLA 5JCOA 1SA0A 4TUYA 5KMGB 2RHJA 4EI7A 4X20B 1W5BA 4IIJB
chains in the Genus database with same CATH superfamily
2VEOA 4KOEC 1XROA 1R4ZA 1N4AA 3TNYA 4S12A 3QKTA 3ILVA 3NT5A 2G83A 3USZA 4OU5A 4R9SA 3ILXA 4R50A 1EA7A 4I36A 2FDRA 1VRVA 4QDZA 3N28A 2GFHA 5UKDA 4MVJH 2IOFA 1EQ2A 2FA9A 4XB1A 2YDYA 5F64A 2FEXA 2OBYA 1GO0A 1L7EA 1QKKA 1XZDA 2ZXFA 3I34X 2P4KA 5HF8A 1ROPA 4OIFA 2WTMA 2EWMA 2R6GA 4Q9DA 2OK7A 3PUJA 1Q15A 4KI0A 1NX9A 2DQ3A 3RRMA 2BGLA 4UTZA 4F4JA 5D6NA 4QASA 3WWDA 4E21A 3K96A 1TLTA 2FPXA 2WJHA 5BVGA 5E1OA 4J0QA 5FPOA 5FADA 2TMGA 3WFJA 3G2JA 1Q7GA 2G9VA 1X7XB 1ZEJA 4YT4A 1IY1A 2R6FA 3HYNA 2IP4A 3A2LA 2B3DA 3UAVA 1H8HD 1I4OA 4TYNA 4KXMA 1KHTA 2IYTA 1CIJA 3R9WA 4B7ZA 3N4ZA 3DKRA 1E3WA 1Y6RA 2D7DA 1FFYA 1YK1A 4Z4FA 1JG1A 3DBLA 1KI4A 4IDFA 4XX0A 1G60A 3H99A 2G9NA 2ZM6B 5A3VA 4R81A 5FBHA 4OHMA 3LQQA 5JMWA 1DWUA 1RFYA 2HRYA 3CJRA 2QN2A 4C14A 4IVPA 1DAEA 3B1YA 4KRGA 3SEAA 2GZAA 4KVFA 1Z13A 2GESA 5I5EA 3VYRB 4AO7A 1HZZA 2Z1MA 5DI3A 4L2IB 3REFA 2OKGA 1GM9A 4R7ZA 5AJZA 4K28A 4R0NA 3X1KA 3EEYA 5GONF 3N0WA 3MGCA 1DEHA 5EIOA 4IF6A 2PHNA 5EZ6B 2B33A 2XCQA 2ERYA 1DF5A 3LNNA 1QP8A 1BQ0A 1VTKA 4P80A 3A3OA 4NDAA 5HY4A 5FB3A 5CB4B 2PJUA 3MDSA 3TINA 2EDAA 2O0JA 4MRNA 2YUTA 3GHHA 2JJ2D 2Q5CA 3F8TA 3MHTA 5D3ZA 3AEXA 3ZS8A 3WAGA 1D8AA 4O33A 2W43A 1A98A 1CJVC 1J8YF 3ESBA 1QZTA 1DCKA 3ZBPA 3ZVMA 3EARA 3BF8A 3RIMA 1G9XA 3VUFA 5A7GA 4HDRB 3TW6A 3ZN2A 3JQAB 1QGUA 1DPFA 1UODA 5IYCO 4RXUA 3IPAA 5DJ5A 3LFUA 3RS5A 1H42A 2DHQA 2XBLA 2RJZA 4X1KB 1FDSA 4ENTA 3NKVA 5AHXA 3LW8A 5E1AC 3TIIA 3QMPA 5JXGA 4JYAO 4CLOB 4JBIA 1IZ0A 2J9XB 4Y6PA 5FKJA 2W6NA 2CHGA 3ICPA 4J76A 4EPTA 3OIDA 2BN4A 3PLNA 5K8VA 3VVCA 4A2WA 2D00A 3CCMF 3ZE7A 4NE2A 1ENOA 1YIOA 3P0HA 5TNXA 1N7HA 3CS3A 1QVGF 2WLHA 3BRCA 4JLAA 5F5NA 4PYIA 1FFTB 3ZKWB 1T2EA 1SUPA 4FZRA 3KUXA 1QYDA 4OYYA 1ZR2A 1LD3A 4F2PA 1T2NA 2KTVA 4BEJA 1SXQA 1R27A 3WSWA 2B4KA 2BSKA 1V95A 3ER9A 2ZXWB 3IFXA 4QLOA 3I04A 4NR0A 3BGWA 4XIIA 2NLJC 1RCUA 2X7JA 3K9FC 5AVZA 5I7UA 5C1IA 2OTCA 5LP6B 4ZVQA 2HK9A 4KQHA 3GAAA 2V58A 1WHTB 2BZSA 2W8BC 3T95A 4N3BA 3COVA 3OOWA 4BUCA 1ZM7A 3SYOA 3HI4A 1QIHA 3NKFA 5C1DA 4RUFA 3KQMA 1XPOA 1BXGB 1ZXXA 3QKRA 3W05A 4DSAA 5ELMA 4OQ4A 2NXCA 1I51A 2R6HA 2V6MA 5ALVA 4OJMX 1JQJC 5C8YB 5F3RA 2NTJA 2YZMA 3L0DA 4GGOA 5CXQA 4A8HA 5TC4A 2P79A 2A4KA 1G8HA 2YJ5A 1HNZB 3TAUA 3LXXA 4RTOA 3G89A 1ZBDA 3UENA 3KIPA 1UT8A 1M1YA 3Q1KA 4J07A 5DXFA 2QTBA 3UTCA 4P35A 2WLLB 5JH7A 2CXNA 1SOWA 1KDVA 4DJTA 4OX9Y 3LCRA 3V6LA 3PGVA 3ZWAA 2ZUUA 4EL0A 5C8ZA 3A0HZ 2IK8A 2ZSHA 4IG9A 3UV7A 3KJJA 3LHDA 3GZ4A 1UMCA 3JASB 3E53A 5K20A 1ZU4A 4P7GA 1YFJA 2RK6A 4QL3A 1SU7A 2V74B 5IASA 1B8NA 1DQYA 2GBLC 1YS4A 3I9MA 1X52A 4KWCA 3QVLA 3ICVA 4Q9NA 2VWHA 1Q19A 3MT0A 4CDRA 2QTVB 1WUJS 2OP1A 2J7KA 2H29A 3EFFK 3EODA 1AVTA 5DM1A 4C7OB 4BMYA 2ZZNA 1SVOA 4RWZA 2QYSA 4L74A 3Q9NA 3H2GA 3CUUA 1VLHA 4UCVA 1KK1A 2VOJA 2JAPA 4CV3A 5COBA 1N0NA 3WK6A 4MDYA 3O47A 1DEAA 4UFPA 2C99A 1T1JA 3O8OB 2C94A 4LVCA 1L0NH 2GRUA 4A1OA 3LT2A 3KVOA 3THRA 4DIOA 2FZEA 1SBIA 3T5PA 4WKCA 3MDOA 1GSOA 3D0OA 2NSYA 1JR4A 4XSVA 4IKOA 4IFTA 2LPMA 4GKJO 3ZE8A 1MFZA 3A4LA 4O3FA 4GRIA 1Y4AE 3G1WA 1XTJA 1E1KA 4GRDA 4ZV7A 5AM0A 3N87A 2FYUH 4R1MA 1THGA 1E3WB 4RCVA 4WJZA 1LPBB 3OEWA 1F8FA 2DPLA 2IJIA 4XX0B 4Q9KA 4EEXA 2VIIA 2CE4A 3YASA 5F2KA 3HCCA 3SMQA 1QK5A 1H48A 3DVAB 3HKDA 1QLNA 3LGSA 1NQXA 1FJGB 3DSRA 1HOXA 1JQDA 1UWVA 4BAYA 4RIGA 3W8EA 1GGMA 2B35A 1IQRA 4YT5A 1RQGA 4QGPA 1WTCA 2O06A 3AM5A 3JD0A 4LF8O 2DHCA 1P39A 2H31A 4RVCA 2CL6X 1HBJA 3G4SV 4IXWA 2XYHA 3VR0A 5C5IA 9ABPA 2QTHA 4R1UA 5J4LA 4ICGA 4RF5A 3ON1A 3UMFA 4QT0A 4AMVA 2ANBA 5T6MA 3W8FA 1LU9A 1FYXA 4BGEA 3QKIA 3EFBA 4BQRA 5EXEA 4OHBA 3Q5DA 2FUKA 3S2IA 3ASYA 4LP8A 2FMUA 3EB9A 4WQMA 3PWSA 2H6EA 2AR9A 1PU2A 1P1IA 2QMZA 4Z4IA 4PX2A 3RFRA 4L8GA 1L4FA 4RHFA 5DVZA 1H05A 3OY7A 1AQIA 1AMOA 2AC2A 4BVKA 3MAAC 5FOSA 1XZPA 2EL7A 4RU1A 2OO5C 4RJTA 1M5IA 2I3ZA 4PAOA 2B1RA 2R4UA 2VJPA 5CT4A 4YREA 1A8UA 4PSKA 3HJTA 2P9YA 3OFNA 3KHNA 3MMZA 4NDNE 3RFFA 3FOWA 4BV3A 1T5BA 1RIFA 7AT1A 4YJDA 3LQRA 3GV0A 1AKTA 2VF2A 3ELUA 2GLXA 2EYQA 4PLWA 3A04A 2OCDA 1WSWA 3HSSA 5JYCA 3NBFA 4AJJA 2NG1A 1U3CA 1ZRNA 3KKEA 5H9CA 1QLEB 1UWKA 3HS3A 2E6UX 3I09A 4TT3G 1UF9A 3V8RA 5C5EA 4MW3A 4DBLC 2K7FA 1E6LA 5IF3A 4IVNA 5FF9A 4B8ZA 4EZEA 3U49A 3QVSA 3QFRA 2ZJ4A 1XPUA 1NL3A 1PK8A 4DMCA 2R8OA 1TLFA 1I3NA 2VWPA 2OBNA 4G5SA 4A36A 4KQ6A 1Q5PA 3KAJA 3HWX1 1Y3CE 2YHAA 1OU4A 3NX4A 2IHVA 5U1PA 1Z2AA 3AQ4A 4ISCA 4NC9A 2H92A 2O0KA 2JS3A 1UJ2A 5DWQA 3QKRB 4N5IX 1Z16A 2X7XA 5KTKA 3C16C 4C4ZA 2VDJA 3VBEA 4BFSA 1Q7TA 5ECDA 4GGMX 2PBRA 3TQTA 1P7VA 3JQFC 5DTJA 5C8DA 1PZNA 2JI9A 4PELA 3PT9A 3H9VA 3T1HO 1J5EB 1R3LC 3IAM1 1P45A 3CT4A 1OJLA 2PZMA 3D43A 4NZ9A 4LEIA 3C3XA 4MWCA 5HIAA 1OFUX 1KSJA 2HVJC 4IWYA 1S8NA 3L46A 1UFIA 1EEHA 2IYUA 4Y98A 2BBOA 5B5SA 4P7BA 2Z8XA 5JH7B 3UK2A 2RC5A 1U94A 1D09A 3WLMA 3HN6A 2FVYA 3LL4A 5T64A 2WU4A 1X1TA 3V8VA 2ZIZA 2E4ZA 1EWTA 4EG4A 1UMCB 2LBWA 3HCBA 4ITRC 2JJ1A 4JBNA 1XMVA 2ZUTA 4RTNA 3A37A 1GTOA 1MGOA 2E4VA 2P2LA 3PFHA 2Y1GA 1FRNA 3WRYA 4MRSA 2QN7A 1J99A 1I5OA 1AILA 4YCAA 1YITV 3SNHA 3UCEA 2NU7A 5KYXA 4UM9D 5KB3A 3U4AA 1OY1A 5KYWA 4F56A 3PXAA 1QYWA 1MFPA 4WXRA 4OHYA 1SHLA 4GX0A 1H7MA 4U7GA 1NY6A 2RSLA 1NVVR 4AWAA 2I2DA 5NLLA 1TJ3A 4WCFB 5CR9A 2FFQA 2WJGA 5E0KB 4XTCS 2W48A 2O7NA 4GAEA 1C0PA 1W96A 1JALA 5IZCC 4R1SA 1N2CA 3LRXA 5HWEA 2X42A 3WGTA 3RS9A 3HBMA 3M6UA 3EMVA 4TTRA 2J0UA 3PXCX 2JASA 3CBGA 4XM1A 5CUQA 3PYMA 4UCQA 4EYKA 3KKKA 5BWMA 4DKJA 5AT1A 2R6R1 2O8EA 5AUOB 1AKUA 1XZJA 2QRZA 2PRYA 3VQWA 2FE4A 3GU3A 5GADl 2SBTA 3PJGA 4PLGA 2P27A 3EMKA 1VQNF 5C52B 5H59A 2XVAA 3HKDB 4QQFA 1R6KA 1UINA 5BOSB 3ZDQA 1THTA 3OPQA 5DGTA 4NCIA 2OFWA 3MGAA 3PHBE 5DEOA 2C82A 3KU1A 3QLVA 4CV1A 1QQBA 4CMEC 5BWBA 3KALA 1GTG1 5AM2A 2O3RA 1OCZB 1JDZA 4IGEA 2N0SA 1KP9A 3U1BA 2FZ4A 5JMOA 4YRGA 3WLHA 3I0MA 3GUHA 1EVKA 5EQDA 1Q7CA 4ZAZA 4ZVSA 4JC8A 1ADFA 3VYTB 1I3KA 3IBFA 2VR1A 2C7OA 2VDQB 3OC6A 4O4LA 1YHQV 1XCGB 3ZWVA 2PJZA 3F78A 2H0RA 4UARA 1K68A 3URMA 4E2ZA 4MW0A 3TL2A 5CVDA 2WJ3A 2Z3VA 1T0BA 4ZVNA 5I7SA 5TVKA 4M0UA 4J29A 1LDBA 2UVDA 3ZNNA 5IYDO 1ATZA 3ZJZA 1J97A 4D99A 4F2DA 3K70D 1V37A 4DC9A 4NPHA 3GVXA 2YEVA 1T3HA 4L27A 2ZU6A 1WHSA 3KWFA 5TVGA 1N34O 4LXGA 2K7ZA 2F55A 4H18A 3ZHVA 4ZP1A 4BMZA 4MPRA 3MF4A 2C4TA 4P81A 1KDYA 2I71A 1VEWA 1WW3A 3DJFA 1A5ZA 1Q44A 1RLTA 2IKQA 2ILVA 2Q3JA 4FWTA 1M6HA 1MCZA 3ZI7A 1T10A 4ITUA 2C7VA 4TSKA 1YUBA 2NUBA 4N7BA 3VR3A 3LHKA 1GCAA 1SQFA 4BQIA 4S1WA 1Y9JA 2M7WA 4HZUA 1AQJA 2QX7A 1QBKC 2QRHA 4N6OA 5GQSA 2R0QC 2CWJA 3MIZA 2B1JA 3HJGA 2PR2A 2A3RA 4EHNA 1NUSA 1VJRA 4F3RA 4GFDA 4IHJF 5FFFA 5KHIA 5F1KA 1E8NA 1FJXA 4BMPB 3I62A 3V4PB 4RVFA 2EHJA 3O3OB 3RC9A 2ETNA 1HG1A 3LGAA 2FV8A 1K4KA 3FD9A 1YR7A 4D6PA 2ZB4A 5BY2A 1HI9A 5B36A 2QB5A 4DLKA 1FFBA 3KJXA 4FFVA 1JQ0A 4TKLA 4RMGA 3TL3A 2Q69A 3OEED 3DFFA 4KGDA 4E70A 2V7UA 5D3QA 2ZSBA 1P0QA 2HRDA 5L3VA 5G4UC 1U7TA 1RCTE 1Q6UA 2BYTA 2P6PA 4B3RB 3MLEA 4KAFA 3E1KA 2OCHA 2XB4A 1ZICA 1OV9A 4GH5A 3CXRA 5T6BA 1QAMA 3N8NA 1XMSA 3RD5A 1IM8A 2XT6A 3DF7A 5EC1C 4N40A 1VQ4F 5I8WA 1L1QA 2GZHA 2X6BA 4F46A 3D8RA 3K58A 3CE6A 4PRKA 2GB4A 4E3WA 5FLXA 4DZTA 2YOGA 5EJ2A 3DR5A 4JB3A 4EA9A 4NYJQ 5C8XA 1EVYA 4DCVA 3JWHA 2D1SA 3IT0A 2ZRFA 2XR1A 5AM4A 2WSMA 1JH8A 4J41A 2JAXA 4KN9S 4O2LA 2CLCX 1P7YA 2BLNA 3SYNA 3GDGA 3LWZA 4TL9A 2OGZA 3KBOA 4DXDA 3HJFA 3W2GA 2WHXA 1U0OC 2D13A 3MBOA 2Z2ZA 1D5CA 1Z6YA 2UZ1A 4OJQA 2JVKA 3DMGA 1KNJA 1V7PC 3APQA 2CT8A 3PUZA 4P92A 4TLCA 3Q7SA 1VSVA 2NU7B 4Z2AA 4MHOA 3K0EA 3NGLA 4WFBV 1EHIA 5KYWB 4R7CA 3DL4A 2FW0A 1EP2B 1C80A 2Y4OA 2MK3A 1W36B 1AX9A 3R6TA 4X3PA 1HTWA 4WVFA 4E5PA 2H18A 1L7QA 2OIGA 8GPBA 2L17A 4BVJA 1GR1A 5KJFA 3ZOKA 1NXOA 1CX9B 1NW7A 2IYAA 4ER7A 3TSWA 2MR5A 5E4JA 4UE2A 3OIVA 5FNVA 2J0UB 4I99A 1JR3A 1IWOA 3ZCPA 2J85A 1G6KA 3OBIA 2PZEA 2D8AA 3GLIA 3NBXX 2OHFA 4IKPA 3BA6A 1UEJA 1OTHA 2DECA 1VRCA 3JVEA 4C07A 5DX8A 3KS9A 2QI9F 4RSRA 5HKAA 1BROA 5AJWA 4JYYA 1M2VB 3LDAA 3B78A 1TIBA 4KWIA 1VQ7V 4BP9A 5J59A 3AHIA 1HT1E 3BMXA 3W8RA 5BN1A 2WHRA 2WSSG 1MOSA 1GU1A 3RCBA 4YRJA 4U2EA 2RJNA 1Q7YW 1HDJA 4RQEA 4ETMA 3BZBA 1YCGA 3QWBA 4MVJD 4LYYA 2P75A 4E5MA 2Y1WA 1VPVA 1CLEA 3E8SA 3PAFA 2CMGA 4EFMA 2YHUA 4ZEMA 5FOVA 1Y7LA 1W0KD 3GEDA 3E27A 2C5HA 5JQWA 4W5QA 3R44A 5HZMA 3E4CA 3QF4B 3M2TA 4GYCB 1TQ8A 3ADOA 2FZGA 4WLNA 5K6AC 5AW3A 1NVDA 4G5QA 3FDIA 3I5YA 5ERGB 4DLVA 1RHQA 5E7MA 1V5EA 1IV3A 2PX2A 3NALA 5KTPA 2Z1TA 6REQA 4QULA 5K3AA 4KKVA 3B13B 2P2ZA 4IEIA 2DHEA 2IJKA 5E9JA 2C57A 2ENUA 1VOTA 2OLEA 3UWSA 2GM4A 3IRVA 2O3UA 3U3KA 1S77D 4U5XA 4F9EA 3AV0B 3E3LA 1NVPB 2VDPB 1UJ6A 3OIFA 4E1VA 4U2GA 2WUDA 3DGEA 1UBRS 1YFLA 4LH7A 4XIYA 2XNDD 4YJFB 4LYAA 3ET5A 1N8KA 5FPQA 5EPUA 1QV7A 4DY6A 1DAFA 4PV1B 4CKCB 4ND2A 3BOSA 4RQFA 3QNUA 4D4KA 5I7FA 1R50A 3CNEA 4ZGGA 5DM6V 2VRZA 2K4MA 1M90W 1PO7A 3OX4A 2R751 3SFTA 3BYQA 3BZUA 2YJ4A 3F7VC 2CDBA 1B41A 3X43A 3O8CA 2VA9A 3ASOC 1CRQA 1ULAA 5FDFA 2WVGA 3QTYA 3IQFA 1YDGA 3RVLA 1G1XB 4LYHA 1R0LA 2EIKC 5HKBA 4FILA 5FNZA 2HWXA 1ZAUA 5G1NA 1JQAA 4EHBA 2F00A 4R71A 1RC1A 4MUBA 4AZ3A 3F9IA 2JKZA 3RT9A 2ADOA 5IUJC 3GFFA 4RKFA 5BQ3A 3TM4A 4JJIA 1E6UA 3C6MA 4WUTA 5F7OA 4JAUA 3AXSA 3RF6A 2KMLA 5BT9A 1JXOA 4JYCA 1J33A 4JJ6A 1ZH0A 1NVTA 5BR4A 2QX8A 3Q4GA 1A2QA 3JRNA 1S9HA 2HAEA 4L6IA 1ZONA 3O8RA 3DHNA 1UPXA 3N5CA 4Z4QA 5C37A 2IH3C 1Z0ZA 1H0SA 1GGEA 3T38A 4EITA 1FVOA 1H2ZA 3V55A 2IW3A 1PW7A 4CTNA 1HDRA 1OA1A 2BKXA 4W9RA 4GR4A 1DX9A 4DRZA 4KR6A 6Q21A 2CUGA 1FMCA 1JG2A 2IM9A 1CZLA 4GD3Q 2PT5A 3S2GA 4UHKA 1PV0A 4BP8A 1NQWA 2JFHA 1SKVA 4ZO4A 5AVSA 2I34A 1C3XA 3F3SA 1FAFA 2H06A 3WMRA 4R2WA 3OO1A 3EIEA 2IHZA 5FRDA 4PCAA 3H8JA 4R2HA 2CFSA 3AMVA 3W7TA 3B5IA 3GMIA 4KVZA 3SLKA 3WJ2A 3CJHB 5DYGA 3QJGA 3WMFA 4LQDA 2C5AA 4ZRDA 1NH2B 1YA4A 1SUWA 4XGIA 2H8PC 3ST7A 5ALRA 4G4SO 3FOZA 3B9PA 1YB1A 2XA2A 2GSWA 4X6XA 3F8WA 4AQ7A 5DH9A 5JAUA 2CHQA 2HRBA 4I9NA 1E8DA 1Y4ZA 1P44A 4P84A 4HDQB 1E79G 4BWGA 2DBRA 4JC4A 2C2KA 2NZJA 2EEPA 4IV8A 2UZ1B 1II8A 3UICA 4XWGA 3EZFA 5HY2A 3CYFA 4ND5A 1CYDA 2GN4A 1J8DA 4A92A 2ZZKA 3DWIA 2G38A 4W4LA 1RI3A 1YZTA 1Z8HA 2XSZA 3LX4A 4DO2A 3AG2C 3GJ7A 4BN5A 4G4JA 4JJKA 2HUPA 3ZJTA 1E1DA 3KAPA 4REQA 3QYFA 1GDHA 5EIFA 4G0UA 4WX2B 2LO1A 1JXMA 3AESA 3OOEA 4OGLA 5CH8A 1KZ6A 3GDOA 4L5YA 3H8WA 4RACA 5CLGA 4HEA1 1SR8A 2VEDA 3ZV6A 1XQVA 1KC8W 2Q5QA 1YAJA 2P6UA 1OA0A 3P9KA 5ECWA 4G89A 1Y1PA 1N6KA 3O5AA 2ZYSA 3OPMA 4RZXA 3G9UA 5KWVA 1W2WB 3F6MA 4EO7A 2OD7A 4DV3B 3UM9A 3W2TA 2ISCA 4JI8O 3GLIB 3L7DA 1LVUA 2Z08A 4P32A 2VQFB 5KKAA 2DBQA 3DO6A 1RPNA 3ZHRA 1YRLA 3NNDA 5D5PA 3HR0A 4EHDA 4QRHA 2ZUDA 4FE4A 1JG6A 2M1XA 3CVYA 3K5IA 1G2QA 4JU9A 4PPFA 5TT1A 2R84A 1HRKA 3CSUA 5BRAA 3BPSA 4QICA 4JYPA 2ZT8A 1OJ7A 1DOZA 4CVNA 4G8BA 4DMMA 1YGYA 1AJNA 4L8WB 4AP9A 5I9BA 3I4LA 5JMTA 3IX7A 2J3KA 5LL6Y 3IS3A 2BM8A 4JI1B 1KQFA 2P22C 4Z4GA 2QL9A 2BCGY 1HDOA 3AT1A 4C21A 4TQGA 2V8BA 1SQQH 1QGOA 1NMSA 1ZVQA 4XRRA 3I6ZA 4CLDA 1RJ9B 1XU7A 1M5UA 5FL7G 2Z30A 2HP0B 1ZK1A 3I5MA 3A1CA 2O52A 4AMUA 4WI1A 4IDCA 1I0IA 1VGRA 2DKFA 5IVKA 4B83A 3CVOA 4EB0A 3MT9A 2W2QA 1NP6A 4EL5A 2AQ8A 1QPZA 2QAGB 4RO2A 1WZNA 2XIJA 3ND5A 1X59A 4CF3A 4DAOA 1GY8A 2OSVA 5FI5A 4EG0A 4POOA 1H8ED 4KDFA 4YXFA 3FNGA 3TD3A 1XD9A 1I2DA 3NK6A 3ISJA 4C0SA 1I4DD 4UDNA 1E4VA 3TL6A 1TUEA 3PL1A 1ULUA 1IQ0A 1ODCA 5DP2A 2Y9PB 3LF1A 5A5EA 4LZLA 2CUNA 2AXQA 2RAPA 3FYUC 4HGRA 1E4YA 5HZHA 1L5SA 5J2TF 4X45A 3KZOA 3B6KA 3NOOA 3DMDA 3VH2A 4WINA 1E7KA 2NADA 1VI6A 1P7CA 5CURA 2ZKOA 2UXDO 1XZNA 5CFPA 4I1UA 2MYPA 4LWSA 2M2IA 4OGQB 3FNEA 3ZO8A 2J4FA 2X22A 5HNKA 3EA0A 4BKUA 2GCOA 2OXRA 4FOPA 5IKMA 4B6JA 3QBDA 4DQDA 1Y6ZA 3C85A 1TUIA 3LDCA 4UE6A 5JJBA 5AXCA 4QFDA 4W99A 4YP6A 3RA6A 1ZAYA 4MDEA 4KAAA 3T6KA 4F86A 2IHNA 3P9XA 5D1NA 4MVSA 3RREA 2PUHA 3GWZA 1A0OA 3L41A 7REQA 4QHTA 5H4GA 3WIDA 2GVIA 1TZCA 3CMCO 3Q5EA 4OGGA 2XRZA 3ZHOA 1X1DA 3TD9A 4UAJA 1LTQA 1NNUA 1L5NA 4C87A 2BSQA 1RWBA 3GUZA 1D6JA 3OMLA 1I7FA 4G0WA 1NMQA 3SYMA 5GIOE 3R9KA 1YJAA 5IT9M 4PPNA 3C3YA 1WDMA 5G4KA 1G8PA 2Q6VA 2R5WA 3EBLA 2LW1A 5A03A 3KOMA 5T4EA 1UEXC 4DLRA 2IIPA 2HP8A 3NRBA 2G06A 2PX8A 4G8CA 1ORDA 4DDUA 1E63A 2ZDGA 5KOHB 2V9ZA 1JPJA 1WY7A 3E9CA 1EZ1A 2FFBA 4R2XA 4KFUA 2OK8A 4YR7A 3OLZA 1F4LA 1E4EB 1Y1QA 3KP1A 3OU2A 1VKNA 2GUZB 3OZTA 3SLRA 1G38A 1J00A 2G6BA 4EFDA 3ABSB 1YR6A 4G37A 1QLWA 4ZKEA 4YECA 1KEUA 1XTSA 3N0RA 4KQEA 1JVMA 3LYHA 1OLOA 5EZ5A 2XMPA 3V1MA 3H84A 3M9LA 3GNTA 4QJ5A 2FEAA 1W9HA 2HNAA 2RB9A 4UBIA 2JFZA 1QC5A 3VMFB 3A1DA 5K45A 1Y6JA 1E1RD 1AKNA 2HMTA 3NV7A 3E58A 4MYCA 3F8SA 3GFQA 3D31A 3EYAA 4D3DA 2O54A 1FTYA 2GOYA 2DWUA 1TJNA 4RA9B 2I8LA 3UMGA 1WZUA 1JI3A 4JEMA 1JDBB 3T1TA 2E5LO 1GNVA 1W5SA 3NV9A 3KV3O 3WYDA 3Q8XB 1U81A 1H1DA 2PS0A 1SHJA 1P0MA 5EJEA 4GHWA 2O2XA 4C4OA 3LLCA 1R6XA 4WDRA 4DG9A 3PD7A 3PXDA 5EOVA 1SQ5A 2PE5A 3HN2A 1DB3A 4REQB 4CN9A 5FWXB 4CCSA 4ZA2A 2I54A 3ZYZA 4B3CA 1GGNA 1XQYA 2GARA 4W7IA 1IHUA 4JUCA 2ZVDA 3IMKA 4RIHA 4XOUA 3TZCA 3AUUA 3SQDA 1KXZA 4BOYA 2NNUA 4CEJB 4R31A 4A0HA 2O3JA 4FMCB 1AZWA 3THXB 3BSSA 1XQWA 1EJ6A 2E82A 4D3ZA 4KJZA 5CA0A 1E3MA 4JZ2A 5HR5A 3PNLA 2M98A 5GM1A 2OYSA 3AJ9A 3VIUA 1AUQA 4DLSA 1S2OA 2VCEA 3P3NA 2XJ9A 3EHEA 4TLLB 3L1VA 4BU1A 1QPBA 4ZYWA 2WP8J 4KU4A 2BTQB 2QM8A 4WLFA 2HWUA 1T6ZA 1UCFA 1NMXA 2PUBA 2WIJA 3I3OA 2N42A 4TMKA 1FNJA 5CYGA 4CG1A 4Z7OB 5REQA 1ZKDA 3ANMA 2P06A 2XMRA 2RHOA 5G1OA 6AT1A 4DTCA 4HDKB 3ORHA 1V3VA 1P9NA 4H1UA 2BM1A 4RABA 1B1AA 3H87A 3QYAA 2I99A 4KKXB 1J0CA 3DV0B 1SQVH 2RI0A 2CXRA 1M73E 1E7QA 3OMAB 1R8QA 4PQFA 4DV0B 1HYGA 3O83A 2RD2A 1I3MA 4DUGD 5IDWA 3O1LA 1C9NA 2C5LA 4I55A 4AILC 3JSAA 4XOIA 4ZT7A 3UT6A 3LRTA 1EJ2A 5I7EA 3TLZA 1AGYA 5JQGF 1KRHA 3C3BA 3TQHA 3VFDA 1UPGA 1PVVA 2R8RA 1GT91 3KU4A 3TKAA 3TTWA 2C00A 4D9NA 3DSQA 4I50A 4LY9A 1MRSA 2QWNB 3PHJA 1UQTA 4P7KA 3TI7A 4YN3A 2J59A 1KFKB 4MEBA 1UMDA 1TUEB 3H1AA 1MEEA 4BQQA 1KNKA 2A88A 3ZU5A 1A88A 1QANA 1KO5A 4K5QA 4PIMA 3HVUA 2OFFA 2GJSA 3UYKA 2C2MA 5AK0A 1SDSA 2YBDA 1RQ2A 3TVDA 1BGWA 1NMUB 1E5QA 1XYGA 4EBFA 4L02A 2QN8A 4LWSB 2W2KA 2JFYA 2IGBA 1NI4A 2IUYA 1BDHA 5AUQA 3NATA 5HJ5A 2XASA 1O2DA 2H07A 3KKNA 2VHTA 5J1SB 4YAFA 2MINA 1W0KA 2VP2A 2J48A 4HD8A 4QRIA 4DSOA 2Z8YA 2HSWA 3V8BA 3TCKA 4DUYB 1TJYA 1JSRA 3MUEA 3PVZA 2QENA 5TGZA 3W5JA 4BX2A 3EWSA 1DG9A 1PQYA 3AUFA 3L1JA 1CFZA 1J5XA 2OVBA 2PR7A 4NCAA 2UVPA 5EWMB 2GEDA 3JYLA 3RYFB 2D3TA 4D9GA 4EDHA 4GLBA 3PUIA 4PANA 1CDEA 2B36A 3VI3B 3IE2A 4MT8A 4DB2A 1ZWIC 3A0RA 5IJ9A 3T4DA 1H1LB 1N0IA 5TV2A 4IILA 1B0ZA 2JLCA 1QAOA 2XNDA 3BFRA 1EVZA 1DO2A 3FPHA 1RM1C 1C7IA 1ZISA 2QW8A 3TR5A 1PR2A 1G21E 5G4KB 1RC0A 1GCOA 1SVLA 2J33A 5EWLA 5BMOA 5JVDA 4KFRA 2OCIA 2XAHA 4BJ1A 4BWYA 4DQKA 3SKXA 1ECGA 2JFGA 4EUSA 3B2EE 1Z22A 1T9GS 3VKUA 2HO4A 3ZDAA 1SOVA 5IWAB 1L7MA 2WB4A 3VOTA 1ODTC 3WOVA 4TT8A 2ZIEA 4P93A 1MBZA 2BUBA 3E3OA 2H4WA 2Q0AA 3E81A 4LDNA 2AHOA 1R16A 3FTPA 3MT7A 2ZCVA 4CZZA 4DCUA 5EMKA 1FUIA 1NZJA 2VSQA 3NTUA 3W79A 2GASA 4PPQA 2IWRA 5KSZA 2B5UA 4IIYA 3JWIA 1KZ1A 4LIPD 1HFEL 5IE9A 3C5VA 4UNSA 2PS3A 1ZVJA 3JVUA 1Z08A 1QOQB 2J3IA 2P35A 1PNQA 1IOZA 2Z5GA 5WRFA 2JHFA 2G0AA 3RFTA 4QFCA 1U40A 3GLVA 3TD6A 2DB3A 2XRFA 2YJ6A 1M34B 3EN0A 5EA2A 3RTBA 1XEXA 1JDPA 2F3TA 3MJVA 4WXHA 3PA6A 4GBGA 3U7FB 2AOUA 3HM2A 5HZGA 4BGDA 1VXOA 3E6AA 1WCIA 3GP3A 4EGCB 1VKZA 3U40A 4JP5A 2C3PA 1FXKB 1MV5A 3A06A 3BM5A 4XCVA 3CEMA 4PZ9A 2F93B 4MUXA 1T9GR 1JIJA 5JBNA 3WY9A 2J5XA 4WBNA 5SICE 4TL7A 1DDGA 1MJNA 4KP4A 2R72A 1OV6A 3KG2A 2OQRA 4HWSA 2WVJA 4GX1A 5CA0B 2WD7B 4FBMA 4P82A 1VGQA 221PA 2H08A 5IC6A 2IYEA 3OPYA 2N74A 1YL5A 1JKMA 1SXGA 2R11A 2ODNA 3WI7A 1E58A 5IJZA 4ZO6A 1OBOA 2DUMA 5CFOA 2CCKA 2NUAB 3I2IA 1RAHA 1R3DA 4D56A 4DVGA 4PCUA 4ETIA 5EMJA 4DDWA 1NYTA 3A27A 4BXOB 3DL0A 4LVOA 1WBBA 1PP9H 4H33A 3RR2A 2R86A 2J8ZA 1Y4SA 2JIZD 2CSXA 4CPDA 3GCGA 2B4TO 2YV2A 4NBWA 1L4GA 1ZC4A 5DCYA 1T1RA 2R60A 4C4PA 1B0UA 4L5JA 421PA 5LPNA 4KYTA 5HPYB 4YRLA 4RHTA 4FC7A 4JC5A 2JZCA 1LB1B 1YBFA 4PRZA 1IZ7A 1CETA 3STTA 2P4EA 4ZIBA 3JZDA 3ETCA 3STXA 1BHQ1 3AHEA 1K8XB 2YRFA 1QE5A 2FDCA 1GGKA 4I55B 4NU8X 3GDWA 2X0IA 3S2YA 1WNSA 3I0NA 3ABLB 2ZQMA 4L4SA 3LL7A 3FD8A 1EHCA 3AH8A 1SUFA 1FDIA 2QE7G 5EUCA 3CC2V 1OR8A 4NEHB 3VX3A 2F62A 4I50B 1HR0B 5BURA 3ABUA 4XIGS 2QXYA 3UB3A 2GNOA 3MBIA 5JG7A 2F1MA 1RAFA 4EP1A 1J2UA 1Q77A 3G5MA 3GRUA 3VPAA 2Q8PA 1D2MA 1UMDB 4A16A 4BLOA 5HRUA 1QKJA 2JIBA 1KJQA 4YHBA 3EVTA 1PD3A 4R41A 4JR1A 4DV4O 3VYUC 4Y6GB 1VB3A 4NBNA 1PL7A 3DAOA 3ZUPA 3LU1A 3MAJA 4KUEA 4I1VA 1UXKA 3P2MA 2QVZX 3KXDA 3OIUA 5E1BA 2BMAA 1RQ7A 4ZJPA 5FLKA 4RK7A 5E6RA 1UADA 1EB9A 4IIHA 2W2KB 5C32A 2XH8A 1PGQA 3VPHA 3LUHA 1GM7A 5K3BA 2OWOA 1NI4B 3DOJA 3SZGA 1NRIA 5I8ZA 1O5IA 5EXXA 1ZA2A 1DOAA 2Y0BA 3MRXA 2QTCA 2HT6A 1F4NA 4RC9A 4ZANA 1IM5A 3LFTA 4EJSC 3DC7A 1PEDA 3DMPA 3BGOS 2ZVZA 2V54A 1Z37A 5F2OA 1K4CC 5BVGB 1HEIA 3SE7A 3V34A 1F2TA 2NXJA 2AZ0A 3NU1A 2EKPA 5AVYA 1UDRA 2WIAA 2ZYRA 3G4SF 2UVPB 3C6KA 4K9OA 4KUMA 2Q7OE 6NULA 2CZWA 3JSXA 1H2AS 3R3ZA 1H8EA 4RWEA 4OQFA 3DL7A 4IWXA 3PCXA 3DBLB 1RBMA 4JR2A 4P34A 2WIFA 4ZQBA 2ZUBA 3LA8A 3P20A 1M2EA 3VDNB 3OUZA 5JCXA 2QQ5A 4P3OA 1YA6A 1B3QA 3DAGA 1HE4A 3D6UA 2FUNB 5BV2P 1KP2A 3AYXB 4P9OA 5T8KC 5KDLA 5B1BB 1SZXA 3F90A 5JAQA 2W2TA 4AZWA 5FUYA 3X1XA 3KJHA 1L0BA 3OQHA 5DI3B 2JL1A 2YWFA 5LIRA 5ALQA 2XYGA 1Z4MA 1F0PA 2CBXA 1IRXA 1PEAA 2W6JG 5E3JA 1E7MA 2E4YA 3JQ9C 1K9VF 4GLLA 5IHPA 4E3ZA 1QUFA 2QQGA 2EX4A 5CLFA 2VZLA 4KO4S 5FOTA 4YNBA 3SOPA 2P5UA 1U0LA 4WSOA 1TEVA 4F9GA 2XWQA 2NTVA 4FYPA 4PVCA 1L6RA 5JFOA 3H8VA 3A2MA 3B9QA 4EAAA 2R7NA 5CLLA 1JKFA 4PS1A 3QTCA 4IJVA 1ZDMA 3ZMVA 4JQCA 4DABA 2G4CA 3I7TA 3QUTA 1ECJA 1QGUB 4RTJA 3RV3A 3ZU2A 5KMGA 5EK0A 1GFIA 2NGRA 5EKUA 1EK5A 3QLJA 2QTMA 3EXEA 1ZY2A 1ZOOA 1RXVA 1JKXA 3ZGZA 4L3WA 2X0LA 3ONDA 3BK1A 2B5VA 3OA2A 1LPAB 4MWBA 3RFCA 3MB8A 3ZKAA 1OFVA 1AIPA 4K8RB 3H4MA 4U7HA 1ZH6A 4LPSA 2ACWA 1J2EA 2AOUB 3A4TA 4ERXA 3IDZA 4UC0A 4AJEA 1K6EA 2A0UA 3P27A 1WCIB 3O8QA 3RODA 1X7PA 1NXXA 4TKVA 1E61A 5AJHA 2VYCA 4JP1A 1XQXA 2RGWA 3B6JA 1S0VA 1N36O 4KDRA 4MIOA 2RJ3A 3UWKA 4K3AA 5B58C 4GLFA 1HDYA 3KJIA 2A92A 3A28A 4W8HA 3BB4A 3EYWA 2IYSA 3N75A 4BT7A 2WD8A 4M1MA 2XE8A 3OJCA 3LX5A 1RWVA 2BSKB 1R4AA 4CF5A 4RTPA 5IK2D 1X7DA 2H2AA 2ZJ3A 5JY1A 1J0BA 2RC6A 4IM7A 1SURA 2REXB 3ENNA 1VFNA 1Y9EA 4PJ0Z 3EBOA 3PEUA 4IXMA 4ZK2A 3HACA 2FB5A 4GI7A 4EZBA 1Y6QA 4QQ8A 1X92A 3DB2A 4IJMA 1DEKA 3WB9A 2AJTA 1DAKA 3WXBA 1R3IC 2WHQA 2EJWA 4MINA 2BY4A 4V03A 2AQKA 5SYMA 4BATA 5CBGA 2BBWA 3ZMUA 3OE1A 4F97A 1XDGA 1YITF 2Q5FA 1LRJA 3UBMA 5ALZA 1M1YB 3W9UA 4C8GA 5A0TA 4FQ8A 2G8LA 3L5OA 2R85A 1YB2A 5A5VA 1QNFA 3EH2A 1VQVA 2XCIA 1JPVA 1QGDA 4O2AA 4IUDS 4KN8A 4KE7A 2HIAA 4EFKA 1S01A 4PG6A 3OT7A 1N8RW 3TJMA 3NVKI 4IVQA 3I9JA 5BYKA 1UBSB 1RYMA 1DKQA 4UCUA 4NUTA 5AM5A 4HNAA 4HLUC 5AFSA 4OM7A 5KAFZ 2O7RA 1DCTA 5EO3A 2VYVD 3AVQA 1HFWA 4TTTS 4PX3A 1SVNA 3U6BA 1B3RA 3T9BA 1VG8A 4LFAB 3OX1A 4Y9TA 2QJFA 2BO1A 4MVXA 5HZKA 1AV6A 1JHZA 2PH5A 1KY4A 4I1YA 3PR1A 4CM5A 2ZBQA 1X7OA 3B53X 1XMOB 4HN4B 4FT4A 5HY0A 1BOOA 4WHMA 2B5OA 1T2AA 4AB1A 4HR7A 3QWAA 4CRWB 5H0IA 4LJ8A 5HBRA 3FVWA 3G0IA 3RIGA 3OH8A 5HW0A 3WIOA 1L5ZA 1AE1A 2BSXA 3LBIA 5CT9A 4W9MC 5F23A 4XJVA 3DEYX 1HQYE 1IUOA 2WRZA 3S0JA 2UAGA 3L74H 2GK6A 2PJDA 4HTFA 3NS7A 5SYAA 3IQZA 4IVRA 4ND7A 2CXXA 1MOZA 4E12A 1W76A 2ZR8A 3R20A 1ONPA 3OMWA 5IAAA 2SKDA 4AJPA 4MWEA 4GMXA 5IKPA 4DBZA 4RMNA 1YI8A 4B6EA 3D8NA 4D98A 3CJQA 3ZR4B 1FFWA 2YDXA 3FR7A 1U9ZA 3GW8A 3ZCQA 3B5JA 3GN2A 1SU4A 3JQ8A 4F5YA 4WXEA 5ALYA 2OZEA 2ZE7A 3NAQA 1U96A 3PENA 1WSBA 1YHQF 1II9A 2Z58A 4K81B 1TAGA 2D5BA 1NZFA 4BC0A 4JVNA 4FLYA 5SY6A 5AW1A 4GKKO 5EERA 2C95A 3CPQA 4OLJA 1KS2A 4R8RA 4H16A 3IBCA 2P6YA 4LF9B 5EIEA 4FE3A 3Q6MA 1G291 3EVAA 3L7YA 1S7CA 1ZL2A 1SOMA 2K2QB 3OZWA 2HG5C 2Y77A 3PN1A 2GPWA 2X2OA 1I0ZA 3CSXA 1HP8A 2EVWX 4IDHA 5JSYA 3WKAA 3FKSD 3HEAA 3VH3A 4OFZA 1XCBA 1XWIA 5B2ZA 1A8QA 3B82A 4QA9A 4FLWA 1K5HA 1P7BA 3IE1A 4G5YA 3ZP4A 5CM8B 5EMNA 1XNJA 1H47A 4JSTA 4I9GA 5BPFA 3TF5A 2WA3A 2KG7A 1TYBE 1OWOA 2Z2IA 3UO3A 3LGXA 3O3CA 4DR4O 3HC7A 2IT1A 2O7QA 4A0SA 5CITA 2VHWA 3SG0A 4FVMA 4QU0A 2C8VA 2C5EA 1KJWA 3EE6A 1N3IA 1KDOA 3E3AA 2QA4V 2HQ1A 4IIJF 3ZUGA 2M6YA 2PZJA 2ZT9B 3C4VA 3PDJA 3G0HA 3OQVA 3MELA 1ZWKA 1H8HA 5ALPA 3UC9A 2FSVC 4YS6A 4Z9BA 3HUFA 2WF6A 1V8BA 5JXJA 1QZUA 1VIAA 4JI2B 3HNPA 3TGWA 3U3XA 4DARA 2I80A 2EF0A 3NHSA 3F6RA 2H1WA 5ALNA 3QEJA 5THQA 3L4JA 2OZLA 1FJ2A 4ER5A 4PDMA 1RMYA 2XTNA 1AS0A 4QYSA 4DLWA 1MN6A 4RSGA 1UXHA 4NNPA 3O4GA 2FP4A 4KQ1A 1RKVA 3WV5A 4KRFA 3NGXA 5AM1A 1DDOA 1JQ5A 2E1PA 3FZEA 2Z9DA 5F7XA 4Q66C 4ARIA 3E7DA 3BCUA 3O2JA 3AKYA 3K0TA 3O8QB 4TKVB 4JB8A 3LC2O 3UFBA 2P91A 1KY2A 1RSZA 2H3HA 2GYVA 1VHDA 4LZPA 2NO9A 2BRUC 2WKSA 2QLNA 1Y8QA 3TTSA 3FPCA 1J0AA 2REOA 1GO3F 2P0EA 1S0UA 3P9SA 4CNQA 4CIVA 4Z8YA 1YV9A 2Q7GA 5CPFA 1SKYB 1VL6A 1Q3HA 5FWAA 4HT3B 5CVJA 1HM5A 4TSRA 4V0ME 2XNCA 3NJ8A 4EG7A 3AW8A 1U5BA 2JJ2A 5IH7A 2K9PA 5H8WA 1J9ZA 2V5AA 3ZU3A 2IBTA 4C2AA 2KM1A 4YUAA 3WMXA 5BPHA 3N8IA 4MMXB 5F9FA 2ZRNA 1PLJA 1W87A 1XRRA 5JJ5A 2E4AA 3W9YA 2BKLA 3AP3A 2HQSC 4YAGA 5I7OA 3ZE6A 1W6RA 3TKLA 2UYHA 1P84F 3D4IA 3GLGA 1L4YA 1MOQA 1VKOA 1DZIA 4JI5O 5B1HA 3ENQA 1V48A 1NF2A 2CXOA 1BGYH 1RJFA 3TXYA 1OB2A 1S6YA 4A6EA 4PDRA 3SP1A 4CKEA 4YXWG 3DB1A 4D5GA 4BIZA 2HF2A 4MUJA 3LDHA 4CV2A 4FMBB 3QA9A 3D6TB 4ND8A 4UVAA 5EJMA 2OM6A 4X93A 4ZHQF 3FLAA 3RSSA 4AF7A 1ZK3A 1EM1A 5KQLA 2F4VO 1Z68A 2VA8A 1PL8A 4CW7A 5K5EA 4HNAB 4URWR 2XY4A 3BIJA 4PSDA 3TM5A 2CLEB 3Q7PA 2CJPA 4LGVA 4Z7QB 3MG9A 1PS8A 4QYMA 3IELA 2PQ6A 2EIJC 1S3SA 2YHIA 2ZBGA 1GQFA 1OTXA 1VIYA 3AFGA 1G4AE 1NTOA 1Y5IA 3GLRA 4DZZA 1N9ZA 1OYVA 1HMPA 4LKOA 2G4VA 2TMYA 4DDMA 3GY0A 5KYXB 1SC5B 3K8OE 2WVAA 4GPIB 4IZ6A 5E38A 2L18A 2JIZA 2XCRB 1HY3A 2DQSA 3DFMA 1RI4A 1SEVA 3WYGA 3KJQA 3MS4A 3NHJA 4FSDA 1NTMH 2EKBA 1CZUA 3D2CA 4RQAA 1ADCA 3WTBA 4PAGA 1VQ7F 1NF9A 5B3AA 3IBYA 3OMNB 2WEKA 3M84A 4JTAB 3V9PA 3TRFA 4A8JC 1C9YA 3AJDA 3KXLA 4XWOA 1XZIA 4F0JA 1D1QA 1J0DA 1K63A 4RE6A 1L8AA 3IP7A 4P9NA 1N2CB 3T3MB 2GPBA 2VPIA 3DNPA 5L4LA 3PTAA 1K8QA 3OIWA 3DAHA 3OTHA 3TZHA 4PG5A 1C1HA 1RXSA 5AD1A 4EEZA 1XYVA 3G8YA 1SC6A 1GPKA 2O8EB 4E0BA 3PFIA 4DANA 3GNLA 4AJNA 2IFTA 2ERCA 5CCBA 1EK1A 2BFMA 4JK3A 1J56A 2Q29A 3W5CA 3J80M 1U3DA 4TVSA 1Q1QA 3NR2A 3RGGA 1EFVA 2AK3A 3ABQB 4JC0A 4E31A 3FYSA 2O20A 4FFKA 1G8YA 1JG3A 1TD1A 3FMFA 1ZCBA 5ALSA 1IWBB 1AKQA 1SB8A 2XZPA 3HCAA 7ADHA 4JOCA 4FGKA 2VCHA 3T3HA 4PYLA 5CM2Z 3LCMA 4Y7CA 4BIIA 3RADC 5DNEA 4OHXA 4HAVA 1V55C 1KEKA 5LGNA 1US8A 4UFZA 2J9GA 1SBHA 3C7AA 4BMDA 2C4UA 3SJBA 1UPAA 3OE7D 5FWYA 3HJUA 2J67A 3D3KA 4PI0A 3TMKA 3RYIA 5DLQC 3PHIA 2CXUA 3WHPA 2YXEA 2NO6A 3RUDA 4O4LB 4P3XA 5ICGA 1XK7A 1FYEA 5AW4A 5I51A 1YVEI 3BSWA 2IEAA 2NP7A 4MS1A 2ODTX 4JLPA 4P86A 2M6RA 4G0ZA 2PYJA 1KMMA 1S7GA 4YJ3A 2XTMA 5KJ6A 4ACAA 3W8NA 4QJIA 5A71A 2KQXA 2CTRA 4KDCA 3T3EA 2YEVB 3HU1A 3OM9A 4ZO8A 2R8XA 4GKVA 2YINC 2JS5A 1WHSB 2IA5A 1Z6QA 1YC2A 1QTQA 3UMJA 3JSLA 1L7DA 4KWHA 2OR3A 2IITA 4U7OA 3HU2A 4XUEA 5CDYA 2ZIMA 2LKCA 4GQAA 1JHUA 3D0KA 3DDWA 4Z8XA 3R41A 1DC6A 4BJ3A 1GVNB 4HI0E 2HU2A 4EB8A 3HB3B 1SQXH 4HZUB 1MVNA 5B1EA 3S1AA 4CF7A 1RA4A 2EX1A 2Q3MA 3KSZO 3U13A 3FPKA 3LBHA 5KTRA 3M6LA 3CWCA 4Q1CA 2P62A 1GQRA 1L3IA 3GLFE 3P0EA 2GM5A 7MDHA 1Y89A 1Y8QB 1IBKB 3QXCA 5HE9A 5J63A 3NH6A 3HLKA 4FYHA 1A9XA 5I7AA 5CW2A 3ROMA 1NW6A 1PNKA 1D2AA 1TVMA 2C04A 4JBHA 2C2WA 1DAPA 4P98A 3NHRA 2XWPA 1KKMA 2GCGA 1ISRA 3BB1A 1T3GA 1U5BB 3UXMA 1YVDA 4LXHA 2QDXA 2XQVA 3C87A 2ZTLA 2XTZA 2Y05A 3M1LA 4B3TO 4BQNA 1PZGA 5LA6A 5IFKA 2ZXEA 3MOGA 4DILA 1IIBA 3LPDA 3VVBA 1Z82A 4JT8A 1KGDA 3F4KA 3KYDA 2IDJA 4BNVA 1HZJA 5DV9A 3F3MA 1N1GA 2C2HA 3NEAA 4AJOA 2W2PA 2P9FA 3K5WA 5JT1A 3KVRA 1EE9A 1QFXA 3GLGB 4I9QA 3ACDA 2C9YA 1YKFA 5BN4A 1MJHA 1VLQA 4B4DA 1C81A 4KYUA 4CKEB 4C3VA 2PWPA 2HZBA 3NHAA 4RDIA 3SPIA 3K5MA 3L8EA 1NHWA 3ABTA 4ND8B 5GY7A 3UYLA 3NBMA 3DJYA 1H3NA 5CDFE 3KJEA 5DHQA 3HGQA 4L6CA 3BXHA 4JASA 5FAXA 2FWPA 3NYRA 2XKAA 3QVUA 4XUCA 1U2QA 1PHPA 1AKRA 1H3FA 2YHIB 5DWDA 3R0QA 1FXHA 4RM3A 1NF3A 2C9DA 5BYBA 3LSQA 5IK2A 1K7SN 1X7HA 4JQSA 1T6BY 3H2ZA 1N5JA 2G72A 3M0EA 1UQUA 4R9NA 5FBRB 4JLSA 1RYFA 3I12A 1BHO1 1JQ3A 4JT9A 3WIEA 1NVBA 4GW3A 2JCBA 3NMUC 1H5NA 5L3QA 4UULA 3HK2A 5K0BA 1TCVA 3VNAA 4KXRA 1VA5A 3DDZX 1F5NA 1N8TA 3A1VA 4ZVRA 2IXTA 1Z2GA 1CXZA 1NULA 2WSIA 1EHYA 3VZQA 1P33A 3V7YA 4BO4A 3PC8A 4B62A 4BQFA 3LWVC 1BMFG 2R6JA 4OU4A 4GMFA 1INLA 1HE3A 2FKAA 3A1TA 4Q7EA 4RIFA 4AICA 1VG1A 2XJ4A 4HYEA 5FNVB 1OYOA 1XU4A 4F1KA 3K12A 4B17A 4XTRA 1Q17A 2RIRA 3TTUA 2G1KA 4RHXA 1F20A 1GNSA 2IQIA 4FB4A 3QE9Y 1DT5A 3H9EO 3OJLA 3IKJA 3D8CA 2IUEA 1EK6A 1ZJ4A 3T7AA 1VQPV 1TJ4A 2P5TB 4M87A 1VE7A 3EQ7A 3PQCA 1XDDA 4TQDA 3KUCA 4XPIA 4MB6A 2VYVA 3ASNB 1YJ9V 1FNMA 2ZRHA 1EFVB 1JN1A 3WMWA 3ORRA 2JEXA 3L8CA 1KBOA 3IKFA 1KI3A 1UM9A 4EKNB 5H2FZ 3NOQA 1ZINA 2QWXA 2BT4A 4MW1A 2KW5A 5FLEX 2WIDA 4P4LA 1CDDA 2FEMA 1DFHA 1US8B 3RVDA 4AKHA 4JKOA 5EIBD 4WADA 5JEEA 3VHXA 4D92A 4EGJA 3R66A 4DUPA 3RYIB 2CWWA 3B1WA 4TV9F 5DFAA 3M4XA 2Q7HA 2YCBA 4D25A 3L84A 4F3NA 4RZSA 3N70A 4AJ2A 4AY2A 3QYJA 4CCAA 4JI0O 4YV7A 1XZGA 1UT5A 1FVHA 6REQB 1N92A 3N4YA 1W2HA 4GOKA 3OKCA 5B1YA 4UOEA 5ALIA 1FFGA 3H11A 1O97D 4YJ3B 1NU6A 2EDCA 3KSUA 1PHRA 2Q0SA 2EQ5A 4PWYA 1ZQ1A 5A9SA 4JVLA 3RU2A 2O19A 4G4XA 2C9OA 2CXPA 1MMMA 1Q74A 2YYAA 2H94A 2PXHA 1IXRC 4YIOA 4KFSA 4ID9A 1PTJA 3TQOA 3FMOB 3FGZA 4D02A 4OO3A 5CIWA 3FX2A 5IHXA 3NJRA 3KHKA 3AY0A 2JJMA 2HSDA 1Z5VA 5IT5A 4FHEA 4TQAA 4TMXA 1U0NA 3CA8A 5B3SB 1L4NA 3OUSA 1LUWA 1CUXA 4UHEA 2GPSA 1N2OA 4MUIA 1GTJ1 3ZWMA 2H1FA 3SEFA 4P4TA 3VYSC 2FZCA 3QVOA 4YV2A 2OBFA 3S1AB 5F51A 1AKEA 1QE3A 1RCFA 3EORA 821PA 4OGWA 4A82A 4QGBA 1OCCB 3SYRA 1MVLA 4AZ3B 2GPAA 1QQCA 3W7SA 5J3JA 2ZINA 4HVTA 1RBQA 3ZE1B 2JDIG 4OMUA 3QUWA 1FXWF 4REOA 3RANA 1BKDR 1CUAA 3LPNA 1V5IA 1CEZA 1OYWA 4FGSA 1M2NA 3RVBA 1A9XB 1O4WA 5A1JA 1LI4A 2WPNA 3LXRA 3E3NA 3S0YA 1AF7A 1RAAA 3KPJA 2XAJA 1MNGA 2IOFK 1BN7A 2GAFA 3GFBA 2WOJA 4AJ4A 1W25A 3IOMA 2FRDA 1H1TA 1KU6A 4AROA 1WL8A 4AI6A 5LA6B 2HVYD 2IW5A 3JQQA 3T1CA 2ZKIA 3JYNA 1BAPA 3ZIAD 1EIZA 1X1SA 4Q4DA 2E76B 3PP8A 4DR2O 3AFHA 1ZMRA 1F0NA 1WUIS 3PHHA 1LEHA 3PUVA 3IVRA 3ZU4A 3RFUA 3SJUA 4J1NA 4PXYA 4M1SA 1GYQA 2IDMA 5IKXA 3KX2A 1ZMBA 3T8YA 4AJIA 1V6SA 2OXIA 3RTGA 2GF9A 1FFHA 2D3OW 2H1VA 1Y34E 2YWBA 3Q3EA 2HS3A 4KI7A 3CKKA 4IIFA 4HL6A 1L8QA 1X8XA 4F8JA 2GR9A 3O85A 1H4VB 1H2RS 4XWWA 2V6IA 3GGDA 2FC3A 2OLJA 1GPBA 4OHRA 1G4HA 1YIJV 1U2GA 4NAVA 4RL4A 3RSQA 1KTIA 1Z5ZA 1VBNA 2ZWPA 1II8B 1VG9B 1OCOB 5LBIA 3T9DA 4ZQHA 2FZLA 2WWWA 2EJ7A 4MUMA 2IU0A 2VF5X 3B4SA 2FMXA 4B2IA 4LFCB 4G81A 3FFWA 4A6XA 3D9QX 2GHQA 4E5KA 2LRHA 3BAFA 5AVRA 3DF9A 4M8LA 4WACA 3ELWA 2I8AA 4BQEA 2I91A 3OEEA 2AW9A 1G5HA 3I1YA 3PC4A 2GD6A 4G65A 5L3QB 3HADA 1LA2A 3C3JA 3PXUA 5KX5A 3W4IA 2HCFA 4GEKA 2TYSB 4IH4A 2FJUA 2P9QA 3OEHG 3EOAI 4N1AA 2CTWA 4Y30A 1V5GA 3OZRA 4BR6A 3AESB 2ZREA 4ERNA 4MQEA 2PX5A 4DPLA 5B6PA 2YMMA 4C22A 3DMFA 3OE5A 1H65A 2COUA 5FQOA 4EUFA 1GZ7A 2OXTA 2A78A 3QMWA 4X65O 4JL5A 3FPGA 4K05A 2HSGA 2G5PA 4R8MA 1YRQA 4WFJA 2W6PA 2BC9A 3B5EA 5DBIA 5F1PA 4XDLA 1ZIPA 5LBQA 3ZOPA 2DFTA 1BXKA 4DR3B 2RK4A 1XQ1A 1EFHA 5T5QA 5JYEA 1W93A 4XPIB 1J6UA 1A7UA 2CK3G 1NPDA 3BWMA 4EUNA 1F0YA 2BP7A 2OCPA 3QWHA 1KA9H 4JV5O 2DUWA 2JA2A 3A2KA 3WC4A 3STLC 3UMBA 1O89A 5ICEA 1P7ZA 4DJDC 1VK3A 3QKSA 1TEZA 2IUTA 3KOYA 3Q2IA 1AXRA 2P2GA 5DTMA 2G04A 3ITEA 3U7GA 3CYQA 4UM9B 4TKUA 4S1VA 4Y1FA 3WRWA 3TB4A 4IWNA 1QH9A 3HFSA 5AR1A 2GWHA 3SR4A 3VHXB 5BRJA 1LSJA 1CR6A 1WB6A 2X0NA 4FIPC 3IBTA 2Q3HA 4PC7A 1ENZA 4FUTA 4C2TA 2DFKB 4IQFA 3G1UA 1XELA 1LBQA 4HBGA 2NO1A 1LFAA 3MWGA 3UEOA 3HVHA 2KKWA 3L43A 4IDQA 2VJNA 2WQ7A 1SKQA 5FTWA 4CJXA 3W9SA 1T6XA 1K0UA 1G9TA 2YWHA 1DBRA 2HH9A 1AQ6A 3KZCA 5A9SB 3BSFA 1G6HA 1PS9A 1IIRA 3GP8A 3X2EA 1EXWA 3IXQA 4RH1A 4WZBE 1OLXA 3SI7A 4AZSA 3E22A 3M99B 2IODA 4ZGBA 4EYGA 4CMKA 2QROA 2QPAA 4G2TA 3BS4A 3BDAA 1E2QA 1K5GA 1F6WA 3IOEA 1XYYA 4Q6WA 2JLUA 2WM9B 1M7HA 4FW9A 3QVJA 4BWVA 3N8HA 2UUPA 2PMKA 5LZ8A 4MVJA 4YCBA 1XFDA 2B5WA 2QKSA 2B1GA 3TDMA 1IY0A 1IEXA 4OFWA 1GITA 3S29A 4JD5A 2GCOB 3FF4A 1G7CA 4IGGA 4J16A 3TS1A 5EVJA 4EKDA 3BULA 5DEIA 3FHJA 2HJGA 3UQYS 3K0AA 3KT3A 3STWA 2NPFA 5JAOA 3I3SR 3OE7A 3MJTA 1YUNA 3M5PA 1GCUA 2EQBA 4BTVA 3TO5A 1Z4OA 1FK8A 1QFYA 3ED5A 5DXJA 2I1LA 4EUEA 1WAMA 1IXSB 7REQB 1TRHA 2IF2A 4LF4B 2XE6A 1HOTA 1DMRA 2O8BA 3BD8A 4CODB 2VQSA 3NVAA 1PJCA 2ZYWX 2GLTA 2VT7A 5IAGA 5AJUA 1ZS9A 3VGPA 1XHOA 4RPIA 2YICA 2JCXA 3NANA 1UC8A 4CGYA 3K70B 3EQZA 3E9DA 1KMIZ 5JZMA 4L16A 3RC7A 1G41A 5EESA 4HAMA 2KSQA 1H9AA 4RVSA 4IICA 5G0SA 4UVCA 3BPZA 1FBTA 4IPTA 2D0IA 3OLWA 1ZM2A 5IXSA 1UEIA 4UW9A 3LF2A 3A9VA 1EFLA 4QSMA 2IYYA 1TK2A 4RV4A 3U4DA 4WZZA 3K2IA 2G1PA 3RE1A 4ZI2A 4EGAA 4DQUA 5AHWA 3IILA 4ZIRA 3BJEA 1NJGA 2RH8A 3WBFA 3IPXA 2LNDA 4JODA 2UYCA 4GNRA 1E2UA 3P2OA 3DHVA 1Z18A 1ZVMA 3FN4A 1VJDA 3D6AA 1K4YA 1G1AA 2EW1A 2GCNA 2NTNA 3JWPA 1T36A 3KNZA 4ZHVA 1UWLA 3GUYA 4P8RA 3OU6A 1OZGA 1ZHOA 2JGMA 4G4YA 2AUMA 3NUGA 2PO7A 2DULA 1XX6A 2QNBA 4N5NA 4ENPA 4G27B 1QC5B 2W6ZA 2IYLD 1IL0A 3WQSB 1E9DA 4G0MA 3ROEA 5ALEA 4MR7A 4CS2A 5F52A 4C4YA 4FBGA 5HF9A 1DGSA 3P9ZA 3N7AA 1F14A 2VJOA 3VTAA 2PDAA 1KE2A 4KNWA 4NTZA 1ZD9A 4E1AA 1WP8A 5FBVB 4W5RA 5LHHA 5EMHA 2B6HA 4ZODA 1JT9A 1ZNXA 5HUQA 1WZCA 3W06A 1GKIA 5J4YA 3RRNA 4E2XA 4HATA 1ZOSA 3CYOA 4JP2A 4J7XA 4KQMA 2R00C 4A03A 3A0UA 2AG8A 4J0EA 3LT0A 3DVLA 2H4ZA 2E74B 4GI2A 4KVAA 4MQEB 2VNSA 2JRIA 3K1JA 1LBSA 3LYUA 3HZRA 2J5QA 3AGKA 4U63A 3W04A 5CH5A 1YMVA 1LV8A 1XNRB 3EFHA 3AW9A 3GVIA 3KD3A 3AL3A 1IZ3A 2Y0CA 4ZOLA 2XEXA 3LX8A 4OEHA 1IATA 3FVVA 1Z83A 1OFTA 1BA2A 1GA6A 4QUHA 2I67A 3G9ZA 3OF2A 3AFIA 4LNHA 4HQ0A 1HDZA 5AI8A 4WKNA 3C8MA 4UATA 3UJ7A 2OGSA 1NIJA 1PZXA 4BNHA 4BNZA 1YDXA 2VCYA 5LD2B 4ZVMA 2BE3A 4KQWA 2BF4A 3DOHA 3BJIC 4V2IA 5C7OO 1S96A 1T3LA 1COWG 3CC2F 1NJFA 3I5DA 2BP7B 2FLKA 4G1UC 2ZJ8A 4Z4EA 5REQB 5KREA 2GF0A 3QKSB 5MN6A 2VNKA 3AZPA 2Y1DA 1U7WA 2OZVA 5F2EA 4RKRA 3TIGA 1YQWA 2CWDA 2VPXA 3UT0A 1ECFA 2VJDA 4TOIA 4IMPA 4DEXA 1QP4A 3OOSA 2YRWA 3CE2A 1VI2A 2EBOA 4B08A 5CA1F 3E8GA 1NNLA 1IRIA 2W0MA 2ZATA 4KQXA 3SXPA 5HWSA 1UBGA 4Z2YA 2Q9UA 2F1HA 2YCLA 5ILOA 3TFWA 3RRYA 1IJEA 3G2HA 2VHCA 5AW0A 4EKGA 1KKUA 2MYNA 2MSLA 5K2OA 4UU1A 3DO8A 1CNMA 1FRVA 2NZ2A 1DSSG 2WB2A 3K05A 4JSYA 2D1QA 4YAEA 5HXZA 1CZKA 1FP4A 1MAVA 2OL4A 1ST2A 3L4KA 5BQFA 3L40A 4ZYZA 1QBGA 3C0KA 1ODLA 4UMFA 1LGYA 4L4XA 1P6QA 3R0XA 4NP6A 4MVQA 4NMMA 5KNBH 1M56C 1EGQA 3EW7A 3THYA 1DQNA 4ZU3A 1UMBA 4R51A 4D26A 4DIEA 1BVYF 4PZCA 3WL3A 1EWQA 5L3RA 1ORVA 5F9HA 3EGXA 3UVEA 4DLBA 4A2CA 3A6PC 3ORSA 4Y9SA 4MGIR 1NASA 3W8DA 3MCZA 4H0NA 4N3CA 4YAIA 2MINB 3QU2A 4I2NA 4AMBA 1XWWA 5KTNA 4K0RA 3K0AB 3EDMA 1D1PA 2WT4A 3HV2A 2XOKD 3WRXC 4TPKA 4A15A 5ENVA 1NLUA 2WF8A 4XJSA 1WUYA 3U2QA 2ODPA 5A6SA 1K98A 1YTLA 1N32B 2BFCA 2DWCA 5AIAA 3UHAA 4F2WA 3GCWA 3K8QA 2O8BB 1CJUC 4HZ3A 2RK3A 3L6DA 2B99A 4HSGA 2BFNA 2QTWB 3SGIA 1K6JA 4PN3A 3WBJA 3A0RB 5IJ9B 4QOSA 4RF3A 2BKAA 1UDWA 2B0CA 2AQIA 3RSZA 3R7LA 2QGZA 4OPMA 4DREA 5H3CA 1DJNA 2AI1A 5EWLB 4JYZA 3PNBA 3LSSA 1W5FA 5JVDB 2AW3A 5SY9A 3TUJC 1PE0A 2WSBA 3HI6A 4UZSA 2GJAA 1JEAA 4MTLA 5AP9A 5FWDA 3FPJA 4NWIA 5HDBB 4R8KA 1HQKA 4ZIRB 4AXBA 1J23A 5GP1A 3MMPA 2A1IA 3PF9A 3AR9A 3SC6A 2IL1A 3FCCA 1EQUA 4BMCA 1VDMA 3CRAA 2I3BA 2C07A 1RKBA 1EZ4A 3PT5A 3K0FA 3A6GA 1T36B 1PJ2A 2AMLA 1DG1G 3GELA 5DISB 5DSTA 3FDZA 5IDYA 3ZMZA 2IYPA 5HQ3A 3SVZA 2HLNA 4MVJP 2XT0A 1AA6A 3L4BC 3PS9A 5DU2A 1E1CA 5ALXA 4XA8A 3PEVA 4NULA 4MR7B 2ODBA 4QD3A 4X8MA 4DLAA 1T2DA 2II6A 4YGXB 4GBMA 3OJEA 1IXMA 1NNSA 3NP7A 1GRJA 5CXXA 2I2AA 1O5OA 2CYBA 3N5KA 1T43A 3NIWA 3IQGX 3VJMA 2QKCA 1H2SB 1TVKA 3ASZA 3LY5A 1Z7GA 4WGFA 4PWTA 2UZ0A 3V4ZA 4NX2A 2JGKA 3Q1LA 2LP4Y 1UBJS 2VAWA 4DNOA 3TSOA 2CNKA 1XEXB 4DQVA 5ALMA 4M36A 5FLXN 1WB5A 3CY6A 5CCEA 4NZOA 3AVUA 5H6QA 3W6PA 2O2JA 5C51B 4E15A 2GILA 3B1ZA 4OHCA 5LQMA 2NOAA 1FFEA 4AZVA 3O03A 4UTXA 4JGGA 5LQNA 4CFZA 4IOJA 4H0CA 2QPTA 1H66A 2O8NA 4E7OA 2ZBDA 2PI4A 3CPJB 1YT5A 4HFMA 4D4HA 1YR3A 4L72A 3RYCA 4WBNB 2YXHA 1U8FO 4LHSA 5IU6A 2C2BA 4IHQA 3QPAA 3TI9A 3K9GA 2I2XB 4US0R 4BLRA 2G9RA 2WG2A 3WGYA 4BLTA 3OPYB 5BP7A 1CN7A 3P52A 3L7IA 4I46A 3RWRD 4GX5A 2RCVA 4MVUA 4O5OA 2XNKA 4JI7B 3AG4B 1UFYA 2XQFA 1FNDA 1SIUA 1OGJA 2JGDA 1E1RA 5ALTA 2ONZA 4R3WA 2Q27A 3G6BA 3SN6A 1KO4A 4RF4A 3VKWA 1DTEA 3SJAC 5LXTA 1NJ2A 3GLHA 2ZIGA 1W4RA 1L5FA 1T9BA 4BFWA 4M9SA 2H0AA 4DBVO 5TMPA 1I14A 2HQRA 1C7RA 4QG7A 5CLIA 1QMGA 3LXMA 5HQJA 1J24A 2KSDA 2VTBA 2Q5HA 3F73A 2J4CA 4XCXA 1YFKA 2DF8A 3DKPA 1ARZA 3KT8A 1U43A 3MZ0A 2C98A 1X3SA 4KZKA 4UMDA 2JD1A 1IULA 3DONA 4KITB 3LDDA 2J45A 4ALMA 3D02A 1E32A 5BWLA 1GV1A 4I4LA 4EG6A 3AC0A 4NK5A 2G7ZA 4W5HA 3B6NA 4NBKA 3ZGOA 4AZ0A 2CNLA 3OECA 2DGDA 3QV2A 2PX6A 1ML3A 4YJKA 1SGWA 4NV0A 4DZRA 4UXNA 5K8IA 3NORA 1FP4B 3J7TA 2OHGA 2Q49A 2P1RA 3WWEA 2WFZA 4N5LA 2V4MA 3GRZA 1ISMA 2E0IA 2ZYVX 3K4QA 5FBZA 2QYHA 4S24A 4UFNA 1ISPA 3G9QA 2PZBA 4HWTA 1UMBB 1CRPA 3CX5F 3IT1A 3LDEA 2QW1A 4O2BF 2BOCC 5ECGC 5E6RB 5KHAA 3B40A 2PWAA 4QXMA 4U8HA 1OH7A 1NW3A 1K8YB 2HL6A 3N2NA 1KIMA 1XHZA 1D1TA 1P7WA 4PGAA 4ZAFA 5CX1A 5KSYA 1JLRA 3UIEA 5EP1A 4E03A 3FNBA 3EY9A 1QGZA 1J4AA 3FRIA 1YJ8A 1DKRA 1YVUA 4O4IF 3IMFA 2R68A 2BHNA 1BE3H 1AQNA 1F2TB 1UDAA 1N7JA 4DUGA 4QGHA 5JAHA 5LZ7A 1LC3A 1ZHFA 4PYNA 3ZCCA 5J4HA 2XXAA 3FUCA 2IH4A 1OGIA 1U7OA 2C97A 2C7QA 5BR8B 1VQ1A 3G7NA 3ZEIA 1WCYA 3I76A 3AG1C 2ADQB 3T52A 2AZ4A 4N8SA 4PBSA 2I65A 3NASA 4PYKA 1N6PA 1HW7A 1IN7A 3ND9A 1XQ6A 2V7WA 4IOLA 5L3EA 4CT5A 3SPJA 2H52A 3R7FA 4Y2UA 4RNCA 4OSPA 4BO9A 5B8FA 4Y2GA 3W5BA 1J70A 4X9XA 2HK8A 4CLEA 1E64A 1QB7A 2QA4F 1K2VN 5IEJA 1S2IA 3T4PA 1CEYA 5J4VA 4IL5A 2PWBA 4J3FA 1ZJZA 1HE8B 1ZNZA 4EW3A 1ZD8A 3TRDA 4GM0A 2CD7A 3RVKA 4K8OA 2RQ6A 4XGRA 4IIDA 3MIIA 3AIOA 3N0VA 2DZDA 3JTMA 3JV7A 4BHTA 4QOEA 3QJYA 4GU5A 4FLMA 2D6FA 3AG7A 4HYOA 4YAOA 3VQYA 3ZGXA 3K0FB 2WW8A 1GPUA 1Q0TA 3EWAA 2RBGA 3FOCA 4TS9A 4F4IA 1OKKD 2HEPA 1XAIA 1RI2A 4ZARA 1MKYA 1CCWA 2I9PA 1NW4A 5HQ3B 2IXAA 5F7ZA 1VZ2A 3DYIA 2JJ8A 1W55A 2E85A 5ITWA 4NYKA 2VXCA 4D3SA 4KXYA 3LNMB 1Q1AA 1R5JA 2W8BA 2DHDA 2C2OA 3VGJA 2A06H 3S2SA 3NGMA 1N6RA 4XI9A 3NVMB 3V8MA 3S3WA 5JJCA 4FHDA 1Q81H 1SK9A 5KMGB 1CR0A 2W71A 2ZF8A 3PFKA 3EXEB 5L8VA 2AX3A 2AMTA 3FTQA 5FJJA 2PHZA 3UNXA 4B4KA 2PH1A 4TZZA 5KDOA 4J7UA 3GLTA 3QLTA 4Q6BA 1EUYA 1M5RA 1DX4A 1I0HA 4ND4A 4F8YA 5IF9A 2XYVA 2J07A 3O8DA 3PTZA 1GPLA 5ALKA 4P4SA 3IEVA 1G5FA 5D00A 4F21A 5KC9A 1R1MA 4J7AA 1UBNA 2ORIA 4BNMA 4QNMA 1TMYA 4BJHB 4H1VA 1U7UA 5J9PC 1WQ3A 1AGPA 3T1YO 2B4YA 1XVVA 3FLMA 2PU7A 1SBNE 4NK4A 2PLAA 1A8IA 3F67A 4BZPA 1VA4A 4LMRA 2GBLA 3R6LA 3ZHZA 2V3CC 2W70A 4RQTA 4WY2A 1NXWA 4YMTA 1MLDA 1S5PA 4XYLA 1Q5OA 2X2EA 3QLUC 1GL9B 3DQPA 2FEPA 1TCUA 1UIRA 2CNDA 3KCXA 3GLHB 3R7DA 4G2NA 5BN3A 1TYCA 2X1LA 4YRIA 5K1ZA 5BNTA 2FRXA 2PLNA 1RT9A 4H6PA 3KWJA 2PTMA 3GJ4A 2A9VA 1AUPA 3FM9A 3DBVO 3F6CA 1NI8A 1K6MA 3KB8A 1AQLA 4UHFA 2HA7A 3ZY5A 2MW2B 5I9SA 3NNNA 5ITSA 2IC5A 2AFHA 1XIVA 3V2HA 3B85A 2IYOA 2X1HA 4AY5A 4O2AB 1BCCH 3KB6A 4IGFA 2J6IA 1EN4A 4JDPA 5BSFA 2PD3A 3CCEV 3ZIDA 1R88A 1F2VA 3GEIA 4PICA 2UXCB 1PZEA 1K6XA 4XDKA 2VSOA 2VKTA 2HK7A 2QTRA 1W2BU 1P1BA 1O8CA 3FTDA 3L0ZA 1YZGA 5JWOA 4LBEC 1JV2B 5CA3A 1TCCA 1MQAA 4WZAE 1GZHB 1V11A 3L1KA 3CLSC 5BXYA 3OZGA 1IHPA 3H83A 2YYEA 1JQLB 2HRUA 2R8EA 3OR7C 2A5DA 2XUIA 5DNAA 4QO7A 3FCYA 3A6KA 3KCQA 2B30A 4RYDA 1JILA 3R3YA 2YVQA 4B87A 1EP3B 1V7ZA 3AKDA 1NJSA 1W44A 3ZDZB 5IT0A 4ICIA 2I5PO 1Z2EA 1AKVA 4HEHA 3HY6A 2DQYA 1FEZA 2AN3A 3CWQA 5CX1B 4DMHA 3BERA 1UBFA 1LRKA 5FFMA 2FJPA 4HTFB 4FQ7A 1L4EA 1PUXA 1JFLA 1OTYA 4L8YA 3AFOA 4PZYA 3A58B 3CUTA 4XB6B 5TF0A 2WIBA 1M2JA 3CCCA 4QJBA 4NFYA 1JHMA 3TIXB 3HM9A 1ZZEA 5L6LB 4G1EB 4BNWA 4YY3O 4DA4A 3FTCA 4PO3X 4BV8A 2DY0A 2G25A 2BGGA 2XXAB 1H2GA 3AHHA 4NZPA 5B6JA 4Y0VA 5CIYA 2XB9A 1QRUA 4B5CA 2W2LD 4AKEA 3JQ8B 2G4LA 3C1TA 2PGNA 1OFIA 1R0KA 1LPMA 3K7EA 5IX8A 3UY4A 3QIAA 2X86A 4TXLA 4Z9AA 4HH3C 4Y2TA 2OO5A 3MRVA 4Q39A 2QZJA 4URZR 2QV0A 1EGVB 5LZ4A 4Q47A 1P75A 2QMYA 1CJMA 4PGHA 3DS8A 3LOQA 4HEQA 4V0LA 2M6SA 3O2NA 2D06A 2LKDA 1CT9A 2WHPA 4ZI7F 2VXYA 3M4YA 4J11A 3GWGA 2O0LA 4N4AA 2HADA 1C29B 2OGTA 4GLOA 4CDMA 3F0GA 2YZKA 2HA2A 5GJWC 1KKLA 5HRAA 5AJVB 3OCVA 4BT3A 3DP7A 2BCCH 2Q41A 4C6TA 1U31A 1QQAA 3H42B 5EUBA 3EPKA 2EZ9A 2HXYA 3EQ9A 3QPWA 3DYVA 3ZC3A 3HRIA 1SVWA 2KG7B 1JT2A 4J0KA 2JG3A 1RPTA 1TU0A 4RHYA 4Q4AA 2UXNA 1TQHA 3F6PA 4YPVA 4N7MA 2Q3DA 2OESA 2D5LA 3RVMA 4I3HA 2MMGA 1ZR4A 3O75A 1R74A 2VQ3A 3PIDA 3DPSA 5AJYA 1IV4A 1XJCA 2AOTA 3GA7A 3T7CA 5ANRB 5ENZA 4QYWA 2Z3ZA 2GFQA 1ZI9A 1LSOA 3R5JA 3NM4A 1SMKA 2GAOA 3HHEA 3SYLA 2H7CA 3UH0A 3CX8A 3NG1A 7GPBA 1ZOLA 4C6HA 1XNQB 1JW9B 4KHPB 1BJTA 4H2DA 3JQFA 2ZPTX 1CUDA 4XDZA 3WYCA 2NLOA 4J9ZB 1XP8A 2V0GA 4EPXA 2OZLB 1DMSA 3SFZA 1LJUA 2IVFA 4M1ZA 4F5EA 4BKRA 3X3HA 2HSZA 2FP4B 5GGXA 4M9XA 1LX7A 4IYRA 2KTUA 2JH3A 2VS0A 4GPBA 3TTTA 4WFGA 1CUGA 1Y76A 2YJTD 3QLEA 2NU9A 1XVAA 3D8UA 4MCAA 3H0KA 3RU3A 5ICCA 1TZKA 4G24A 1DS6A 4A9AA 5BO5A 3NP9A 4AF8A 5JSHA 2CB9A 3DVQX 4A6DA 1LDEA 4V0RA 3DMHA 4Q9AA 3Q88A 4Y2PA 3I1JA 3EZ9A 3UUWA 2DETA 2Y99A 2C8JA 4UVHA 4C29A 1JAHA 5YASA 2ZRKA 1AP6A 3DD5A 1VIDA 2FJ0A 3LVFO 2BZ0A 1WBDA 4HP8A 3OJFA 3LCUA 4L5AA 4MW4A 4BX9A 2X0FA 1P9RA 2B2CA 3HBLA 4FJCC 3N7TA 1FFCA 2Y69C 1JTFA 4HNQA 4NNOA 2RBKA 5B2FA 2MQEA 4ENUA 4EARA 3LCCA 4BWFB 2AI2A 4NV3A 3GZNA 1CVRA 4CNBA 1FSZA 1JWLA 1PL4A 3V46A 3V3KA 4MPTA 3JCUZ 1A71A 3BK7A 4QNHB 1FMTA 5I3CA 5IZCA 3BZWA 2JLSA 4RULA 1KDTA 4L9RA 3HCWA 4N9QA 1P5JA 3PYXA 3G79A 2BOBC 3UQZA 1XZCA 3T2MA 3RUEA 2HA5A 2ZS7A 3MSXA 2QZPA 3A1NA 4GECA 1BT8A 5JBQA 1Z4JA 1R6TA 2H4HA 1NDHA 3GVPA 3RVPA 1P7GA 3WBKA 2WAYA 3LUJA 4KHZA 2X8JA 1OBVA 3SJCC 3GJQA 4ZK7A 3IMPA 2HWWA 4QIWF 2X4GA 2RHBA 1KY5A 4BYMA 2ZJZA 1ZSVA 1XUOA 1CUVA 2OB2A 1IOWA 4EY7A 4KV9A 3G67A 4HDOB 5K3DA 1QIDA 4X97A 4QE3A 2A14A 4NJMA 4A6PA 2R6AA 3AP1A 2G5TA 2PGOA 4K9PA 4I66A 1P4SA 2PMPA 5JAZA 1YONA 1MJGA 3AJAA 1Y6FA 4EPVA 4EEQA 2W00A 3NEYA 4HNHA 2ZNJA 3CURA 1Y8RA 4AX8A 4GT1A 1VQPF 1GQOA 4AW9A 5BSTA 4WN9A 1W4LA 1YJ9F 1QHTA 4MKIA 2YI8A 4O1IA 2UZ3A 1EFAA 2BJWA 1KAMA 1XVLA 3ICXA 5DTRA 3GGPA 1SVMA 1L8XA 1NRXA 1ELOA 4LRQA 2Q28A 4RWUA 1SXJE 1KVRA 3QV1A 4CE6A 1FD9A 4MR9A 4DM7A 4X62B 3TDNA 4NVPA 5ES3A 3H2KA 2ZVQX 1QTNA 4M8KA 2OTJV 1HNNA 2Y9MB 4URVR 5DIFA 1SCAA 3MCVA 3BL5A 1E2BA 2YDEA 2VZ8A 2OV6A 4FFSA 3WLEA 5BV0A 3KPUA 1BD4A 3HY3A 2VJLA 4BVBA 1BMQA 4MPPA 1U3LA 4MKZA 5CNJA 4JI6B 4DJAA 4A5UB 1WXXA 3PV0A 4XASA 2QJTA 4LDJA 5J9FA 3W1WA 4MQMA 3ZWPA 2BWJA 3T41A 3WB1A 1YDFA 4IRMA 3H2JA 4PHTA 4G4ZA 4KVGA 4JJGA 3GXOA 1GRNA 4WOPA 4C0XA 5DCLA 4MTCA 3ZCVA 1USWA 4ZQIA 3E70C 2DJ5A 5DT9A 2XOEA 3WKBA 1H5QA 3FOFC 1IMJA 3C3WA 1TEHA 5FWYB 1YE5A 5G53C 1XT6A 1KC3A 4BZXA 3CCVV 1LDNA 3FVQA 4C6TB 2GPJA 1P4HA 2PUAA 4G01B 3WL6A 3TE7A 4Q4AB 5JD6A 4QIHA 4J6EA 3L7NA 4DSUA 4MS1B 4M1QA 2RE8A 3NEPX 2JW5A 1H94A 4QXOA 2AOTB 2QDOA 3Q6IA 4X7RA 1NZDA 2B0JA 2VHZA 2HU8A 4EVSA 2VQDA 2ZRDA 5LB2A 5DM70 1CIPA 2IE8A 4JB2A 4RD3A 4WASA 5GJVC 4RVNA 1QU9A 4HNRA 3NC4A 4WJKB 1PR9A