4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
5MN6A 4KWEA 5BMVB 3HKBA 5IJ9B 5ITZB 1TVKB 1Z5VA 3CB2A 4EI8A 2R751 4WBNB 4TV8B 5EYPA 2VXYA 3ZBQA 3VOBA 4EI7A 4TV9B 5EIBD 1SA0B 5FNVA 2Q1YA 4EB6A 4YJ2A 5KMGA 3E22B 4DRXA 5EZYA 4LNUB 5IJ0A 4O4HB 2XKBA 2RHJA 1TUBA 4IIJA 3WGLA 4DXDA 5LOVB 3JALB 2RHLA 4YJ3A 3VOAA 3RYHB 2BTOA 3HKCB 4IHJB 4ZHQB 4O4LA 4EI9A 5IYZB 5CB4B 2BTQB 3JASA 2VAWA 4O4IA 5GONB 3UT5A 5C8YB 1JFFA 3JAKB 3RYCB 4X1YA 5LP6C 4O2AA 4X1IA 5JVDB 5EIBC 3RYIA 5JQGB 5LXTA 3N2GA 4I4TB 4M8IA 5M7EA 3ZBPA 5CA0A 5J2UA 1FFXB 1W581 5CA1B 3WGNA 3JAWB 4F6RA 5KX5A 3M89A 4TUYA 5LP6B 1OFUA 3WGMA 5MN5A 4YJ2B 5J2TB 3RYFB 4U3JA 2XKAA 3V3TA 5KMGB 3M8KA 4ZOLB 5LYJA 4DRXB 4I55A 4X20A 4XCQA 3N2KB 4O2BA 3ZIDA 3HKEA 4I50B 5IJ9A 1TVKA 3JARA 4FFBB 4HNAB 4WBNA 3HKDA 4TV8A 5JCOA 4O4JB 1RLUA 5JH7A 3JASB 4TV9A 4O4IB 3HKBB 3JATA 1SA0A 4B46A 4ZI7A 4B45A 3RYIB 4E6EA 3E22A 5LA6A 5EYPB 2GVIA 4LNUA 5CA0B 3WGJA 1Z5WA 4U39A 4O4HA 4X1KA 5FNVB 1W5EA 4TUYB 4EB6B 1RQ7A 3JALA 5EZYB 5LYJB 3RYHA 4X20B 5IJ0B 3HKCA 3R4VA 4ZHQA 4O2BB 5IYZA 3HKEB 5CB4A 2BTQA 5JCOC 1W5AA 2VAPA 1TUBB 5GONA 4IIJB 2R6R1 3WGKA 5BMVA 5C8YA 3JAKA 5ITZA 4YJ3B 3RYCA 5JVDA 5JQGA 3JARB 4I4TA 4O4LB 3HKDB 1FFXA 2VAMA 5JH7B 3UT5B 1FSZA 1W5BA 5MN4A 5CA1A 3JAWA 1JFFB 3VO8A 3JATB 4X1YB 4O2AB 4X1IB 4ZI7B 5LP6A 5LXTB 1RQ2A 5J2TA 3RYFA 3N2GB 4ZOLA 5LA6B 2RHOA 5J2UB 2Q1XA 3N2KA 4F6RB 5KX5B 4I50A 4X1KB 5LOVA 2RHHA 4U3JB 3VPAA 3C8LA 1W59A 3RB8A 4I55B 4FFBA 4IHJA 4HNAA 3VO9A 1W5FA 4O4JA
chains in the Genus database with same CATH superfamily
2IW5A 3M4XA 3IA2A 1E79A 4DCTA 1BCSB 5DBFA 1RS0A 2EZ8A 3C9SA 4D9MA 1KYYA 5AOBA 4NCHA 2AHZA 2Q6AA 4QKQA 1NASA 4M98A 4OK5A 2WK1A 3VZPA 3M6MD 4BJ3A 1EEHA 3CF2A 1J4AA 1SVSA 3RVNA 1DMRA 4BNIA 3EZFA 3JX9A 4FILA 4P8RA 3B52X 2NSHA 5AVOA 1OV4A 4G1BA 4LJYA 2QOEA 4Y2UA 1N4AA 1KKMA 4CMEA 2WNIA 5T8KC 2K6GA 4MRMB 1ZHFA 5K0LA 1ITZA 1T5HX 3EGXA 2JLQA 3FUCA 4B43A 1EJBA 2F43A 4R9VA 4KH0A 5JJJB 4F4LA 1Y8RA 4YJ2F 3MFYA 3FZYA 3EOAI 3LX8A 3LD9A 4FQ5A 2VO1A 2MCFA 5I51A 3C48A 2PRJA 3GGOA 4OV6B 3CWZA 2IZ5A 3OR7C 4UD6A 3FLAA 3QTLA 3TXYA 2Q2WA 3BMNA 3OPMA 1EUYA 2VTVA 2ZRCA 1YBAA 5IJ0A 4U0KA 3AVTA 1OH8A 1Q43A 3Q87B 4LOAA 1WMBA 4UM9D 3ZNQA 2NVOA 3RIGA 2BOBC 5JFTA 2ZR7A 3WDSA 4KHPO 2VJKA 2WV7A 4TMZA 5EESA 3R65A 2HGZA 4PN3A 1EUQA 4QDJA 4BV2A 3RUHA 5JXGA 3CJHB 1AKQA 4FGWA 5C7YA 4PZYA 3FFTA 3UV3A 3DKIA 1ZJYA 1DCFA 3JAMA 3IBFA 1JDSA 2Q8QA 3IAXA 2P2YA 4XOUA 3ROEA 3M2PA 1NXTA 3DT8A 2WFLB 2CFRA 3D2BA 3SZMA 4PXAA 5KWVA 4CS2A 3CCMF 4R2XA 3CUWA 2NUBA 4RDHA 1PWEA 4IM7A 2OG1A 1S3FA 2WIFA 3BCUA 2MR5A 1UP4A 1M34E 3BPSA 5EVJA 3NNNA 1Y6JA 4CMIB 1JDPA 3AHJA 5CVDA 1AUXA 2ZT5A 1L4GA 3ZX6A 4JJIA 4TMXA 1ETUA 4HDNA 1P2FA 2M6LA 1NVKA 3ILSA 2CHSA 2VJLA 4PCAA 3BABA 2ZQYA 4C0SA 4LY3A 3M0EA 2ZJ0A 3SS8A 3HDGA 3C1OA 4Y1EA 3VC7A 1CLEA 3BEDA 3FD9A 5C7LO 2XRZA 1MNAA 4HSGA 2H2IA 5I9NA 3FPEA 4FB4A 2C9OA 3F5TA 1GZ4A 5LQCA 1Q1EA 3PDWA 1JYFA 3NXSA 3ZVRA 2B36A 2OHVA 3AP3A 2QLMA 3NVKE 3QMVA 5KTRA 3ENZA 3FR7A 3IURA 2PUGA 1LWOA 1MNQA 4W1SA 5ICGA 4TGLA 5EUMA 5F2OA 1D2MA 3LUGA 3PP8A 4CI0B 1RXEA 3J7AC 2N1BA 1PXWA 3NIDB 4OYHA 3SK0A 4MR9A 2I29A 4Y7DA 1T5DX 3ZV3A 1RFYA 1D4FA 2BUAA 2GEJA 3JQCA 4U2KA 1NYTA 2CUZA 1AV6A 1XDGA 3TDKA 3IAYA 1BQEA 4YJ3A 3CCFA 1XMOB 5ITWA 4WFGA 3A6PC 3A4MA 1S6YA 3B6ZA 4JP8A 3PR1A 3ICEA 1HOTA 3DMPA 2I78A 1CETA 1FSGA 4L07A 1QFMA 1N57A 4MH0R 5DECA 3CX3A 1NF2A 3NK7A 2GK7A 1UOQA 2H94A 1F4LA 5ALXA 4TWRA 1CUUA 2OVBA 2B5UA 1JLMA 5IUNC 4BLUA 4V02A 4WLFA 2BSQA 1C7ZA 3TSZA 3WYFA 3IAFA 4HDMA 5HGXA 2BGUA 3HZZA 3R4CA 5CDTA 5FUYA 4F6RB 1K4YA 2GDSA 4E5DA 4PLCA 4ZT3A 4UU1A 3PLRA 4JI6B 4LF5O 4F6LA 4DMMA 1NOJA 1YC5A 4RK1A 1ZCFA 2VQFB 1TM4E 2IHTA 1UJBA 4BIZA 4RZUA 3T34A 5D01A 2CDRA 5EIOA 1H47A 4EYGA 2C7VA 1W52X 4D2IA 5EHIA 1XAIA 1N78A 5AI9A 5TVGA 2BTUA 3C6BA 121PA 2AC4A 3ZY2A 1GTMA 4AO7A 4N01A 2GD6A 2YDEA 2IS4A 4WZBE 2B6HA 3EAQA 1MSWD 4FCTA 2OCKA 1PK8A 2RK6A 3B8HA 4ARZB 4WN9A 3L0PA 4B3XA 1OA1A 3VTKA 4ES6A 2I5PO 3H1LH 2ODNA 4F1KA 3TPCA 4G9BA 4DY6A 4UUMA 3PUXA 2D2XA 2DFTA 4X60A 2RI6A 3QQPA 3T6KA 1LF5A 4G5QA 4YGYA 5LZ2A 1H5QA 2GF2A 5LA6B 5DMHA 5DM1A 3G67A 4U3JB 4BAGA 1ULAA 1PL7A 2IK8A 1HL3A 1LVUA 3FE2A 2O8EA 2PVSA 5AXDA 2JLSA 3IR5A 1Y6QA 1RFGE 3E89A 3LDGA 1AUOA 1N0JA 3GY0A 3DULA 3CBGA 2F95B 4JZGA 4IFIA 2CLKB 4KXVA 5FTNA 1I6MA 4QOGA 4IMIB 1FYFA 1P7PA 3K0AB 1MA3A 5D3QA 5C5IA 3Q2OA 1NYRA 4C01A 3KIPA 5B7GA 3H1HH 4YJFA 1TXGA 3B3AA 4AMBA 1A76A 4E4EA 4EY7A 5KNBA 3CZ5A 3QPVA 1AQJA 3B9QA 1D0SA 2DG2A 4PNEA 1Z39A 3J80A 2OWEA 1E96A 4P7FA 5JLAA 1Y34E 5CNKA 1XQYA 3CCEF 1U3VA 2BELA 1HQKA 1HXHA 3PFGA 2YFKA 2MTBA 5HDBB 2RGDA 2XGMA 2V7QA 2JF0A 3B1JA 4LS3A 2FEKA 2CF5A 4QU9A 3GCGA 4JOCA 1AA6A 5BQ5A 3GLRA 4YIKA 5FWYA 1L7BA 5GM2A 2VPYA 1JIVA 1F0YA 1L0BA 3CVUA 1WNFA 1UDCA 4MTCA 1CWUA 3Q11A 3H87A 4UUOA 1XL0A 2VSQA 1MH9A 1RIFA 1X1DA 1KR2A 3KDAA 4LGMA 4K0KB 5ALJA 3OEHG 1PYDA 3D8RA 3O95A 4EY4A 4Q24A 3JQAD 1W0JD 2YV1A 4TYPA 4BEBA 4ZOCA 4UVCA 3UW3A 4DBZA 2M6SA 2Q9LA 5A9SA 1GMGA 3AVUA 5L4NA 4UVBA 1LUWA 3QHAA 2C83A 1PEKE 4ZHQA 4GD3Q 3ZZTA 4RHTA 1NMUB 4KBGA 3S0JA 4I4TF 2JIQA 4RFVA 2CE4A 4MO2A 3RHSA 5EJIA 1UZUA 3DQPA 3FSEA 1DTSA 1RTKA 4REMA 4PQYA 1TU3A 2O2HA 1U0LA 2AN9A 3NPAA 4YRNA 3Q4HA 2VNHA 1R2QA 1DAKA 2HQOA 1RLGA 4EY3A 3WKEA 3W2EA 3F7YC 1QVGF 3JQFA 3L0BA 4MK4A 4M0CA 1VP7A 1T2CA 4KYUA 1DF4A 1QLWA 3ABLC 2ZIFA 5BZBA 3Q9SA 1P5RA 1T8UA 3HSKA 2WKWA 2ZRKA 4GQAA 1IFXA 2BTQB 3MEQA 1AXGA 5JS8A 3RF7A 3WNVA 2DYKA 4J41A 3H9GA 1R4MA 2PX2A 3UBMA 2KLHA 2XTNA 1AJPA 4MW1A 4FK8A 1GGNA 4J29A 4F2HA 1HZZC 3ZS8C 1T4CB 2V03A 4URYR 4A6EA 3DVSX 3LC1O 1XXHE 3EPRA 4DO2A 1UUFA 3DFIA 4PINA 1C30B 2PUEA 4EGQA 3HBFA 4CKYA 1ILWA 1WUTA 4PC3A 2NT4A 1XRJA 1UJ6A 4TWAA 2O2JA 1VF6A 1EVQA 3LX5A 4AZ0B 1JNYA 1A95A 3LUAA 3QIAA 3OW2F 3OCZA 5EZ5A 3MD9A 3VPCA 2KYRA 4BT5A 4U2BA 1OWMA 4BNLA 4EVSA 2FYUH 4H27A 1FLAA 3ZUGA 2D1SA 5CDYA 4NONA 1PGNA 3FJYA 5JBQA 5D86A 4OK6A 4YRZA 3L4SO 2AI3A 3SZGA 3W7SA 5EWMB 4ZVRA 3GVPA 3W2FA 3KUXA 4WUTA 3FVRA 1UDWA 5LKRA 4Y6QA 4IT5A 3DLIA 1FTQA 2QAIA 5BN3A 5IJZA 3EXHC 5IYZF 2FQQA 2V4DA 5ALFA 1JLLB 2O3UA 4U2EA 2IYNA 3SLGA 1WXDA 1AZSC 1EHYA 4P1ZA 2PNJA 1E6MA 3W7BA 4BQIA 3N74A 3LUHA 4DV6B 2VJPA 5KTOA 4FT2A 3B60A 2ZSJA 4TWKA 3X2SA 1JJ7A 2PV7A 2WA1A 4J03A 3VV3A 4S24A 4UREA 4Z0NA 3SWWA 2FOXA 1AX9A 3G0HA 4LF9B 3UQZA 3CCUF 4RSGA 4XQ0A 4EI7A 4YECA 4UVAA 3EN0A 2B61A 1PJQA 3R44A 3K9NA 3IEQA 4L2IB 3KZOA 1XHXA 1IE3A 2OIGA 1KGDA 2IUFA 1L8LA 1ZK0A 4C3OB 1CEQA 1E3EA 1PJ3A 4RVCA 4AILC 3ZU3A 1A7JA 2IPOA 2MSEB 1XRSB 4QNRA 3CX8A 1JVBA 4KRXA 3B6KA 4MRRA 3ZHYA 5FL3A 4LIPD 1OGIA 1ZH6A 2A35A 4GM1A 4B46A 2Z3VA 2PHZA 1VEWA 3VPXA 1MHPA 3EXG2 4MVJA 2YWBA 3FBTA 2DTEA 2C3OA 2MYNA 3IDOA 2CCJA 4GVLA 4FZ5A 3OZGA 3D54D 1GCUA 2OZBA 1WZUA 1Z28A 3DQQA 1BZYA 5KYGA 2O48X 3AR6A 4INZA 4NCXA 2GM3A 4NESA 2WVJA 3OTIA 1SCIA 4MVJI 3F2VA 3DD5A 2F3UA 4XWOA 1CNFA 2QE6A 4R1PA 3QP9A 3LYAA 5C18A 4DV1O 1SA0B 4L8YA 1E7MA 3IT3A 4A92A 1MKYA 3PPVA 4LHXA 2PTGA 2NZXA 3C70A 5F7JA 2Z1NA 3U3MA 4EW1A 5BT8A 1Q6YA 1B76A 4BVFA 2ZZMA 4PSKA 2IV3A 4YAKA 5EP3A 4MLPA 4ESEA 4ID3A 3NIGB 2ENUA 4YP7A 4DJAA 3WGUA 3TBKA 3DBLB 2PSDA 4IYJA 4XAQA 2JDIA 1H8ED 4YMLA 5JDCA 2Z6UA 2AXQA 2IX9A 2J5QA 1GFSA 2QP9X 1WUHS 4CKWA 1JEOA 1C7IA 5ADWA 4DXAA 4XDGA 1MW8X 3SZOA 5IANA 3GFQA 1H9AA 3KV3O 4LDQA 2JHGA 1G8JA 3KXPA 3PPYA 1U0EA 3F4KA 3L71H 4J9VA 4D9HA 1PWYE 3GX1A 5FOXA 2NMUA 4C82A 4PGFA 4G4YA 1ZXXA 1NN5A 4Q34A 1DX6A 3H11A 3A1DA 1I3LA 3ISTA 3GRYA 3X1ZA 3FF1A 4TTRA 3EIQA 4Y18A 5BYJA 2IKQA 1R15A 4MQFB 4G0YA 3CLRC 1XDSA 1HW7A 2GERA 1QNLA 1M1YA 1NW9B 3PF9A 4N47A 4ZOAA 1IK4A 1SBTA 3K9FC 2DFNA 1ZVJA 2H85A 3G1UA 5IAEA 4HZUB 2GHYA 3KQWA 4QG3A 1YUBA 4BJ5A 4AYXA 4EKYA 3UPTA 2XZDA 1ORIA 3REOA 4Z3KA 1KE1A 1A7UA 4Q3KA 3P32A 1A8UA 3ID6C 3A4LA 3TLKA 1BRTA 4QLBA 1NVTA 2WFLA 3ESRA 3INTA 4E6EA 4ZGBA 3MJFA 3QFRA 3SIWA 1Q82H 2X0JA 3RT3C 3LV8A 2BO1A 1FNCA 4XRGA 2GVZC 3THXB 5DT2A 3HXLA 2C9BA 2OZKA 4CI9A 2F3TA 4N5NA 3VYSC 4WZAA 3U7QB 1Y4SA 3A3PA 4OQNA 2EGGA 1QPGA 2QMZA 1PR0A 2C82A 3ITKA 3EDRA 3FDZB 4P2GA 1LTHR 3GLUA 4KSCA 2Q3JA 4I4LA 4JBGA 1ZITA 4BCBA 3ACDA 3MC1A 5BMOA 4UTVA 4W5OA 3W6ZA 4JJ8A 3I2FA 2QQFA 3QTBA 3DEHA 4HADA 4AKSA 3NATA 3OBBA 5KU1A 3HMQA 5LP6C 5A3JA 1IXYA 4RD6A 2WOJA 1CZOA 4MKZA 3ZPXA 1VF5B 3TW4A 1UXKA 1W4LA 1Z68A 3WMWA 3TMAA 1VE9A 3N2ZB 2BZGA 1EAYA 2CMKA 2O8BA 2BMFA 4G85A 1GTL1 1HF3A 1FU4A 3LBHA 1UMBB 3SE0A 1UFOA 1IHYA 4TTVA 1G4YB 4TYWA 5DBHX 4MDHA 5JJEB 2ZUWA 1GUBA 2OILA 4X85A 5CVVA 3SYKA 4DLTA 3SJAC 3IMEA 4ZOLA 4PWTA 2PQ2A 3GBPA 3L0SA 2AN5A 2WSMA 1C1XA 3VPAA 4O4JA 4YRTA 2BFDA 3CPSA 3GJ4A 1FD9A 2E4ZA 1FJGB 4BC0A 2HQSA 4BMVA 5EZYA 5KUTA 1GTG1 5KHHA 4ZRNA 2C2GA 3WGLA 5LOVB 1GEGA 1KSJA 2Z4SA 1R0RE 3QPDA 3FOZA 1J8VA 2VYCA 1C3XA 2XKJE 4GRDA 4MTFA 3P0ZA 1RHJA 3E4DA 3KD3A 3IKVA 4ZEVA 1EZ4A 2P2DA 3O7MA 1U5AA 2XGJA 7REQA 1F2TB 3G2JA 1TA0A 1FKAO 4ZVTA 3V4OA 2W2KB 2PBRA 1DIRA 4DL9A 2XT0A 2J32A 4D9JA 2IHUA 5BR1A 2X6TA 4BKUA 3JVEA 3DO6A 1BSMA 4DCGA 2GO7A 3CNHA 4JGIA 2HHHB 3G5LA 5TIIA 5EKXA 3UXHA 2OM2A 3E9EA 1Z5GA 3L46A 5F7OA 3DDOA 2ZIXB 5D6NA 1W88A 3LTEA 2CVPA 3AOEC 2H54A 3N05A 4LXUA 4XW2A 3B1KA 2ZTLA 3BMOB 3VH2A 4MB2A 4ZREA 2UYCA 1DDGA 5FRDA 2Q5FA 3P2MA 3AVYA 4DDMA 5FOWA 3QU2A 1VJTA 1JSXA 4TLDA 1I5OA 4BLSA 1V5GA 1FCJA 5BSFA 4Z4EA 3HJTA 1QVWA 4BNNA 5A04A 1DLBA 2WJYA 3GUHA 2ZCJA 4FP9A 1CK2A 1NLYA 4QGPA 2CNKA 3SPHA 1PP9H 2R8OA 4ZJZA 4KJZA 4YRQA 2C04A 1L3CA 4BJ6A 1ZZGA 2PFSA 3HGTA 1NOKA 3C85A 1XKTA 5LA6A 2CDCA 4DWOA 2W8BB 2P27A 1YR1A 1ZX3A 4L5BA 2O3QA 1GKUB 2VDUE 4BUJA 2Q2OA 1T1RA 2LUOA 3ONDA 4NZNA 2DQKA 1QSGA 4BE7B 5JSHA 2VGNA 2ZYIA 2BGLA 2X9VA 2WUGA 3GDWA 2WLIA 2QUJA 3T9EA 2CKMA 3I72A 2JFFA 4GXNA 1O57A 4NC9A 4BO0A 1MPXA 1US8A 2LR0A 2FF5A 1VP9A 2J4CA 1MJNA 2A14A 3AXTA 3KTOA 4LPSA 1GA4A 5HNKA 1VCOA 3FKQA 1BS9A 1J21A 2ADOA 1ORWA 3CRRA 4TVSA 3LNMB 3DFMA 3DNFA 1YACA 5FWAA 3ZUPA 1K9VF 1ECGA 2C5FA 3RVRA 3ROKA 2DULA 4OXNA 1K8RA 2J31A 3FF4A 1Y8ZA 4XJSA 2ZRGA 1V43A 1FDUA 5EO3A 1M1XB 1WDWB 4M37A 5L3RA 3RU3A 3TD9A 1B16A 3TNFA 5FWDA 5HS4A 1D5NA 1U8ZA 1X7XB 4GECA 3CTPA 1N75A 4BO3A 2N74A 4Y2SA 4XJXA 1UMKA 1QV7A 3K05A 1DO8A 1USUA 3R9KA 5G40A 3B82A 1ZD2P 4LF6O 3LLSA 4ETMA 1UH5A 4X1YB 2XMDA 3VUFA 2PSHA 1G7SA 2P79A 1WPXA 4Y3UA 3R8CA 2ZSUA 3LWZA 1RSZA 3TO5A 1F3LA 3PT5A 2IDKA 4P82A 1B8UA 3GWGA 3ZG6A 2RBGA 1NI8A 5KA6A 2RHCA 4UOEA 1KERA 2N47A 3BFVA 4L85A 4NIMA 4PANA 4BY9D 2PUAA 2JGDB 2VWHA 3H4MA 4RU1A 2VHXA 3PQDA 1MQSA 1MTOA 1L5MA 5KYXA 3DXRB 1I3OA 1DBIA 1J2EA 3F6SA 2JHPA 1S72F 3TOSA 3H5AA 4PNPA 1KYOF 2QJWA 4FGJA 5TXGA 1GRJA 3NUZA 3DB1A 3TAHA 5AM3A 2BIFA 1C9NA 3W7TA 2HF7A 2O7SA 1GRNA 2ECKA 1N8RW 1C9MA 2B92A 3WGJA 1ULSA 4ZCIA 1OTXA 1MX5A 1E6CA 2FV8A 2LNDA 4OYLA 2ZT6A 4ADSG 2OB2A 1CR4A 2FHSA 5AM0A 4DF3A 5CP8A 4ICGA 5HQTA 5IBCA 4HEQA 1J2JA 5JWRA 1YI8A 4KN8A 3K9CA 5KIAA 3W7VA 4AS1A 3KCQA 3NALA 5HOEA 2CXRA 3QYFA 1WPRA 3HYLA 4N3AA 4PHTA 1WJGA 2WUVA 5ESRA 4LY6A 4M0KA 1W93A 2V7TA 4ED9A 2I6GA 5B3SC 1YL6A 1AXEA 5GVRA 1F8XA 3EH1A 3TZ6A 3RS0A 2CD7A 3V4LA 3OECA 3BFPA 4AZ0A 3GV0A 4HH4A 1QK4A 5BP7A 4UJ5A 3GPIA 2EJBA 3K4HA 2GLXA 3QVNA 4F93B 5AVRA 1LPPA 1B0AA 2RHMA 1OXMA 4XGKA 1BMFA 3ZU4A 2VNKA 3RE3A 2JHAA 3IIKA 1QPZA 2IELA 3SYLA 4AJHA 5I5GA 3E03A 5DWQA 5B1NA 2FJUA 5B6IA 2A1TS 3GNLA 4TTIA 3QXGA 1HLGA 5EWMA 1L7XA 1YDMA 3OU6A 1Q3HA 1JQBA 4E30A 4DB4A 4EVRA 3DEFA 4B5LA 4MNTA 5EUQB 2RGBA 1V9PA 4BLOA 1N4DA 3G6KA 4DIOA 4DLBA 1K5HA 3KOMA 4MV5A 4OMCA 2W2LD 2F4VO 5KI6A 5FPKA 3MF4A 1ZJZA 3RS5A 2VBFA 4W7HA 1XVVA 4TN5A 1PF5A 1GN2A 3UV6A 4QXAA 3J7AU 4PF1A 5JBIA 4AW9A 4BQNA 3TPFA 1B4DA 3O83A 3GFPA 4MUGA 3EA0A 3SGLA 3SPGA 3U4MA 2AJCA 4KN5A 2BKUA 2E3CA 1UODA 4EFMA 1EFLA 1Z6PA 4LVCA 4ZYXA 1SD2A 3BFKA 1FU8A 4PZPA 5AJXA 4B3SO 3OT7A 4NB5A 2LZ0A 1XA4A 3LYLA 4H18A 3U4GA 4NAVA 3OQOA 3GVXA 3ZD9A 3H2KA 2R8PA 1N9ZA 4FEYA 4NCIA 4DJTA 3F9RA 4FDMA 4IZOA 4KXYA 1E79D 3W7XA 1SC5B 4EPYA 1BCCH 2DN9A 4EB6A 5K5EA 2QRNA 4QJ3A 1SETA 1SVKA 3K6RA 5BWNA 4CEHB 3W4KA 4MW3A 3HCCA 4HX2A 5C8YB 1B3QA 2IU4A 3FPCA 1MJGA 2O0JA 4D4MA 1ZAUA 3AR2A 3G2HA 3ZQJA 2UYHA 4IIHA 4MYTA 2VXCA 3OUTA 2N75A 2WWRA 1HK7A 4P5DA 2SECE 5KNDH 4LP8A 1FJHA 5JZBA 4KZKA 4LMRA 4OREX 3H19A 1A8QA 5B3AA 3GI1A 3MXTA 3NYIA 5AVKA 1T1GA 3OUZA 5HJEA 2KQUA 1S9HA 2D74A 4AY5A 2ARKA 2CCGA 4FN5A 4QEZA 1CIVA 4Z4HA 3ISJA 3OTQA 4OJKA 1XNGA 1HQDA 3HWWA 4BIOA 3OM1A 4HJXA 2XXAB 4PO8A 4XIJA 2P65A 4CLOA 3ABQB 1WXIA 4LRTB 2V0CA 3AFOA 5TB5A 2B4TO 3T0GA 4CNQA 1DRWA 5BVHB 3DBLA 1LLDA 1VMEA 1XTSA 3E53A 4UVDA 1A5AB 1IBRA 4H60A 3EORA 4IIBA 3HUEA 4JI3B 2GILA 4DT1A 1VA5A 2ABWA 1JLKA 1NW6A 2O5VA 3GEHA 3GLHA 3PJGA 3QKSA 3MVEA 3DEYX 5CG1A 1DP4A 2R44A 2PI5A 4K3AA 2GJSA 3DP9A 3IP8A 1ONNA 3B70A 5CD9A 5G0TA 4RAOA 4GGOA 3D00A 4O2BB 2ZWPA 2YCLA 1J1UA 4TPKA 3KUUA 1PZEA 2PWYA 3WIEA 1DB3A 4KMMA 1S1MA 1HBJA 3G71F 4B2YA 4MRSA 1NVPD 4OYRA 1KU9A 1V9SA 1MFZA 4GI3A 4KXFB 5SY6A 3D5TA 5T3YA 2DEUA 1FNMA 1J9ZA 2H4FA 3TG2A 3RC2A 1L5QA 3FMPB 3F0DA 3GFRA 4G4ZA 4CV2A 3U7FB 1UBLS 4P4LA 2GXQA 4ECEA 1XRPA 3IYLW 4R0MA 1BA2A 4FLZA 3HR0A 2EZOA 5IWCA 3HWRA 3VYVA 2LW7A 1BROA 3F8TA 3WNCA 4B6QA 1U28A 1OYVA 1NR1A 1QNMA 1GGJA 4OAOA 1XLTA 4Q20A 2R8EA 1RU3A 1XVAA 5K3DA 1ZIDA 3P2OA 3ETDA 2XQVA 1NQVA 3K9WA 5B6PA 4JUCA 4P2ZA 5G02A 3RE1A 2FC3A 2DPGA 2CHQA 3VVBA 4IMPA 1VGQA 2A5JA 1CUCA 3D8TA 3IBTA 2G67A 5C4MA 1XDCA 3NVDA 1L5SA 2W6JG 3O5AA 1OJLA 3MTAA 1T8SA 4KFSA 3QF7A 3B1FA 1KWGA 3SMQA 3DBVO 3GDHA 3TLCA 4E3WA 3NHWA 3SNHA 2NU7B 1HLPA 2OFXA 3TKYA 1G55A 1NHGA 4DA7A 1WB9A 5FXMA 1LBSA 1DFGA 2GUGA 1H2KA 3VDQA 4FR2A 4BUCA 2C42A 2Q7DA 3CCVF 3RSLA 2NU8B 2GF0A 2YYEA 4BVGA 3HJHA 3NCTA 4H7KA 4MV1A 3NRJA 3AFNA 1TZBA 1GAQA 3RI3A 2NZVG 1NXQA 1DO2A 4YLGA 1I2CA 4F8JA 3CEAA 3NCHA 5KCMA 3DEIA 3TS1A 3U7RA 2B94A 4YCDA 3JY6A 1JN1A 4UEQA 4TWIA 2SHKA 1SUEA 5DW3A 3BCHA 4DMGA 3WC4A 4IHJF 5B1SA 2PYJA 2BGMA 1USVA 1DKLA 2VJCA 1WZCA 1Q7EA 3JAWA 1Z8DA 2VAVA 4H31A 5ETJA 5LOVA 4G24A 3DE0X 1GVNB 4U02A 4JP1A 1S4MA 3A70A 4RD3A 3RVQA 4I5EA 3JVVA 2Z8YM 1TPZA 2LKCA 2M6YA 4XVUA 1YZLA 5CBFA 4P9NA 1ZGZA 4QD3A 1NJSA 3ACCA 1SULA 1S3GA 2C4NA 2WM8A 1QHGA 4UV9A 1K92A 3DOUA 3TIGA 3FRJA 2XCRB 3FZEA 2R0QC 3SYCA 5IC5A 3OUUA 4DSAA 3SR3A 1X1CA 3QKUA 5IMBA 1GADO 1ZK1A 4BMZA 1E1RA 4FLVA 1GJRA 3M2TA 1V8OA 1USGA 2VP5A 3R3UA 3FDIA 2HT6A 2VZEA 3OY7A 5I7EA 3P20A 5CYFA 3ZY3A 4JTAB 4FYMA 1MJHA 1KETA 1U3PA 1FYWA 3OHPA 3SJCA 2DRIA 2ZULA 2W90A 2VIIA 1YR7A 3EVNA 3K5IA 1K89A 3MBKA 2FDCA 4G0PA 4KMOA 4DR2O 1IYZA 4YAEA 4D7AA 4G0OA 1E1CA 4QYMA 4MPJA 5I4BA 1NBMA 4RY2A 2IEBA 1YA4A 2RHLA 5AVWA 4OQXA 4X64B 1GTVA 2OGZA 4L5IA 1HQYE 4C6RA 3P9SA 3VZRA 4JR1A 3O84A 3DAPA 5ALPA 2NZWA 1M74A 2IBMA 1I14A 2AEEA 2ATCA 4K8ZA 5KNBD 5FULA 1C1YA 1GN6A 1HL7A 5BUCA 3JTEA 4YMTA 3NT4A 3OE5A 1OXXK 4HUTA 4B17A 2PZ8A 4J1TC 4JB8A 2HJDA 2VYNA 4MV0A 3OX3A 2CJFA 2OO5C 2QLFA 3OIWA 3CY6A 2V7QD 2F6RA 3CLHA 3MTQA 1Z0JA 2NYAA 4H4DA 4M83A 2MMGA 3V2IA 2XY4A 2VHEA 2O7NA 3PB3A 2PWAA 4M54A 2HRRA 1MX9A 3BRSA 4I5SA 4BVEA 2AYXA 3I9FA 1Y6XA 1IMJA 4R5HA 1MVLA 4NYIQ 1QU3A 1FJXA 3VPDA 2GLUA 3L3BA 4HDSA 1P1HA 4A5SA 3GLIE 1TQ8A 1EUZA 4Z4FA 2AOUA 4RIEA 4J2OA 4FYKA 3FIUA 5AKIA 1RTTA 1P1FA 4KVZA 2OCCC 4LWZA 2BRUA 5TDHA 2JZNA 2OM6A 1Q83A 4TQUS 4B0PA 1SQ5A 4J2TA 5I4CA 4XFDA 1TI7A 4DUGD 1XX6A 3L0IB 1N2CA 1JKFA 3DZKA 2I2XB 2VDOB 1SRQA 4MULA 4KODA 3HUDA 3V7FA 1ZWLA 1U2SA 3SX2A 2HZBA 4W6ZA 4N6GA 3DXYA 1N3LA 1UI9A 1KY3A 4D4JA 2IODA 3C0KA 4D25A 3B8NA 1EMDA 2P6MA 2RI0A 2VT7A 4NG4A 3W7WA 3AZQA 3TIFA 4B7EA 3W8FA 4AUNA 5I47A 2JGDA 5HRAA 2IPMA 4RZHA 5K0TA 2JJ8A 4UHHA 1Y81A 2HDHA 1A82A 2OYQA 2APJA 4XWTA 2GBOA 2N3ZA 4IJKA 3HNOA 2EEZA 3BWMA 2FZWA 4D4HA 1H0KA 1G8GA 1B2LA 3WIVA 1W9MA 3H1FA 4I9NA 4WPGA 4Q9DA 4MB6A 3DG9A 3C3DA 3SF8B 2Z4RA 2CLIB 2CLMB 4PJ0Z 5FUVA 5C8VA 2B1JA 4XGIA 1F1BA 2XOEA 2IEGA 1V48A 3LWQC 5AXCA 4Q03A 3HCOA 5HDQA 3C8UA 5JC8A 2PI4A 1J8DA 4CEJA 3LSYA 1JEDA 4RXMA 5LQRA 3DV9A 3B7GA 2FN3A 1NGSA 2ORED 5DTEA 3MT9A 4JN6B 4OA8A 4LZAA 2EJTA 2QTZA 4A6DA 3HABA 4N5HX 1CBUA 2JKYA 3WL6A 4C05A 2JL1A 1KXJA 2P3SA 1JAIA 3BBPA 4RV9A 1W75A 3TEMA 4FFNA 1VZ3A 5D85A 1QHFA 1AKRA 5JISA 3F49S 3MELA 3AF1A 3F98A 3M3PA 2BMEA 1K5SA 4U9UA 2HMYB 3KUDA 3TSWA 1WOYA 4Q1BA 4M7RA 3ZLVA 2QRVB 3CUEF 1FSSA 2UZIR 3JD3A 4D6PA 1TIPA 3WRWA 1A4RA 3H1GA 3QU5A 4X9QA 2ZBRA 1D03A 2ZIVB 2FDXA 2PGOA 3RREA 3AY3A 4HDRB 4FGSA 1SOWA 4Z0PA 3KE9A 5KUMA 4ZT6A 1GV0A 4XDKA 4FVTA 2AHOA 4RULA 4P9PA 5I9LA 1QV6A 2IP2A 2JNWA 3HKEB 3I6IA 1GGKA 4H59A 5IRCD 3C5CA 3H1PA 2IY7A 3ZDCA 3R77A 2HBYA 3OC0A 2FMLA 1HORA 3TL2A 2A8YA 2OZLB 2B9VA 3OETA 3FNIA 3IHTA 2QGZA 4X95A 1M5UA 1W30A 3A9RA 2R8ZA 4ZWNA 3IALA 2OV6A 1PS0A 1LSOA 4UQLA 5F98A 4C87A 1Z4OA 4DSZA 4CG1A 4I19A 5JTTA 2YV5A 4Y1FA 1Z4KA 1NG9A 3TQCA 1PL0A 2F00A 4NBWA 4YYZA 4QAQA 3K5WA 2JCXA 5KO2A 1IPEA 3VDRA 4BN4A 3LBAA 2NPOA 4RXUA 1LWNA 2NLJC 2AE1A 1CJUC 3I12A 2DWQA 1U81A 4KDFA 2ZS7A 4EPVA 4NBSA 2D7DA 4B6RA 1K73H 1N5OX 2YBDA 4TQ9A 3V1YA 4CT0A 5CR9A 2EINB 2C9YA 4FZJA 3R0JA 2MU1A 3ONFA 1BDHA 3HZHA 5D51S 4DN6A 1NTZH 2Q6KA 2Y66A 4J6FA 4F71A 4EHIA 1RMQA 2NNWB 1EWYA 3IT0A 4RELA 3MWLA 4DJFC 2QRKA 3H4TA 2XNKA 4YHHB 4K6CA 4KQ2A 2KSQA 4JL6A 4WH0A 1V54C 2NTYC 5JG7A 1QCCA 1V8ZA 1VYVA 1Z83A 3VU0A 3AL0C 1JPXA 1QIJA 2IP4A 1TTPB 1JKXA 3I58A 5GIPE 3FRHA 3L7IA 2A9VA 3C3SA 3QBTA 3T1OA 3VQYA 1I6WA 1Z4NA 1E2MA 4LBVA 2WSLA 3WNDA 3PXBA 1X1SA 1D1TA 3N27A 1CU1A 4PO3X 2M32A 3ZDZB 1VL2A 1Y98A 1TC2A 4B9EA 3KKMA 4GZ3A 4G0XA 4P7JA 3ENVA 3E82A 2JDID 5H6RA 2DKOA 1G4HA 3UUEA 3OZWA 1A5BB 1VMIA 4QXRA 4BFLA 1TCAA 1K5PA 3KJEA 3GRAA 1EM6A 2W0SA 4DLPA 4FBMA 1F6WA 1H4QA 1UQTA 1WF3A 4O0MA 3D6NB 1Q1BA 2E4WA 2PL9A 2CTPA 5F64A 1JEEA 4HXGA 4B6OA 4YY3B 1IOZA 3O90A 3DZCA 4EPWA 4YCCA 1R3KC 4WQMA 5ADVA 4MW4A 1G98A 3FWPA 2O5CA 4AJ4A 4BE4A 3OIGA 3RC9A 3QE4A 2ZB2A 1BHO1 2C98A 3ZWKA 3VTIC 3AWDA 3UHOA 4RQUA 1IN5A 1DBQA 2EYQA 2POCA 4YRCA 2FMXA 1RCTE 1LSUA 1IXZA 3LQRA 4IUDS 3GJTA 2O5EA 2PX8A 4QUHA 4CKXA 3C8ZA 5K3SA 4ND1A 4OXSA 5GJVC 3SE7A 1SU8A 4O2BA 5EG5A 1PG5A 2QP3A 4Q16A 2GO1A 4ZCTA 3QVJA 3D3IA 1P6QA 2PUJA 1R3DA 3AU9A 4PS0A 4B7KA 3U62A 4DQ0A 2QJRA 5CB0A 1V8BA 3ZHSA 4IFBA 1XPJA 3OM8A 2ZUTA 2E0IA 4OXYA 2P69A 4HQLA 3GFSA 3W5BA 4R8VA 4U9IS 3FHTA 4WJZA 3ZWNA 1KZ6A 4L5CA 1U1GA 3VHRA 4EARA 1SVIA 1JXAA 2YOFA 1B73A 2AD1A 4GQBA 3R6WA 1PFYA 3AKEA 1X0XA 1W94A 3ZTYA 1KYIA 2PJUA 4P4NA 1H8HG 2FX3A 3OFNG 1PQ4A 5HF8A 4Y6SA 3IH5A 4L8LA 2QBYA 4UDOA 4OP2A 1FP2A 1D4ZA 4EEKA 4PU0A 1II8B 2QAGC 3AVXA 4J7UA 4AJ2A 4WCEV 4H13B 1RWQA 1WB7A 4OUDB 5FLEX 1BJTA 1YQWA 1ZU5A 3MT0A 5JEDA 1YRHA 5DGTA 4C7OB 3NOVA 2PHNA 1RJFA 3S7TA 4Q6BA 5C7IO 3LHIA 4EGFA 3OCVA 1K1EA 3C8HA 1XTIA 4CFYA 1TKCA 4PWYA 1AI4A 3FROA 1YKGA 5HRUA 4MR7A 1M5RA 1SB8A 2HRCA 2ZROA 2A94A 1SOUA 2R1TB 4JJ6A 4DR7B 3R3YA 1HKUA 4BVKA 5B7NA 4UU8A 4V0NA 4LRXA 2I2WA 2R9VA 2WWHA 1ZEJA 3GLFE 4O29A 1KGSA 4O0LA 2GPYA 1ZOSA 3USES 4I1VA 4GPTA 4DQDA 4BX9A 3RRNA 5ENZA 2F3QA 2ZDQA 3D3QA 5EBLC 5BMVF 1C2TA 4OHMA 3RADC 5AJTA 2A9PA 2G4CA 4ND8A 3EEQA 5LUAA 5C7OO 4EUHA 4KMRA 4B4VA 4NYJR 3HUUA 1NVXQ 5FV7A 3GJRA 5E79Z 3SSNA 4IIJB 4QGHA 3IE0A 3WGTA 4JODA 1U9IA 3UN1A 2EX3A 1ZICA 4C0KA 1THGA 4P0PB 2LCQA 4N76A 1F60A 3KFLA 3DC2A 2I9PA 3TEFA 1RZVA 1QYWA 1A96A 2AMYA 2PS9A 1K0FA 5ARCA 2VHVA 4RETA 1KWKA 3KFXA 3RVPA 3BVOA 4FYIA 2X42A 4PQRA 2X7XA 3A3NA 2WIAA 4I3FA 3WWPA 1NZFA 4P98A 4R4JA 3W3AA 3KOOA 4F12A 3OCUA 5F78A 2H8EA 3RK1A 1MDFA 3QX3A 3P52A 2C95A 2C84A 3T1HB 3KCNA 1ONPA 1EFRA 1SH7A 4WLUA 2QZZA 3ZWBA 1KRHA 5FI3A 3GU3A 2Z3ZA 4PPYA 3CG6A 1UDBA 4WK6A 2NVBA 3X1YA 5ARDA 3BDIA 5CX1B 3NM6B 3S28A 1RKUA 3N75A 2CBGA 3PTLA 2RE8A 4DCUA 1KAQA 1SBIA 3JQQA 3ZIAG 1TM1E 4INOA 2VZ9A 1XHOA 1NI5A 2POQX 1KJQA 1ONSA 3V9PA 1NMEA 2Q9BA 1DX9A 1HO3A 4H1HA 1A9RA 1ZXBA 3SQXA 1MO5A 4G1FA 1JSRA 3OQHA 3IB6A 3ZCTA 4B7ZA 2RHJA 1LBQA 1E6KA 1NDQA 4C0LA 1NBAA 2GS9A 3M83A 2YWRA 5CYOA 2OORC 2CJXA 2IYYA 3VKHA 4MVQA 1NR5A 1KO7A 1J97A 2OV1A 5DOZA 3CISA 2Y1FA 3GRZA 3Q5DA 4TTQA 4H37A 1M0WA 3SICE 3SXUA 5FLYA 5A1JA 3DVQX 4MPDA 2R9RB 1VQ7V 5IT0A 2V5UA 2XYQA 3H6GA 3GLGA 4X20B 5CB4F 3QVTA 3UCEA 1FL9A 3F7MA 1UJNA 2XE7A 5A1TA 5FFMA 1D7AA 4B47A 2CLCX 5FJJA 4CZ2A 1YFKA 2JVJA 3QFHA 1XZLA 2I1VB 4RPHA 5IE9A 1JILA 1QGED 5LMUO 3ZZNA 3KR1A 2IU6A 3D8NA 4LCUC 2NYRA 2VTBA 1M72A 3QYPA 2HBRA 3DDCA 1AKWA 4L5YA 4LY9A 1QKJA 1ISSA 4JI8O 2HQRA 3WRVA 1A1SA 2IOFA 3ZBPA 3T1YO 4R3WA 5GAPK 3INGA 2JVKA 3AV3A 1AM4D 2VUIB 1P31A 2QPLA 1M6NA 5B53A 4ER7A 5CCDA 5H16A 2XNCA 2X4LA 5TMBA 4DS3A 2RIRA 5EBWC 2OT3B 3T8YA 3AUKA 4S04A 1B6GA 3UO2A 3BSYA 1GPH1 1XTKA 1WY7A 4WFIA 3RVBA 2FSIA 4B2LA 2CDAA 1E5XA 2O23A 1L4FA 3L2OB 1NU1H 2FEOA 3BGWA 4JS0A 3I6QA 5IDYA 1IV3A 1N5IA 4B3MB 1ROPA 2ZIAA 2C1EA 1ONOA 2CXTA 2AZTA 2RFLA 3PYMA 2PWPA 2E49A 4CM1A 3DCYA 3C24A 1EXDA 1BXRA 3KO8A 1VLJA 5E9AA 2FEPA 4Z9FA 3WIOA 1U3DA 2QD1A 4YO7A 3PE4A 1KQFA 3URMA 3ANSA 4B79A 2CVZA 4FMTA 1P2UA 3UZUA 4A0RA 5HM6A 1CEXA 1BCSA 3UJPA 4OFZA 2AMLA 4TRMA 1E4OA 1ABEA 1VH8A 2GNPA 4GGPA 1C81A 1WB5A 3U26A 1BMFD 3PPXA 1YT5A 4IOMA 5E1DA 3BIJA 3BGVA 2E5LO 4GKAA 4BT2A 2WYWA 4XEHA 2WSBA 2XUZA 2G0NA 3IEXA 1HMPA 1XBLA 5AI4A 1KAGA 1H22A 1PV4A 2VGMA 4O2AF 4WX2B 3AI3A 4MRMA 4PZ0A 3UFXB 3LQ2A 2GXSA 4ONEA 2VNSA 2LD4A 3UCXA 2OK8A 1CDOA 2I22A 4F6CA 1GLGA 2ZVZA 1B23P 4CTOA 5HUQA 4MDEA 2H1OA 5ALNA 3HKEA 1EFUA 3CZPA 3ONWA 4EY8A 1L5WA 3QMPA 1YJNV 3CC2V 2QA4V 3HL4A 4QJ5A 3TZKA 5J2TF 1WN7A 1SVUA 4ZT5A 3BXFA 1KY5A 2CVLA 3RWOA 1QYVA 2H00A 3MCTA 3WOHA 4C5AA 4KKXB 1EIWA 5IYCO 1GQOA 2CXNA 1M6VB 4X6LA 1CX9B 3ZGVA 3ANNA 5EUBA 1KDZA 4ZARA 1IN1A 3BE5A 3ICOA 4G5FA 1BDBA 5CK5A 3CJHA 5JY1A 2PH7A 1T26A 1JIIA 4LXXA 3WMGA 3KSDO 3FA2A 3STLC 3PTAA 5HZHA 2V9PA 4W4LA 1D2DA 3AR5A 1ZIOA 1QYRA 4PZLA 4V24A 1KC1A 4RA6B 3JRWA 1KEKA 1Y9EA 2ZJ4A 3M7MX 1NW5A 3A2KA 4WLOA 4XLTA 3FETA 2WE7A 2A3NA 3W8DA 3LO8A 5SYMA 4MO9A 1V2GA 5K8UA 2C0CA 5D7NA 2XB8A 1WPGA 2P4VA 3K09A 4DZZA 2VBIA 4YONB 4YMGA 4CMIA 4FN4A 5E7MA 4QQRA 1QWOA 1QJ4A 3NTRA 3ZCXA 4RE5A 5JCXA 1OXUA 2L2QA 2J09A 2F2TA 1K5GA 5DGCA 2NT3A 3CM0A 4DVGA 1TM5E 3X43A 1BQ0A 4W5JA 3H84A 5G1NA 4KQWA 1KMCA 3R3JA 2R79A 1QFXA 1X1EA 5IAOA 2HPAA 4OHCA 1WXFA 4KL8S 4MI9A 1CUWA 3HI6A 1VQ8F 2QTNA 1L5GB 5JD5A 3R0ZA 1ZC4A 3UGTA 2WSSG 4TYNA 1PQUA 2J45A 3KZMA 4IDHA 5H02A 3DLPX 5SY9A 5CCBA 1W36B 1ISFA 1KOJA 3ZWWA 2KSDA 3HXKA 3IVRA 5KTKA 3T06B 4LZPA 3TD6A 1A7KA 2AW5A 4GSYA 1BYUA 4DEVA 2PX6A 5KSPA 5CLHA 4ZYZA 1GCOA 1F0PA 3QUCA 1URFA 4ICIA 3O31A 1FX0B 3IAS6 2D4HA 5HZGA 3S70A 1IPHA 4MTLA 1U2DA 2CK3G 3G2KA 5LKAA 2HF2A 1CD5A 3I9NA 721PA 4R8SA 2ZVDA 4RSRA 4O02B 4RADA 2JFNA 4P93A 1M67A 3FOEC 3NIBA 1YJ9V 5J5VA 4B3TO 3I6MA 2R62A 3DTVB 3VSAA 1P5ZB 4FXOA 3RBAA 3HB0A 1SU4A 1ECJA 4L57A 1Z29A 2B69A 2DTXA 2O4CA 2QD5A 4F6RA 1D4OA 2ECQA 5JNUA 2FFAA 3DONA 1EFKA 5B30A 1NJ5A 1F7VA 3R3HA 2Z6VA 5AKZA 4AG6A 1P91A 3LT5A 1XTJA 1RZ3A 3EQ6A 4H9GA 3PIDA 4YNBA 3G0OA 3R5SA 3WLNA 1AMNA 1ZI6A 2G9UA 4C4PA 5HMMA 4GW3A 2QL9A 5EE5B 2GTPA 2IW1A 3PUWA 1QVVA 5I5EA 2R6AA 3TOCA 1VIMA 1K27A 1JTEA 3TK1A 1PYOA 1VQKV 4UU7A 4EW2A 2ASEA 4BB5A 1Q7TA 3HHEA 4ARZA 2GBPA 3Q8XB 1Z63A 3IQDB 4C03A 1DMSA 4MV3A 3C9UA 2WF6A 4D0RA 1GG9A 1NTRA 1YS6A 2C97A 3U7IA 4W5QA 1RAEA 3T3NA 3M4SA 5DN6G 4TXMA 4FHEA 4ZGGA 4J11A 1OF1A 1T5SA 3DE6X 3EPJA 2LV8A 2NQTA 4Q6WA 1W42A 3VYTC 4DANA 2EJ7A 3RYCB 2C1XA 3X2EA 3OJOA 2H4HA 4EECA 3W5CA 4OUDA 5BQ3A 1ZD9A 4U3JA 4UDNA 1YH3A 1QORA 2FE4A 1QOPB 3CG4A 2D0OB 3IR7A 5EXEA 1ENZA 4IS2A 4G41A 4C7OA 1B1CA 4JIGA 3K9SA 3INYA 2OP0A 3TIVA 3A32A 4MAFA 5BWLA 4GLJA 1BDJA 2R7KA 3A14A 4ERXA 1Y3IA 4PYRA 1H2RS 1O89A 1TO2E 4MPTA 3K0AA 3ESXA 2OCIA 2VP2A 5HKAA 1RRCA 2CMHA 1Q74A 2YC2C 1W1IA 1RQGA 4F56A 2R1TA 4FBLA 1E3WB 3Q8KA 3KYJB 3REQB 2PWZA 3KSUA 2GBGA 2YZNA 4A8JB 2QL7A 2Y4OA 2ZRAA 4KN6A 4Z8YA 4CCSA 3FZNA 2JLWA 4DKXA 4UBOA 1JQ5A 2VNJA 5TS3A 4EPRA 5IVPA 3SC6A 2VVTA 2CUTA 1ZWZA 3CONA 1G1AA 1L5FA 2HV8A 5K0NA 2QPAA 1AKMA 4L28A 5LQSA 4KL1A 3FR8A 4YVFA 5T4EA 1Y42X 2XNSA 2H1VA 4LC9A 1PFWA 1CVLA 1J22A 3FLMA 1XZIA 1Q81W 3T99A 2YQ4A 1BU8A 3UWOA 1YDEA 4OPMA 2NQ2C 1CY2A 1ZD4A 2C9ZA 1WIWA 5G3ZA 5A3QA 5EI5A 4GBJA 5AM5A 4GPZA 1PD0A 1VG0B 3FKJA 2KW5A 1HR0B 3H01A 2BZ1A 3BMXA 4QDXA 3F1LA 3RSGA 3VPGA 4F5EA 1XDUA 2PMWB 5F73A 2YIVX 1Y1LA 3WFZA 4TVBA 3KR0A 5KHAA 1YA8A 2BKAA 1NBMD 2PIAA 3UUFA 1WPQA 3H1BA 3GLQA 3FWZA 2D1QA 3VQXA 4K9NA 3WE7A 2YJGA 4WFEA 1LI7A 2H31A 4UHCA 1N6KA 5GV8A 3G8CA 2YIAA 5IKEA 4OBXA 5B64A 5JNLA 2EW2A 3C41J 4QUBA 4MS1B 4BASA 2GJKA 5ES4B 4RDCA 3GJ0A 2Q3EA 5CX1A 2IYXA 1I94B 4WV3A 2OHOA 1ODKA 2OL4A 3OOWA 4LJAA 4YRIA 4EG6A 1VGVA 3HO1A 2EJRA 3AFIA 1ES9A 4H0CA 4OXXA 2VYND 3C3KA 5B7PA 2BTQA 3LHKA 3EWNA 2FFJA 1IBMO 2HK7A 1ENYA 1Y8QB 4YAFA 3Q7IA 3DH0A 1T4CA 2ZUBA 2NVUB 1QHIA 1XKLA 3V46A 2CXPA 3T7KA 2H5LA 1X86B 3GPCA 1NUHA 4QFCA 1C30A 2ZUSA 5J2UF 1NNUA 4QEKA 1GRRA 3QSGA 1XR3A 1NP6A 2QYHA 4BQRA 1RI4A 3SMVA 2FJPA 4DIUA 3MCQA 2PUSA 1T29A 5EY5B 2EL9A 2CNNA 4MWTA 1GEEA 2VHTA 1P6UA 3ND7A 1IXRC 4RHXA 3T3GA 3D36C 3U5ZB 1NBIA 4QYIB 4KZPA 4X20A 2GPBA 4D0SA 3EGIA 4E13A 5AXBA 4IZIA 4JSYA 1FE8A 3S2FA 2OPHA 3D3KA 3KHKA 3PGKA 3AUUA 4PI0A 4BMYA 2V1XA 1ZNYA 2BD0A 4YXWG 4GL4A 4DR1B 1MV5A 3LKVA 1H2MA 4C30A 4R5MA 4QUAA 5EFZA 2MSWA 3R7NA 5DI9A 1DAMA 3ND5A 3USZA 1JLLA 1K75A 3R3ZA 1BE0A 3IQFA 2V6MA 4BPRA 3DE1X 3N0WA 3RT1A 4G26A 1G6KA 4TVOA 2DQZA 2YOHA 2WPDG 2LQTA 2XAQA 4FJ0A 2XWJI 4G8DA 1YHYA 2B37A 2K2QB 1ABBA 3E7DA 3WXMB 5MF6A 3FB1A 2O2EA 2QL6A 5GONB 3GD7A 2JJ2A 3G4SV 5DRYA 1CUIA 1U2GC 2V0GA 1BE1A 3ZMZA 3QKWA 2ZBPA 1T0PA 3OIUA 2ZRDA 1LQ2A 2KB0A 3LK6A 4AURA 4FT4A 2AK2A 5HM8A 2NR5A 1TEVA 5AUNB 5C46F 2Y4TA 1KA9H 1R0CA 3HJCA 5LR6A 4E2WA 4L2IA 3UXEA 3RS7A 1QYDA 4B7XA 2FSFA 3IKMB 1UDAA 4N8DA 2W83A 3B8EA 4KNYA 4FW9A 2VWQA 4HLQB 3ZTTA 4D02A 4R1TA 4B3FX 2QLLA 2AK3A 3PYLA 4N5DA 1Z6YA 1QR2A 2JEXA 3W7AA 4KO3S 4PC6A 4QGFA 2IYFA 4XPIB 4URWR 2O20A 3OF2A 3SVZA 4WASA 1DOZA 3IAEA 4JXJA 5FOQA 2RHWA 4QATA 1QP0A 4P4UA 1E3LA 1M2VB 2YYSA 5B57C 3AG6A 2ZDIC 3R24A 1E2NA 4ZXFA 1L6IA 3E8SA 2BKLA 3WGGA 5EIAA 1JEAA 5FUWA 4N39A 4CL3A 4MQBA 3R5TA 4YI3A 1SA0A 4N8EA 4PG8A 2VYFA 4FOOA 2Q69A 4OKIA 4EEZA 3HNRA 3LUCA 1WKBA 2FPXA 2R2GA 2VPZA 5FBHA 2Z0MA 1ZUNB 3I5UA 3HKDB 3UFXA 1G5PA 1SRYA 2Z57A 2XGGA 1YXBA 1V8DA 2HX1A 4IXDA 3KDSE 1G38A 4X24A 5EN4A 1OCCB 1EA7A 4B6EA 1RRVA 1FK8A 1PWXA 4EKGA 4I8DA 3GJXC 4OHZA 4X7PA 4KR0A 3KBOA 1DJMA 2IBSA 4OJQA 2PRYA 3FTPA 4YQEA 5IDXA 3HWUA 1PNOA 1YJWF 4B0OA 1ECFA 4DRXB 1HMYA 1XTZA 4H33A 2QM4A 1S8FA 1XPUA 4L95C 4MWCA 3UEOA 4TTSA 4MQFA 3I2YX 2VSYA 2W00A 3DXXA 3OT1B 2KLBA 5B3JC 2JJ1A 4A27A 4PO1A 4EFNA 2GHRA 1MB4A 5HP7A 3VR4H 1T5LA 3FBWA 3D01A 2ZQZA 4HZUA 4NYMR 1YCGA 1ENVA 1PUJA 2CDBA 3RTCA 4PW0A 3NBFA 3M84A 3PC3A 4BX2A 3K70C 3A3YA 4F1JA 1E94E 5MN6A 1H6BA 1P5HA 1I7SB 1W8DA 2CHGA 3B51X 4DDUA 4FZ1A 1NE2A 3KVOA 4QQKA 3I5YA 3IKFA 3QXJA 3THXA 3FFQA 3KHUA 3ZHXA 3VKVA 1QE3A 5JASA 4ZU6X 3U7QA 1KYZA 2XB6A 4NBUA 3EVBA 4JK3A 2A2ZA 1RQXA 1U0HC 5FI1B 5LBQA 3V2HA 3FDZA 4DGSA 1CIJA 2DWPA 1NBEA 2DYRB 5CITA 4X6UA 3I56V 4JOBA 5CVJA 2AGVA 2W98A 3ZGXA 1WULS 2J59A 2OXEA 2BP7B 1YZQA 8AT1A 1JD1A 3PWKA 2R66A 1NAHA 3ZW7A 3BK2A 3SQNA 4DA6A 3CJTA 3WLQA 2ZM6O 1ISGA 5B1BC 5HEKA 2I7TA 3QBDA 3LT0A 4JI7B 5ALGA 1UMBA 3CFYA 1PCXA 4LWOA 3ZJZA 3ZLJA 3VH4A 5EMLA 2H8PC 4B5CA 2DBVO 3AYXB 3VI4B 4DSOA 2YUTA 1AQ6A 2QTFA 4DMRA 3UMYA 1EB8A 4PEVA 3GH3A 3ZY6A 5HXAA 5FUQA 2QGFA 5HY0A 4BZZA 6CHYA 3LLVA 1YHQV 4Z1MG 3P96A 5HQ3B 4GM0A 1N3IA 4HMPA 4AJJA 5IBRA 2BHLA 2NZ2A 3TEJA 3JZAA 4RLQA 1N1DA 1YB5A 1FYVA 3CS5A 1XZKA 1ZINA 1D2HA 1PJTA 3L77A 5CXSA 1QG4A 5CFZA 4LFCB 2JKZA 5F5XA 3IUMA 4ARUA 1XE3A 4W4KA 1Q44A 2ZWVA 2R6JA 4PSUA 1F2TA 3WB1A 3RG2A 1LI4A 4C0AC 2IXBA 1Q6IA 1P1RA 1AQYA 1VBMA 1QLEC 1L5OA 1Y9ZA 2W2KA 2AIZP 3M99B 1DCKA 3VPBA 2VDPB 2V5AA 3ES9A 4RJJA 3W5HA 2P62A 1MOFA 3ZH2A 1CHDA 4HAIA 2O0HA 1QMPA 2ZIXA 2QS9A 4AU1A 1YK0A 2F90A 4NKGB 3DMYA 3BMOA 3H3FA 1RMYA 3B2EA 4O08A 2Q4BA 2RB9A 5DP1A 2XBMA 1NI4B 1U7PA 4GT1A 1US6A 4JWKA 2H2AA 4M0UA 2JGKA 4ZZ0A 4F72A 5BNZA 1ISHA 3D4OA 2PZJA 4BQQA 5K6AA 1JX6A 1M8KA 1G64A 1PT5A 1AR4A 1K5DA 1E60A 1V8PA 1EP3B 421PA 2WG1A 3KKOA 4JKOA 3RW0A 2PGNA 1S89A 2Z2YA 1UP6A 4ZDWA 1CR0A 4ZAVA 2PX4A 2MIIA 1DKRA 5CK4A 3K12A 2BEJA 2WZDA 3RT9A 4P6VF 1Y9DA 1J56A 1A4IA 3T38A 1OV9A 4NNJA 3B85A 2AJTA 3LRPA 3AETB 2W8BA 3AU8A 3RGBA 2ISSD 4OKSA 2J5BA 1X77A 1N92A 4UXHA 1T3ZA 4UFZA 2ZF8A 1Q11A 1QZTA 3MT7A 3TRJA 2I4IA 5D8DA 2SNIE 3H8WA 1FW8A 4FIDA 1PL4A 1SJ9A 1DRVA 1N1GA 2A5GA 1UPCA 3KDPA 1V55B 2JVIA 3RT7A 4C0BA 3N2NA 2XWPA 3ROMA 3KTDA 2XUDA 2JARA 4P32A 4DARA 1P9NA 2WF5A 5GIOC 2FMKA 3ZE0B 1FVFA 2BGJA 5AW6A 1Z06A 3EZ9A 1P5JA 3O4VA 4GZLA 4U4AA 4EG3A 3GCDA 1GPWB 3I9V1 4O2RA 2C2KA 4A8JA 1H2LA 1MC4A 4C78A 4I6GA 2ZIUB 1VYHA 1BHSA 4J1SA 1EK2A 4M0MA 4N9WA 3ZEAA 5L95A 3NWJA 4HQKA 1W5FA 1X7XA 4DUYB 3I01M 2RHRA 4QPPA 1CYDA 3T41A 3EMDA 4IIVA 3IS3A 3MDSA 5KAFZ 4Z9BA 2RG7A 1TECE 4RLFA 4JPRA 5IMSA 4ND7A 3HK2A 3O6VA 1OFUX 3W3AD 4X1YA 3LU1A 1N4CA 5JRJA 4J0EA 2BF4A 5JD6A 2G4LA 2O57A 1XCJA 3I8SA 5FD8A 3V3TA 4GDFA 2XNDG 3TLYA 4PAMA 4B09A 2O8FB 3MRXA 3UOWA 2JD0A 4ZKEA 1EFRD 1VMGA 4DMUB 2VOJA 2CLOB 2JH8A 2XW6A 4DQLA 1TOAA 2HKIA 3QELB 3DXRA 1L8QA 3QIVA 1KEPA 1WOMA 3NVMB 4ZV7A 3CE2A 2PKYX 3HH8A 4YP9A 1GL9B 2BMDA 3IO5A 4LWSB 4Q7EA 5F2KA 2UU9O 4TSFG 2YFYA 3IVCA 2NQ8A 3P27A 2ZSFA 1ZCJA 1ODSA 2DU8A 2UXCO 3WQQA 1OBOA 3CEPB 4EA8A 1Z8HA 1FQOA 4EI9A 1HDYA 4XFJA 2V7VA 3JQRA 1XNRB 3CEHA 4OHFA 4N7MA 2MYUA 4RH0A 4AY4A 1ICIA 1UPBA 2FWJA 4FVMA 3K2IA 3FAZA 5GGXA 3QLUA 2DHDA 4TLMB 5LGNA 4PIVA 1OJ7A 2RKOA 2E1RA 1MOSA 4CT4B 2Q5IA 2WP0A 3I6YA 4C8IA 5L3DA 4AWBA 3MMZA 1MC5A 2AZ0A 4G0MA 2PLFA 5GGYA 3GT0A 2XCOA 4KGZA 1GRCA 4F21A 1OWOA 2IAFA 3KKQA 3NETA 1R6KA 3HBMA 3VR3A 2W6MA 2J48A 4G63A 2A4KA 2FW8A 2P9CA 5IULC 1NQOA 1KAOA 3GGJA 1IBCA 1EQ2A 2ZAYA 2O2GA 2GOYA 4C7KA 3QVOA 3BJMA 3PHGA 4M22A 4J7XA 2B98A 1PTJC 1Y89A 2VQ6A 3T95A 4XWWA 1QDLB 1NSFA 5I45A 4Y9TA 4ZHYB 4IJWA 1R6AA 1GO1A 3QXXA 3L72H 1EVYA 1VE5A 4KR3A 4K1XA 3NKLA 4D44A 1XK6A 3QA9A 1CP9A 5KEIA 4J0JA 2FZKA 3THWB 5TRTA 3F0TA 3A9UA 1MQ9A 2IEYA 2GJAA 4PE5B 4R1UA 3WP0A 3PZRA 1IZ7A 2Y0DA 2OEPA 4WF9V 2F1MA 4L22A 5D3ZA 5DCVA 4YLEA 1RQLA 3DZHA 1KJYA 1L7MA 3M82A 4PFQA 1T6BY 1U9CA 3PCTA 3RABA 1VE6A 2XE4A 4HZ3A 1NKTA 4BVSA 2Z09A 2XKBA 5HUJA 2W0MA 1E3JA 4Z7OB 4CCWA 4AJPA 2YL2A 2CXUA 3Q98A 4GCZA 3B78A 4BJ1A 4BTLA 1W35A 4MVJD 4WINA 1AP5A 4DAEA 4NEGA 2XMGA 2Q7XA 4RPGA 3ZIDA 4MKFA 3P0FA 1SG6A 2IYVA 1ISIA 4Q3NA 2M6KA 3UH0A 1PJZA 4S1PA 2B99A 3VHXB 1LC3A 3LQYA 1IOVA 3K5LA 4EF5A 2P6UA 2H07A 4MVZA 4J0GA 2Z6QA 4CEHA 1MRSA 4WFKA 4WLEA 5C8YA 2WHQA 3SIPA 1UKZA 1A4UA 1YHNA 1HLDA 1M7HA 4K6GA 4B3RB 3FFMA 4IMJB 2QTPA 3AYZB 3W7UA 4EM6A 3TLXA 5BURA 3SBXA 3E18A 1ECLA 1W3EX 4KWEA 5IPFA 4RTJA 1FYDA 3GRPA 1EZZA 1XEFA 3UF0A 2LBTA 1AVMA 1VFNA 1RWKA 2E6UX 2C2AA 1PGOA 4DLLA 3CLSC 3BL8A 3WK6A 4NR1A 3D2CA 1H2NA 2WD8A 1KXZA 4FS3A 1QIIA 2H4WA 2W2OA 3WIUA 2EG9A 1J9GA 4QUIA 4WK2B 1BD3A 3IQWA 2XXAA 4EIWA 1ZUNA 8MHTA 2GK3A 2VCYA 1CXZB 4OP3A 3HKDA 3BHNA 4IQGA 5EQJB 2IUEA 1LUVA 4R7GA 5I7FA 5KHOC 5BVHA 2GR9A 2W43A 5CEEA 3SHWA 2BFWA 4JNCA 4ER5A 2F9MA 2CJWB 3P4UA 4N0MA 1SPBS 3MNFA 2ZM5A 3FSJX 1E66A 4Y0AA 4MUMA 1ADGA 3OO1A 5DM0A 4GBMA 1VA4A 3N8DA 3L4BA 3LFOA 2C99A 1H3EA 4JJ4A 3FGZA 4OH7A 3T52A 4TT3G 3HPLC 4DRXA 3NU1A 4RDIA 1DC5A 2WLHA 3TLMA 1MF7A 4IF4A 4HNUA 4Y9UA 4FE3A 1XCBA 1VM6A 2ZBEA 5AESA 3NTVA 2CXSA 1WBDA 5FLXN 1XVTA 3B3QA 4LOHA 3SPIA 1YMVA 5I3CA 4P35A 1N6LA 1T5TA 4QOHA 3D6MA 3L7OA 4L7QA 1JFVA 1RQRA 3O3MB 3COPA 4HWKA 4UM8B 4OLHA 3KQYA 5JLJA 4TWJA 1F1JA 2GAAA 2O0KA 1U7UA 3WZLA 1NQXA 3KKLA 3GH1A 1WUKS 2FG7C 1KPGA 3QQ5A 3EGOA 5TISZ 2D4AA 1SGWA 5CDFE 1WSWA 3RTEA 2PZBA 3AP2A 2W2MA 2Y99A 2A7WA 2IHKA 1QHSA 5KAPA 3CRMA 1NVVQ 3RK4A 3EEOA 1YS1X 5JYDA 4DQXA 1YE3A 1SO8A 1P29A 3D2AA 4KIJA 1T0KB 4JBYA 4G8JA 4GOMD 4DRZA 2C9DA 3TXXA 2IS6A 4NF2A 5JJLA 3F0GA 3FD8A 1XRLA 1M8GA 4ZJUA 1A9QA 1N8KA 5AOCA 4DPLA 1JIKA 4OI0A 1KECA 2FWNA 3FWYA 3RVLA 3L74H 2NU7A 4ABMA 1LI5A 2FQWA 1J5XA 1ZLXA 3I42A 4KJXA 3AGKA 4PCLA 1R8YA 1TL7C 3CX4A 4R01A 1IUKA 3MS7A 4ZI5A 2O7QA 5K4HA 2NU8A 2A0KA 1AF4A 3CZAA 4J16C 1L3BA 3CF4G 1G4UR 2HNKA 4GPEA 4NYKA 4WGGA 4K6KA 4KO8A 3ESQA 1AKTA 1V3TA 3DPSA 4UM5A 1RA4A 2IUYA 4N9QA 3I62A 4RL6A 1FY2A 4BEJA 2P5YA 1UXOA 4RKEA 3P97A 2KHZA 1JRLA 3NFRA 3UM9A 1MB3A 5THXA 3NBUA 3OSZA 2PXXA 2GNAA 1CR6A 2FK8A 1LFDB 1WEKA 1PQPA 3DXFA 1HDRA 4AQ7A 4F91B 4EJSB 1ZSPA 2HCRA 1LPOA 3I76A 4UDYX 3P9XA 2J0QA 4NPAA 3P5SA 3NI2A 3UWSA 5EJ5A 2XGOA 3FLEA 1RYDA 4QU5A 5E7JA 2FKXA 5JV5A 2IG8A 3U3KA 4Z1OA 1SS3A 2P4HX 1VL1A 4BQPA 1L5NA 3ZIUA 2FPRA 4QYWA 1FPMA 5EJ9A 3O9ZA 3PBKA 2G5CA 3KT6A 1QAQA 1ONIA 3AVQA 3CVYA 3D6VA 1QH8B 3LQQA 4K9DA 3H5OA 3K2BA 2BTEA 2RCVA 4QDOA 1SERA 4HYEA 1Y4DE 4Q6GA 1P0FA 4C6HA 2P22C 1XGKA 4BKQA 1F38A 4GC5A 5HBRA 4TYYA 1TYDE 3L6OO 5DHPA 2XB4A 3IJEB 5T7BA 3H3JA 5DE3A 2HMSA 3MOSA 1USIA 3DVAB 3IULA 2QRQA 4K9QA 3OJEA 4DQVA 1VQOF 4NQZA 2E82A 3TR0A 4RQTA 4A15A 1VQMV 4MW0A 3CWQA 3L7CA 4EW3A 3SHTA 3CCLF 2J6CA 2CBXA 5IKPA 3M3HA 4KV9A 3K4QA 1F20A 4QJIA 5AQEA 1BS3A 3VR0A 1JR6A 2HF9A 3HVUA 2CW4A 5EIHA 4WKPA 1QAMA 2H1HA 3SQLA 3L41A 5E1MA 1R0BA 4DJJA 2UXDO 3MQFA 1HEIA 3P1JA 3IUJA 1UKVY 5KVQA 3FYDA 4N4AA 4UC0A 1T9ZA 4FYVA 4KLZA 2P2GA 5EC2C 5HFLA 5ABPA 3AETA 1FFSA 1Z6QA 3OURA 2ZYAA 5AM4A 2QNBA 3WBKA 1KYQA 3PEWA 5AW9A 5CIWA 1QH1B 4EB8A 6LDHA 3DF9A 3FPKA 4MUXA 3PFIA 4PA9A 3E9MA 3AB7A 1KAMA 4HAYA 5AI8A 3VU3A 2GARA 2J9XB 2V9ZA 3F0EA 4PR0A 3PNPA 4PRKA 2ODPA 3WR5A 2YHUA 4P80A 4PZDA 3KB1A 2XD9A 4P34A 2FPUA 3OE4A 4JI0O 1M6HA 3OTHA 3T61A 3KKEA 5FQNA 3AH8A 3CXUA 3A1FA 2G1PA 1Z75A 2B8EA 1DGSA 3IQXA 4GX1A 4AKGA 4MSUA 2HXGA 3UJ6A 5T3UA 1I3CA 4ALKA 4IIXA 2C8KA 1OYWA 3SKVA 3ZX5A 1UJ5A 4XQEA 3H5RA 3ZZUA 4MSWC 1GO2A 5BR8B 3LRTA 3GG2A 2AG0A 3CMMA 3QE3A 1FDIA 1L7VC 3W9BA 4DUZB 1C3LA 4LZZA 3UGQA 2XZOA 2I4MA 3KG2A 1REQB 1XU7A 4RQFA 4EEQA 2D2CB 4YDQA 1NY5A 1Q7RA 2WLKA 1YB6A 3O93A 1DEKA 1MRNA 3THRA 2ZDHA 4JJKA 3EFOB 4CIAA 1TJPB 4YRPA 3A2FA 3E86A 2O8FA 4RSHA 4FSDA 1RVDA 1MOQA 3ROTA 1E9CA 4G89A 5AI0A 2EBFX 4M1YA 4ZVQA 5HKKA 1E62A 3IIIA 4GP7A 2YHBA 4RH1A 3LWNA 4B71A 4FFSA 4V1CB 1Q82W 1J09A 3R09A 3TBHA 3OFVA 4KQ6A 5CLFA 1P44A 3AWIA 3KLBA 2FI1A 1DKQA 3QELA 4JMPA 1IPFA 4BPBA 1VQ5V 4KR6A 2FRDA 4OHUA 1CQJB 5E0KB 3L49A 3LT2A 5HIJA 4QDZA 3L82B 3V2UA 5FO0A 2AVNA 1AKEA 3SF8A 4LF7O 5JVDF 2RK4A 5GANK 3LPAA 3K9BA 3NV7A 2ZIOA 3IQHX 4EHDA 3DWFA 2A9OA 1LPBB 3RANA 3M1AA 4DE5A 1Q1GA 3IERA 1T8YA 2WR8A 4ZVSA 2IHNA 3CRCA 1SBNE 1CSEE 1FXHA 1T6XA 4YCNA 2OV8A 2B5OA 3LC7O 5JPIA 3UB2A 4OB8A 3E9NA 1XJQA 2Q6LA 4PA4A 2C96A 4DLUA 1GNLA 1NF3A 3FYUC 4MW2A 4OQQA 1IY8A 1ODLA 3A6LA 3A0BZ 4IDNA 4BATA 3TLEA 1EDBA 5AVMA 2DHEA 1S5LZ 1YZUA 1GL6A 2NUAB 2HA0A 2VPWA 1SHLA 4MIOA 3PAFA 4H7HA 3L02A 2QRVA 3ESCA 2HEPA 5A9GA 4CEIB 2GCOB 3DOOA 1W73A 2XAAA 3I92A 4FD2A 2HX0A 1KYTA 2IUTA 5IDJA 3S1SA 4OB7A 1WJZA 3TOXA 4ZYTA 3ZY5A 1KQOA 4HDRA 4PFSA 5U4QA 1X0VA 3K2QA 2WMNB 1SF9A 1O58A 2C5BA 3UMSA 3D6AA 3Q1LA 1JY8A 2QZ4A 5A7HA 1DL5A 2A3RA 3VYUC 4MA4A 2XSZA 2JJ2D 4V39A 2X8JB 2DF8A 3SSAA 3JQ7B 5AKLA 2KJQA 1SEVA 1R3JC 3HRHA 1U2ZA 3VKGA 4N5LA 1ZK2A 1JQJC 2DHCA 4MVYA 4DM3A 3F5FA 3TN7A 4MYUA 1JEQB 2QAJA 1GLNA 2OZLA 4OD0A 1F4MA 3T80A 4CXMA 3SPJA 3N8IA 2QWRB 1L3IA 5LP6F 2PD3A 4GR4A 4RKFA 1AY0A 2A1IA 2Q3LA 1T3TA 1C8BA 2W22A 4KH1A 4ZKIA 2OZVA 2PXHA 2LFRA 2O5RA 2RHGB 2WT9A 1F2UB 3BC1A 5C8XA 3PF8A 4FYPA 4X8AA 2XYPA 4DQKA 2JFHA 1JKJB 4BMPB 5FV4A 2FEAA 4NBRA 3S5JA 3SZRA 4XE5A 1ZUIA 1NLZA 1G63A 2EWVA 3NHJA 5LB4A 2ZE6A 3ZE9A 3OM0A 1AH2A 3RVJA 1Z7WA 2YTZA 2Q5ZA 4EJ0A 3EYWA 5H4HA 5IYZB 3IXLA 3HXQA 1A8PA 3ESBA 1BH2A 1C41A 5E2AA 1M56C 1JDUA 3BSFA 4CLEA 1T24A 4HXYA 2V6JA 4HGPA 1B6TA 3HXOA 5EK0A 4NP6A 5FF9A 3Q5GA 4F8YA 1N0NA 4TZKA 2R6CA 3FPLA 1VIBA 2IHYA 2GN8A 2W71A 2QZSA 3KKNA 3F71A 5CW2A 1PLLA 3IOYA 2FN7A 2FPPB 2JCYA 1CJMA 3ABZA 3BFRA 5JH7B 5LMNB 1RCUA 3LBYA 3EWSA 4A8HA 1OSNA 4S1NA 4NOJA 5IVKA 2BONA 3BGDA 5DV9A 4LDNA 2RJNA 3IOEA 3GVCA 3O2SB 4O4IF 2Q99A 3ECAA 1FX1A 2EBUA 3ZGNA 3I2KA 1NVGA 4F3NA 2EKLA 3BDAA 4L27A 4BVQA 2O50A 4CDRA 3WL4A 1AA9A 2QRJA 4KV7A 4WFAV 1MG1A 1LPSA 2G09A 3WFIA 2HMVA 3NHRA 1EK5A 2ZR2A 4HFNA 4DV7O 4ECAA 5H1YA 1ZM3A 2PL3A 3U9TA 4L08A 3HHPA 1TRKA 1JECA 3ED5A 3T94A 1FNKA 2PLNA 2XF8A 3GAZA 1K3FA 4B4WA 4P3NA 1UCFA 1RABA 4FFVA 3CU5A 1OCEA 2PMKA 2ZRQA 2MR6A 1ID8A 4D5GA 4Q21A 3C97A 1VSTA 4HLUC 2I1LA 3CP1A 2HJRA 1PT8A 1O97D 3JCZA 2JJ1D 5MFPA 3WNZA 4MDYA 3EISA 1P4RA 1N0HA 1ZW1A 4RTMA 2WA4A 3WTCA 5BSTA 3BCSA 2XHBA 3PX3A 4GWGA 4B80A 4HEA1 3ZGLA 2YUIA 5DIZA 2Z9DA 1VDMA 1WQ1R 2BMJA 4E4YA 1G3IA 3E3MA 1H48A 4CNBA 5LXTF 4UMDA 3GOQA 2X2FA 2XWBF 4G1UC 4BY9E 4RMIA 5AUQA 2WJ3A 1LCIA 4CMHA 1GD1O 4HVTA 2XDQB 1RLOA 1QQTA 1U43A 1EVJA 1ZAKA 5BORA 2BI7A 1XMQO 4AN4A 2DQYA 4MJLA 4L9SA 4FR0A 4R3NA 1BHJA 3HEBA 1AG9A 4CBCA 3RYFB 1O6CA 2PY6A 1M93A 2VHJA 1L1RA 4HQFA 5ARBA 1J9EA 2I1WA 2VDQB 2ZAGA 3UAGA 1MNGA 2VDRB 3THYB 4RK0A 3JYPA 1ADCA 2X8WA 4OX9B 2XGSA 1S3SA 3I0NA 5CYPA 1IY9A 1ULBA 2GCIA 4OLJA 1D0VA 3NHPA 3TTUA 3O8RA 3TGLA 1HNWB 3RTAA 3PUJA 1U9JA 4KPGA 3FJOA 3NOOA 2IJIA 1II8A 2ZJYA 5IXSA 3CPQA 3MTDA 5LJIA 2CXQA 2YXZA 1JJ2U 3R8XA 4F85A 2I62A 4M4SA 5FTKA 1NT4A 1MAVA 3KOUA 1SCDA 1Q0PA 5FPTA 1BJKA 3HEMA 1KDOA 3KYCB 2Y93A 2IBZH 4JAAA 4ON9A 3OQPA 4GZ5A 4R9RA 1N2EA 3T5AA 3ABRB 1L4NA 1S2LA 4MS3B 1J0EA 2JJYA 3HB7A 4K2AA 3ZD8A 4D6XA 2JGAA 3EQ2A 1NDHA 4P53A 1QZ3A 2ON6A 4G86A 3SR2C 3NDBB 4OQDA 1GK9A 3E8MA 1ZJ5A 3U48A 1KJNA 1Z2NX 2WLTA 3H2BA 5EJEA 5C1BA 3SOPA 4EJSA 1JA1A 4QU8A 4XWKA 2XDAA 2JLZA 2JK5C 3CLUD 4PC7A 4HXFB 4GMXA 2EIXA 1KI1A 1OXSC 1AC5A 2QTWB 5FEMA 3ZBQA 1PSDA 2H57A 1SIBE 4C4OA 2FB5A 3B6NA 4E6PA 1Z07A 3QUSA 4YMIA 3KLMX 5IF3A 3SM9A 4IIJA 5IABA 1KI8A 2HS4A 4DWVA 3D8SA 4WKCA 1E1RD 1ZMTA 4KK4A 1GVHA 3R5FA 3TQOA 4GSKA 3ZBTA 1Z26A 4G1CA 3PFCA 1R9JA 3I4LA 1G0OA 3I55V 2RGEA 1OPRA 3NYQA 4FLUA 5FBZA 1LW6E 3ASZA 3I73A 3QUTA 3PD0A 2C3PA 1KP2A 3UGKA 3EQ7A 3J81A 4TLEA 1CY1A 4HN4B 3W05A 2DWEC 2F1JA 5KYYB 4IJVA 5F21A 3I39X 4RLHA 2NPFA 4A1FA 4GX0A 2FRVA 2Q29A 4R8RA 3WPWA 4BYMA 4INPA 5FLXM 4CDMA 1T6NA 2QDOA 1X52A 1NP7A 2ZRHA 5TQJA 1EP2B 1RDFA 3ELDA 4PWZA 2IF2A 1EDEA 1APBA 1DRJA 2C29D 4JI4O 1TAEA 2HQ1A 2LPMA 1CUSA 4F9FA 3EZ2A 4MS2A 3A06A 3BDVA 2YIMA 2AFHB 5K4AA 5AUOB 2ALEA 3MG9A 1MMMA 2Z3WA 1YIOA 4TWBA 4DEYA 2XJ4A 1MEEA 3H9UA 4BNZA 4JAVC 3SC4A 5H83A 3S8MA 1OCOC 1GZDA 2Q1TA 2H92A 4IG4A 3VGPA 3RVZA 3JQBC 2JIOA 1A32A 1ZVKA 3TQRA 3GUYA 3T7JA 4FX2A 4RUEA 1Q17A 4LNHA 1E9AA 4XJVA 4KIWA 1P9LA 5EJ8A 1NM5A 5DF1A 4KKVA 4EGAA 2KMLA 3D5EA 4D3ZA 3FMIA 5TMDA 4LA4A 2Q67A 5FL7A 4TKZA 1V3VA 2IYZA 1MA1A 2QE7A 2W6IG 1FIUA 2C2YA 5DM60 3IFXA 3JWIA 4Y0VA 3GP3A 2Y27A 3MMNA 1WRBA 4LOIA 1T4GA 1AR5A 2Q8PA 5G0SA 3E2EA 1B2RA 7ABPA 4P36A 4LOJA 4PHZA 2HLDG 1YI1A 4MW8A 1Y1RA 4AJEA 4KX3A 4UAGA 2WHEA 1U3GA 1T2UA 3U0OA 1EVLA 4L4ZA 4RAQA 3GZ4A 4ZAFA 3R20A 4MCJA 1T0JB 4LV8B 1P9RA 1V4VA 1XPRA 2BSAA 2ZWMA 3TW0A 5J43A 1GZSA 2DTDA 3R76A 3I04A 4G4WA 3L0YA 4O4HF 1REQA 2W11A 4DABA 4JASB 1AN0A 2R70A 3UHAA 3FPGA 4M9QA 4G4SP 3CN7A 2IZ6A 1Y9AA 2O0LA 3EFOA 4PZZA 1M66A 3ME5A 1LLCA 4P92A 4HRYA 4P3XA 1LSSA 5HF5A 2A84A 4LAFA 2P9HA 3RNLA 2X9GA 2FX5A 4N48A 2PXCA 3ZK7A 3C5EA 3STVA 4CV1A 3E3NA 1KYVA 1Z5VA 2Q41A 4FHDA 5K3FB 2ZKLA 1FTYA 1X70A 1FOEB 1TLFA 4Y2XA 3ROXA 2OKCA 4C06A 3WHIA 3AB3A 4TV8F 5E6RB 4LFAO 3AHEA 3FOAA 5AJZA 1UKEA 2JI8A 1XSEA 4AROA 3EBLA 4TXLA 1ULUA 4G0NA 3H4VA 5EIWA 5IYBO 3U60B 3VV2A 1SCKA 1XNJA 1Z16A 3K96A 5AWFC 4KFMA 1VQNV 1IVYA 2GHQA 4WVLA 1ZI9A 2F1HA 4AUMA 1E1YA 4IH1A 1ORTA 1XQWA 4DCSA 1LQUA 3A36A 3UUGA 2GLZA 5KKNB 4L4RA 4JP2A 2XE8A 4M1SA 3DSQA 3MWGA 3KK0A 4I7ZB 2ERYA 2ADFA 3VR3D 3GLKA 1D6JA 2AR7A 4F11A 4NBVA 2HP3A 2GB4A 1PL8A 3MGAA 1RPZA 2V7GA 3F3YA 3A6JA 3OOSA 2Q5EA 2DUJA 2Q0QA 4HNVA 1SXIA 2V6BA 3FOFC 4EKNB 3E9ZA 5D00A 2KPOA 4UVHA 4B5KA 1N32B 4RDXA 1UEJA 2P9JA 5HIAA 2BLNA 4QPJC 2I2CA 1QKKA 1KMNA 3WQHA 2RI1A 1OLOA 3GBSA 1MABB 1IJFA 1K6EA 5TF0A 2A78A 4TL7A 1TFUA 4JROA 4UNPA 4W1PA 4NTYA 2E4AA 3ZW8A 3B5IA 3OJLA 1RM0A 2B30A 4AKIA 3UJCA 2MYPA 5F7ZA 4L87A 4C0QC 2J5XA 4HNHA 3MIZA 1VKNA 3LFUA 3FOBA 1UK9A 1KARA 3LYHA 3B1WA 1OR8A 1Y5NA 3FNGA 1RI2A 4UFPA 4WLVA 5EMJA 1B6QA 1W4ZA 3KE8A 3I3SR 1T6ZA 2I6UA 4HAWA 2JRLA 2I8AA 1R74A 4XPZA 3C2QA 4MWGA 2CV1A 3LYBA 3TRFA 4G4SO 1VQ7F 1M6VA 1EWTA 5AVJA 2PGXA 1Z7BA 1S77D 3EW7A 3Q0IA 5ELXA 3A0HZ 4O6VA 4C4TA 3QPCA 4CR8A 1QP7A 3T4UA 4PAWA 2QWPB 1KFEB 5L8VA 1ZH2A 1E32A 4I9QA 3WGOA 3DMTA 4RS4A 3KWLA 2CSXA 2WJ4A 4X84A 4HQNA 4JDPA 5JRZA 1SQFA 5GTHZ 2GSWA 1ZMXA 4RA6A 4G1EB 1JKJA 1ODTC 5LHIA 1Z18A 2BM8A 1EBOA 2A57A 1X87A 1I36A 3OLVA 2IT1A 1QTQA 1FTWA 3WO0A 1TTTA 4UUPA 4IYIA 3HJGA 2PTHA 3ADCA 1YFZA 1SKYE 2QX6A 1YJBA 4CKCB 2XF2A 4I46A