4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
3WGKA 5IJ9B 5CA0A 4DRXA 3M89A 3RB8A 4HNAB 4EI9A 1W5EA 4ZHQA 5EZYA 3RYIA 4O4LB 3RYHB 5IJ0B 1RQ7A 1Z5VA 3RYFB 3N2GA 4YJ2B 3ZBPA 5LXTA 5CA0B 2BTOA 4U39A 5MN4A 1W581 3E22B 4O4JA 4U3JB 3VO9A 4X20B 3N2KA 3N2GB 4YJ2A 4TV8A 3RYCB 4O4LA 5LOVA 1W5FA 4LNUA 5GONB 5JQGB 4DRXB 4O4IB 5IYZA 4YJ3A 1RLUA 5JVDB 2RHOA 2RHJA 3WGJA 1JFFB 3JARA 3VPAA 4O4HA 3UT5A 3ZBQA 2BTQB 4EB6A 4EI7A 4I55A 1Z5WA 5FNVA 3HKBA 4ZOLA 4I50B 3JATA 5LP6B 3HKDA 4I50A 5EIBC 3R4VA 4X1YA 5JCOA 5FNVB 5LA6A 4X1KA 5KMGA 1TUBA 4TV9B 1FFXA 4IIJA 2XKAA 5LYJB 3HKCA 2XKBA 1W5AA 1JFFA 1W59A 3WGMA 5LA6B 5JVDA 4IHJB 2R751 4O4IA 5IYZB 5GONA 3JASA 4FFBB 3JATB 2VAPA 5LOVB 5MN6A 5BMVA 2VAMA 4I55B 3JALB 4O2AB 5KX5A 2BTQA 4X20A 4EB6B 4XCQA 1OFUA 3E22A 2Q1XA 3V3TA 3VOBA 4X1IB 3VOAA 4EI8A 1TVKA 5LXTB 4F6RB 4LNUB 5LP6C 5IJ0A 4TV8B 4ZHQB 4I4TB 4HNAA 4ZI7A 4F6RA 3N2KB 4X1IA 3HKEA 2R6R1 4O4JB 4U3JA 5IJ9A 2RHHA 3HKEB 5EIBD 2VXYA 5KX5B 4ZI7B 1FSZA 3RYFA 1RQ2A 4I4TA 3RYHA 1SA0A 5ITZB 5J2TB 5EZYB 3RYIB 5CB4B 4KWEA 2RHLA 1TVKB 5JCOC 4IHJA 3C8LA 4TUYB 5CA1B 3ZIDA 5C8YB 1W5BA 3M8KA 5JH7B 3RYCA 3HKCB 4O2BB 1FFXB 4IIJB 1TUBB 3JAWA 3VO8A 3JALA 4O2AA 4X1KB 5KMGB 5BMVB 3JAKA 5EYPB 3WGLA 3CB2A 5J2UB 3HKDB 3JASB 4FFBA 5MN5A 5J2UA 5M7EA 4WBNA 4O4HB 5LYJA 3UT5B 3JARB 4TV9A 4WBNB 4B46A 5C8YA 3WGNA 4TUYA 5CA1A 4M8IA 4YJ3B 2GVIA 4X1YB 5JQGA 5LP6A 4ZOLB 5CB4A 3HKBB 3JAKB 1SA0B 5EYPA 5ITZA 5J2TA 4E6EA 3JAWB 4B45A 4O2BA 4DXDA 5JH7A 2Q1YA 2VAWA
chains in the Genus database with same CATH superfamily
4LSMA 2FJ0A 1N9ZA 1LFDB 2C97A 4OX9B 1P29A 1RAEA 4Q3KA 2NT4A 5DYTA 4QD3A 4DT1A 3H2ZA 5AVRA 4OA8A 3KC2A 3PNMA 4ASUG 3WIDA 2O57A 1A2BA 1YB6A 4XUGB 4GLFA 5ALRA 2NUTA 4HCJA 3PJFA 5JJCA 1CK4A 3T1VA 4ZYWA 5IKPA 4BNFA 1I3LA 4B7CA 4J76A 2DUUA 1HEUA 1LPBB 3DS8A 1GUDA 2C98A 3K79A 2QGFA 4HTFB 2QIOA 1RE0A 3ID6C 5GM1A 1PKEA 1PUXA 4C1NA 1BGXT 1M1NA 2AUMA 1SBIA 2WMDA 3OFSA 3WTBA 5BRNA 5TR9A 1K9VF 5K8LA 2D4HA 3QLVA 3BJMA 1YZTA 1BVYF 1K8YB 6Q21A 5K05A 2DPXA 4KAXA 1HQCA 4E3ZA 1R0YA 5JFGA 1EGQA 2L35A 4J1TA 3KSZO 1DG9A 2XMRA 2XVYA 4MS1A 4Q6BA 5JNRA 1GTOA 2H8EA 4TQDA 1PEDA 3I58A 4FC7A 4MCJA 1SUAA 1CRZA 5FV7A 4EYGA 1JIQA 2NLOA 2UXCB 3NV9A 2CL5A 4H35A 4JLOA 1YQDA 2EU8A 4TKMA 1TA8A 1XLTC 5HFAA 1A27A 2GDJA 4L28A 2C95A 3WSTA 1KERA 3AG2B 3VYUC 1E2UA 3HADA 2VVTA 4FW9A 3HLTA 3FMPB 2LVBA 4G36A 4CMEA 3S0WA 4I1PA 1EFKA 1XR3A 3THWA 1RNLA 1MHPA 2LFRA 1P2FA 4KYIB 4E5KA 1P7ZA 1TCAA 3FB1A 5IAKA 1N57A 1YOVB 5EO3A 5B4VA 1NTKH 3ZVRA 3L18A 4DM4A 3F5FA 1RDFA 1AZTA 3MWDB 4Q4AB 1JDZA 4FFOA 4MDHA 1XAIA 5G0SA 4BEJA 3AH8A 1YR7A 5HKKA 4B3RO 2W2LA 2EIJC 3IUJA 4IX9A 2PL9A 3IDQA 3K1TA 4XFDA 3BL8A 3ECSA 3I01M 4LJLA 4Q9JA 2XUOA 5DM70 2AK3A 3EDYA 3M6AA 3PV0A 4YAUA 3BZWA 3ZCCA 1KY2A 2AOTB 2XHEA 4JYPA 4ONEA 3S6JA 4MQFA 3OP4A 1KBHA 1PJ3A 1QWSA 4JP2A 2R68A 4Q5IA 5FEMA 3ZJYA 2Q8VA 3TQQA 5AI9A 5EHNA 4YB8A 1SIBE 1Y6ZA 2JGLA 3RAEC 4R9UC 3VSBA 4BV9A 4D9BA 2WYVA 5AM3A 4RS3A 3EZNA 3OMAB 3P97A 4KO1S 4YLGA 1ZGBA 3AOGA 6CHYA 1QIKA 1TO1E 5F9FA 4KSYA 1JY8A 3K7EA 5G4KB 2ZIFA 5HGJA 1P7YA 1W73A 3AFIA 2OOKA 3WHLA 2R97A 2IYRA 2MHCA 2GHYA 4A0QA 3KYDB 3QYFA 2P2NA 4DV5O 3KE8A 1F14A 2BBWA 2WFLA 4XTRA 2E1RA 1R5BA 2QAGB 4CM9D 3FB8C 4MMZB 2DXIA 2QJFA 1HG0A 2GD1O 1KC8H 3AQIA 3GLQA 4DQLA 1ADBA 2UVPB 3P10A 1RLOA 1U6KA 4AZTA 1KARA 1CS0A 5ECDA 3RJMA 4CMKA 4EHBA 4JNKA 5FWNA 1U9IA 2HCJB 2COEA 2YJTD 3E48A 3EMBA 3K0CA 1CS0B 4DCNA 4E32A 3KXPA 2Y69B 1P1BA 1L6RA 1VTKA 2QGNA 4X94A 4EATA 4P34A 3H9VA 1SETA 1U7WA 2PWPA 3QBTA 5I4KA 5J63A 1E7MA 2XZDA 2PX6A 1VF6C 1Y3DE 4OM8A 1FDWA 2P0YA 2J0EA 3GC6A 3T1NA 4FKZA 2Q1YA 3T7TA 4F97A 4HYTA 2PVCA 2D62A 4LAFA 1KORA 1R1MA 4AJJA 1IIRA 4C7VA 3HLKA 1VA5A 3OC6A 1RJFA 3KXIA 2E4WA 3IQDB 1ESZA 3H2BA 3KHTA 5D85A 3U1TA 1IPAA 4EGQA 4CH6A 2ASVA 2ZTMA 1FYXA 2FI1A 4RIHA 2O5CA 5AUNB 3J7AU 1MVOA 1ND6A 3AUUA 3HB4X 2V3CC 2O8BB 4KL1A 2DPGA 1Z62A 3GEDA 4V2IA 2QMHA 3RS2A 1Z0FA 2RC5A 3B5EA 3L46A 4GI3A 1YJXA 4CG0A 5B2FA 4BN5A 1U3TA 1IYZA 1NGSA 3OT1A 1DRWA 4MV7A 3I1YA 4ZAXA 3T3IA 2PKQP 4HD8A 1S77D 1JEAA 1C4WA 1HT3A 3IO5A 5E38A 2EILB 5TPZD 3V1LA 1LKZA 4BBJA 1WJZA 4X9XA 5KSZA 1Z47A 4UEOA 1R3LC 3LHIA 3L0CA 5LL6P 2ZXEA 4XJTA 5LDDC 3UUEA 4TTJA 4QJBA 2VJDA 4N6GA 2F48A 4L7QA 4HZIA 5FOWA 3NHZA 4BIUA 3COZA 3UOGA 2IZ5A 4G28B 4EL5A 4X8MA 4RQTA 3PTZA 3V34A 3TMAA 3OG9A 1SQ5A 2ZWOA 1ODIA 1FFXA 2BHSA 3KZXA 4U7WA 1MX5A 4PRLA 1RXWA 1HQKA 4RJIA 2MMGA 3MS4A 4GPTA 4KVFA 4ZQFA 3FFQA 4O4IA 4EMUA 2N04A 1XMQB 1ECGA 1LZKA 1O6CA 1Y6RA 3C5CA 5CBFA 1R50A 4Q7MB 3OFJA 5ESXA 3EIOA 4QU9A 5I9NA 2A2ZA 2HV8A 3O8OB 5CW2A 1KZ4A 4LF8B 2QMOA 4INJA 4B6FA 1NW5A 3UUFA 4TSRA 1AS2A 3OF3A 4M83A 3V7NA 1I5RA 1PN3A 2NAFA 5BSMA 3F6CA 4BL5A 5HP7A 1MD9A 4A03A 1LUWA 2XBUA 4XYGA 2R84A 4M49A 4TLMB 2C3PA 4F1WA 1OC4A 4MUAA 5L3CA 3MJ4A 4TQUS 5KPJA 2YV3A 3HJTA 5A4IS 1DDOA 1FF9A 1T34A 3O1JC 1GA4A 3AFOA 2D4AA 2E5FA 5BN5A 5FBVB 3B12A 3JV7A 4KRYA 2FW1A 2E6KA 3N8GA 4LE2A 1HDYA 3IE1A 3CSDA 1AF4A 5TS3A 5DKFA 1IZYA 1CUGA 3ZV3A 1CDOA 4QPJA 1Q3HA 2ZSHA 4GBJA 1D0SA 1WZEA 3CHXA 3E83A 4RE5A 1J8YF 3E03A 4YPFA 4KUMA 1OVGA 4K2HA 2J9RA 3PIDA 3UFBA 4BECA 1AHPA 1PNTA 3QE3A 2GBOA 2OCCC 1JHQA 4Q37A 1E5QA 4IIDA 1BRTA 1YE8A 1A2QA 5A02A 1CFZA 1FP1D 4X54A 2D59A 4JMPA 2G3YA 1IN5A 1HZZC 1U81A 3QVSA 4J03A 1MB2A 3LGAA 2D5BA 3GA7A 1SCUB 5CR9A 2V9YA 1EVIA 4PA3A 4JROA 1KP9A 5A5EA 4UCXA 5LLDA 3UJNA 3U1BA 4B3CA 4B3HA 3R3WA 5KTPA 2I55A 3B3AA 2HH9A 2O3SA 3OGCC 4M1YA 2YMQA 1GCUA 4G2TA 1TTQB 3BA6A 4GPIB 1ZBDA 5FPPA 3HHPA 4F92B 1VC2A 2KJQA 2Q6OA 4M0FA 2JRIA 2H1VA 4O1IA 2WFMA 5FPOA 2GEBA 3MLEA 3D3WA 4G97A 4DG9A 3AF6A 2X5JO 3VQVA 4X3PA 3FPKA 1MQ9A 4JT4A 4QPZA 1P45A 1LFAA 4B40A 4TWBA 5HUQA 2AIZP 5TISZ 3HYLA 1T3TA 4NZ9A 1ULBA 4HTFA 4O08A 5C7LO 1MTOA 4FFPA 3K0DA 1IB6A 1KI3A 2PL1A 2XB8A 3W7WA 4FZ5A 2K7FA 4MHTA 3ABLC 3R0QA 2WJHA 4K9DA 3RV4A 2IEAA 5K3AA 4LF7B 4QM6A 2PWBA 4J0DA 2PUJA 1LSJA 1FP4B 1E2EA 1Z0ZA 3QNMA 3R77A 4O4IF 4G2KA 4EUNA 1KMCA 1SBNE 1YQQA 1Z36A 1YQNA 1AG9A 3ABOB 3P0IA 4PGFA 2A7WA 2M6SA 5EKTA 3RVJA 1N6IA 1ZH6A 2FHPA 3FFTA 5CA0B 6GPBA 5JS7A 1J5XA 1UDWA 2NIPA 1G8GA 1NTOA 2FA9A 3SJ7A 3ZI7A 4AB1A 1G2PA 4BT5A 1DBVO 1JEQB 1AX9A 2QG6A 2R47A 4NK4A 2BMAA 1M6EX 4OQYA 2WNIA 1FFEA 4XVQA 4DA8A 3HA7A 3F90A 2ST1A 4KITB 5P8WA 5F3WB 4CVNA 2XV1A 1IY8A 1NJSA 2R1VB 3TFWA 4XIGS 2HJFC 3EA5A 1V4NA 3G02A 3HCPA 4NJMA 4EJSA 3SYRA 3U4IA 3RFCA 3TSWA 1TYDE 4RVNA 1POXA 1RRPA 3AT1A 3JTEA 1LR1A 2F93B 4BVAA 3ZMZA 1GRNA 1K4YA 1P80A 1RXVA 2E82A 1V43A 2HFEC 4KHPB 2A14A 3D2BA 3GARA 5AVKA 5AW0A 2IH5A 2EQ5A 4GXNA 3SHWA 3U7RA 4FFSA 1PQPA 3OQ1A 3D6MA 3ZHZA 5C1BA 5CD1A 2QN7A 1XEWX 3NUZA 1JDBC 4FFLA 1YJWF 1FFTB 3APOA 5KC8A 2QI9C 5FI5A 3ZMSA 2Y0PA 1T3SA 1XAGA 4OB6A 3FZNA 5DHAA 3JQ7A 5BQ5A 1QP4A 1XN1A 4QOIA 1Z28A 2JBWA 3C5HA 3T5TA 4ZI2A 4V3CA 1IN4A 1XROA 3D36A 5HTOA 1KH2A 1XMQO 1OJHA 2IGTA 4MVQA 1DELA 1COMA 4K87A 1ADJA 5C8ZA 5ALMA 4RQEA 2ONJA 1C9YA 4TYYA 1XDBA 2DJ5A 2Z30A 2Q2VA 1H9BA 2H2IA 2WK1A 2ZI3A 2EX0A 2IPXA 4FBGA 5JDCC 5FIUA 4FZ3A 3SLRA 4YCMA 1NVMB 4Q3DA 3PFNA 2OZEA 4Q20A 1WL8A 3PKIA 4IQ0A 4RVUA 1XEAA 3BE5A 3GAZA 1LLDA 4IHJF 5FLYA 4BKOA 3Q2IA 5BR1A 3SKVA 2JZNA 4LCJA 3WWPA 3DD1A 2XYHA 5IUKC 1O3YA 5DWVA 2IYUA 7MDHA 2EJBA 3KWLA 1YIJF 3CF4A 3C6BA 1UPUA 5CMLA 2XE4A 1JW9B 3M6VA 1KY3A 5FPRA 1FMCA 3K0TA 1D07A 1LC3A 1Z25A 4MULA 2QWXA 2YWRA 1GA1A 4WD3A 1AGYA 3EFOA 4IF4A 3KJJA 3B3FA 2C2WA 1OD6A 2GN4A 4M9QA 2VNAA 1Q1EA 1MC8A 3AJ9A 4C08A 1ORTA 3CX5F 1ND5A 1N25A 2V65A 3FYUB 2UZHA 1GYRA 1BHAA 1Z2CA 4MKRA 1SOUA 4YUAA 4BP9A 3QU9A 4YP9A 1ZU4A 3OZDA 3M4YA 4IOMA 1WCXA 1ZONA 4WESB 4KVAA 4PX5A 4RIGA 1VHLA 2VDVE 4X7RA 3RSLA 5LKAA 1YI2V 3CNLA 5HZGA 1YKSA 1U40A 2E48A 2EVWX 1SQXH 2QT0A 3LA8A 1U9JA 5KUMA 2CHSA 1XSEA 2YV2A 4P38A 2Z43A 4CMBA 1UXIA 3K35A 2PWAA 1LPPA 1EVLA 2WA2A 3F3MA 4EFKA 3OTQA 5E2AA 1T1SA 4K9PA 2NP6A 3BKXA 3PRHA 4IG4A 4LY6A 2XDQA 2VPWA 3NC0C 4OHYA 3SOPA 2Q7XA 1DZ3A 1U2ZA 1ZVJA 4BLQA 4NDNE 5HZMA 5JCZA 4J10A 4KUHA 4A8TA 1J25A 5L51A 4DRXA 4PTYA 1FBTA 5ARDA 4G1BA 2EW1A 2GZ1A 4M88A 3QBDA 4ZOCA 4HVLA 1ZGAA 2WPDG 1LLQA 1EUCB 1S7GA 2DVMA 2Y2UA 3C98A 3RYFB 3I76A 3TN7A 4EEXA 2BGLA 1Q20A 3NM6B 1H0SA 1H2HA 1C9JA 1W19A 1KKUA 4CR8A 4YP7A 3Q12A 4XOIA 3UMSA 4D5EA 4ZIBA 3QF7A 1UBFA 3DUWA 3WKBA 4QBKA 3GJXC 1I4LD 1G291 2BHTA 4R7TA 3TQSA 3VRHA 4IYJA 1OI2A 1UJ5A 4BO2A 2PD6A 3DQPA 2QRVB 3GP5A 5GONF 3CD6V 1K8XB 1TGOA 1XPJA 2HLPA 3WNDA 2WIJA 3FW1A 2NADA 3KJIA 1KO1A 5BWLA 2RB5A 3SJAA 4C2AA 1X7WB 1PJSA 2G9VA 3A4VA 3LDFA 2J3MA 4HC4A 3ZN2A 4DR6O 3P9NA 3QLTA 3Q4GA 4EUKA 3CNOA 4BNXA 2H5IA 4FGZA 2P06A 4OYHA 2HL6A 1QM5A 2O2EA 3RADC 4P0PB 5GIOE 3MILA 1JVSA 3NIGB 3A9UA 1J20A 4IVNA 3WB0A 1VCHA 3WY9A 1XVVA 1FZQA 2CE7A 1I4WA 2ZSKA 5LA6A 4MRVA 1T2NA 3CXUA 5INTA 1SKMA 1VL5A 1VPDA 1R6DA 4D3XA 2ADPA 1DX4A 2WQ6A 4Q1CA 1TU3A 1EHIA 4FJCC 3FRJA 3ZEDA 1YS6A 1S8AA 3DEKA 3ZJVA 1XVLA 2C84A 2B1GA 2QD1A 4UVHA 5KYKA 1SHLA 2ZW9A 4RH3A 5CYOA 1G5HA 2I71A 2YHIB 3QUSA 3R5KA 3JALB 4IXWA 3DE7X 1N2IA 1YOBA 4HUQB 1NZJA 2ZB2A 3MW8A 3U17A 2R6JA 4A2CA 4DAOA 2FX3A 4L5JA 4A2PA 3FNBA 4NY1A 1NIPA 3NGXA 4DCSA 1QLWA 2Q5CA 1YZHA 1A7KA 3D3KA 4QHYA 1NYLA 4PQEA 5KDOA 1SEPA 2W8BC 4JP3A 1RI3A 2G5GX 2OCIA 4AP6A 2O8DA 1UZAA 2OV2A 3M3HA 4BC1A 3B1ZA 5IARA 2Q0OC 4TQ9A 3TGPA 4G1CA 5LMNB 2GK4A 2IP4A 3PCXA 4HQ6A 2WDPA 1C7RA 4CLEA 2O59A 3IPCA 1NOJA 3HKEB 2HP3A 1SVOA 2H06A 4O0LA 2CZGA 2VDMB 1EZJA 4N8DA 1MW9X 2K1SA 2AN3A 4EABA 3MS2A 4EVRA 4C14A 1ZL8A 2WJYA 4HDNB 4C3VA 4DNQA 5A5DA 1PTJC 1R10A 2NYVA 3IXMA 2IAFA 4KYTA 3W06A 4O5OA 4TZKA 1IN8A 3EG9B 4XYLA 3BD6A 4ZP1A 4H3KB 2FHSA 1ZIPA 1DKUA 1CC1S 5JMTA 1BWRA 1K3UB 2H1FA 4DJEC 1K6IA 3CCVV 2UVPA 4WASA 3CZMA 3WRXA 1NYQA 4JF3A 4EHKA 5M7EA 1XP8A 2YOHA 4H15A 2FPGA 2ZUBA 2X1MA 3I2YX 4HN4B 1J07A 1WB8A 2NPIA 3ASUA 3T7EA 5LYJA 3T6KA 1B1AA 4A26A 5AJXA 3QY0A 4YRFA 5F9MA 3EXIB 4F2HA 4NNOA 1FS0G 2QYOA 3IV6A 1KO5A 1MIOA 4EFEA 2VPYA 1KJ9A 2PR7A 5AVOA 3FCSB 4KMSA 2QW8A 2YYAA 5KYWB 2W6IG 3H1IH 4FK8A 2Y0EA 1XXHB 5DGIA 4F3CA 2WYHA 2SKCA 1EG7A 5LMZA 4UM9B 3DL2A 4RVGA 4PA7A 1K4DC 4CTKA 3KKNA 1IWOA 3S55A 3ZIUA 3UF0A 2AOUA 3ESQA 2P6MA 4LP8A 1UFIA 3Q2OA 1R6XA 2H4WA 2AI1A 1T0UA 5C51B 3Q0TA 4L78A 2JJMA 1Q0TA 1KK2A 4LYAA 4HEJA 2XGSA 4ZC1A 1ZNZA 1GARA 1M0WA 4CLRB 1NBAA 2G9UA 5HMMA 3TD3A 1NN5A 1NW7A 2G9ZA 2VUUA 1W0JD 1HMPA 3OEWA 4JJFA 1QFJA 3LKDA 3QXJA 2PFGA 3AI1A 4QATA 3VTKA 4A0HA 1X13A 4B4WA 1YOVA 1AXEA 3ZV7A 2VDQB 3G8YA 3S1AB 1LPSA 4UCOA 1FUKA 3BEHA 1J0BA 2LW1A 4OP3A 5HW0A 1J8DA 1NAHA 1FOEB 3NORA 1KKMA 2GZSA 2XQJA 3Q72A 5DNCA 3KQHA 3CPJB 5JEDA 4XD7A 1UR5A 3CVUA 1J22A 3AETA 4HFMA 1WNFA 4OHVA 4RADA 3RO7A 3VVMA 1SPBS 3HSYA 3PJSK 4N8SA 3VGJA 2FPPB 4GKJO 5JAQA 3KU4A 1TUBA 4K6FA 2TMKA 4YONB 5TSDA 2ZJYA 1Z74A 3QKIA 1M6NA 4WX2B 1QRAA 4I9HA 5EUCA 5I7RA 4P92A 4Y6OA 2EW2A 3PYLA 3O2NA 1Q21A 3TW6A 1F3OA 1M57B 3F78A 4N5LA 5IZCC 1XFAA 2DPYA 4DR5O 2Q99A 2ZTSA 3E89A 3CKKA 1MO6A 3WI7A 4B71A 1NVUQ 3N0XA 4BKQA 1UBEA 4LNHA 2RGYA 2Q29A 3CVVA 1FTSA 1UJBA 1J0EA 3RJZA 1AI6A 3ZGVA 3FYHA 3AEKA 2BC9A 4L27A 1TOAA 3UHOA 5H9WA 4NCKA 5EIAA 1GX1A 3P96A 2J9YB 2Q0XA 1WUTA 2ZTVA 2IYZA 3N7AA 4I1IA 4KFRA 2ZT6A 3AM5A 1J42A 4PG5A 2H59A 1O4VA 3EEOA 3BABA 1QX4A 4GS5A 2XVXA 3QEMB 3H6GA 3ENWA 3OLQA 1ZA1A 4K46A 4BVKA 2AX3A 4UFZA 2FV8A 3KQWA 4XM1A 4ER0A 1HORA 4L4RA 4GKJB 3VHRA 4A8JC 3LY9A 3M8KA 3CLRD 1JDSA 3F6EX 3ASVA 1DRVA 4GYJA 1VKHA 4NP6A 5KMGB 3C9UA 2WIAA 1QHHA 4NCNA 1XMOB 4BMYA 5JZSA 1DWPA 1E7YA 1X39A 2A1TS 3KZ1E 1UBJS 3DKPA 4UASA 3HBJA 2XNCA 1R00A 1DMSA 2Q1SA 2Z3VA 4WBNA 2G7ZA 2IKSA 4L85A 5I45A 2Q9AA 3VU3A 1F8GA 1CSEE 5EI5A 2XYPA 3R9IA 1L8LA 4RHUA 1Q0HA 3V7QA 1E9EA 1NPTO 2KQUA 3H9GA 1L4BA 3BIXA 3D1LA 3Q2KA 2KPOA 2BGRA 2JS7A 3A4TA 4YMVA 2H92A 4EFBA 4N5HX 5H83A 3D4LA 1AUPA 4F4HA 4BPBA 5EYPA 4OHMA 1KJ8A 2V3VA 2HOQA 3C8MA 4NCAA 5IABA 5B57C 7REQB 2D2CB 3G2PA 3NKVA 3O8LA 2HBZA 2ORIA 3ISJA 2NO0A 5ED0A 1P8AA 2NU8B 3KFLA 2YMPA 4F2WA 2L17A 2VIIA 1U90A 2GFHA 3KUXA 3VNUA 3C43A 4RM3A 1N6RA 1S5HC 3U4GA 5DSXA 4CN8A 3L4KA 3VPCA 1KSJA 1YNSA 1DCFA 2JEXA 3WLSA 3AJDA 5HJEA 1F8FA 4TTTS 2J9GA 2BFWA 3IEWA 1COWG 1B8OA 1VYTA 2R70A 2BV3A 2TRSB 1VQ5F 2WHQA 2IYTA 4U7FA 4B5LA 4DMUB 5DOZA 3NWBA 4OHWA 3M6IA 3G9XA 3NYIA 5E0OA 5I7UA 4O4LA 1ORDA 5A7HA 5JDIA 1JJ2U 4JT2A 3O8QB 2NTVA 2RG1A 1PF5A 1MNGA 2IK8A 1ISGA 3ZWXA 4DA0A 1YJNF 2AEJA 4E5UA 3T95A 2X5KO 4AYTA 1OB2A 1NWHA 4CDGA 1JHPA 4ZIRB 3KQMA 3ZUGA 4EYOA 2QTVA 3ZCSA 3UJ7A 4B3TO 3KQPA 4MWTA 4XGRA 5BSHA 4PYKA 3CBQA 1AVTA 3EYWA 4U6SA 4C0WA 4ESOA 1I1HA 2ZBPA 1M90W 3SN6A 4U2KA 4N5IX 5JJNB 1MU0A 1P6QA 5BSTA 3RARA 2BM0A 3NHBA 3UMGA 1ZGGA 3GJ4A 2M2IA 3V97A 2BIFA 4KE7A 1N6HA 3NPAA 2VQFB 1T8UA 3ED1A 4NX2A 1YS1X 4Q3BA 3D1JA 2ECQA 3RIYA 4TYNA 1W44A 4C4RA 1F1JA 4MK4A 4Z4IA 3MOGA 1XDCA 4LRTB 4UNSA 4B2YA 2IPNA 3LC7O 1B0AA 4D4JA 2GM9A 3PUZA 2CTPA 1T9ZA 2HDOA 1D5NA 1YBVA 2X6QA 3PNQA 3TW0A 1BQ0A 4J4BA 2CY0A 4EX7A 5ICCA 4ERNA 1V8FA 3FNQA 1JA1A 2F55A 4AZ0A 1G3RA 1CEQA 3OX4A 3FPFA 1WVIA 4ZV9A 1CY6A 3L4EA 4R7CA 1DXHA 1FDOA 2BCJQ 3OVMA 1Z3IX 4NMMA 1WNSA 2X0LA 4GX0A 2P9TA 3AZOA 3R0VA 1BC5A 2FMHA 4G09A 3LT5A 1H2XA 3UB4A 3H1AA 3ZGXA 3C8ZA 4TLCA 4D8WA 5BXYA 1UKYA 4XA8A 3U4AA 3DB1A 1M2JA 3AIIA 3SQLA 1EK6A 4OQQA 3VPDA 1JR9A 4GOND 3QX9A 1ONIA 3R0ZA 4G5XA 4RM2A 4Y6GB 4YA6A 5GINC 3DUFA 2NU8A 2HT1A 3FX2A 4EY7A 3AIOA 4X8HA 3B9PA 1XWWA 3FA2A 4LUCA 3H2SA 4KXFB 1ZN8A 2FTKA 3DXFA 3B53X 1CEXA 2L82A 1A8HA 1U7TA 2Q67A 1ETUA 4D42A 2Y1XA 4LYGA 1X3SA 4AZ3A 3E1SA 3MCUA 4NB5A 1FFHA 2F62A 3DA8A 1WNTA 2RGAA 1ESCA 2ZT5A 3K09A 4IIYA 4BYGA 1P31A 4MROA 3G88A 4RBNA 2J3HA 3BD9A 2ZJFA 1CJMA 2BKLA 4CV0A 3BUSA 4C6HA 2VCEA 1HOTA 3B1YA 3CBGA 3IR7A 4RS4A 5E2IA 5JLAA 3GJ8A 3ES9A 5ANRB 2RBEA 2ETVA 5EJIA 5JC1A 2JFVA 3EY4A 3P0FA 2Q41A 3GJZA 2WB4A 4QC2A 1KMQA 5AW3A 2NU6B 3HGMA 4PYJA 4N5MA 1HE5A 1PAUA 3REQA 4C06A 3HDYA 3O31A 3IIJA 1VP9A 1VKRA 2IHBA 1XU4A 2ODBA 2J5XA 4M60A 5EE3A 2PWYA 3D6HA 4JA0A 4NWIA 1DJPA 5F64A 3IOMA 4A9AA 5KOHB 5KHKA 2JLWA 1XYYA 1V6SA 2CNOA 1ZITA 2GF0A 2NOAA 3A1EA 4NOJA 3P2JA 4OK6A 2P2YA 5EKSA 2VDJA 1R0LA 3OJWA 3I56V 1HUQA 2A5YB 2IE0A 3DCIA 4IR7A 4RYDA 4CG3A 4CQLB 3ZJTA 4YJHB 2HSZA 4JHLA 4BDSA 1LVGA 5FR1A 1Y9DA 2JVKA 1YVEI 2X8JA 3LXUX 2R8RA 4PQFA 4AURA 1D8TA 5TY0A 1OCZB 3DBIA 2C8VA 4OY3A 3K9LA 1KEUA 3R8FA 3I2HA 5HRAA 3MSXA 2JK0A 3IOBA 3DXRB 3FNRA 4J3FA 3VPFA 1EFAA 1YITV 2XI4A 1IBMO 3I8SA 5SZJA 1EXVA 2BOBC 3ZXUB 5F73A 2I3DA 4MDEA 5B7GA 1N2CA 5FKJA 2X9NA 3N86A 5BT8A 2V8OA 2GXAA 3K1AA 1IZ0A 2PQ0A 2OFWA 3GVXA 3KZKA 4IDNA 4I6GA 4BQSA 1NIJA 2FKXA 1WV0A 1E3IA 2JHCA 3ONVA 4GL4A 3ROEA 3VQTA 2B2XA 4DVGA 4EUEA 1JYSA 1VQLF 3MWFA 4RENA 1YITF 1W94A 3AQ4A 4XPIB 3UUGA 4BYMA 4P9OA 1UZMA 4EAQA 4TTRA 2F1IA 2XF2A 5K0NA 2O2JA 1QTRA 1CY4A 3RUDA 3F8TA 3SQMA 1NXVA 1E79A 1TE2A 1G41A 3VYVA 4UNRA 1A8UA 3LLVA 2PUVA 4ACAA 4OFXA 4YAWA 2QTFA 3K6JA 5T6BA 1L4UA 4FNMA 1M1XB 5HKLA 1M2OA 2XJ9A 3ITKA 1OI3A 2AI2A 5G2OA 1UL1X 4F9GA 5BUZA 1YD7A 1JTFA 4X41A 3GWKC 3VO2A 1V71A 3QFTA 4BE4A 2ZE5A 1CVIA 1GL9B 3CPWU 3B52X 3HU3A 3MN1A 3DE0X 2PMCA 1URPA 5BVGB 4P4SA 2QRLA 3VYWA 4CCSA 5HFJA 3EFOB 2WTNA 3LUCA 3WA7A 4TN5A 1QUEA 5LB4A 4M37A 1F06A 1EBOA 2ZQYA 4L4ZA 1P7GA 1VGVA 4N0MA 1D2NA 1MO4A 3FTCA 2HCTA 2E37A 2XWJI 4HDOB 4I1SA 1QG2A 4CV2A 4YRBA 3KB1A 3EVNA 2QA4F 3CUYA 3FVRA 1YI2F 3VMFB 2DT5A 1F51E 5E79Z 1M8KA 3K9HA 2QWNB 1T9AA 1X7ZA 2OD9A 3UQ8A 3KVNA 3JD0A 5J59A 3NBMA 4WPGA 4DJDC 4UE6A 4CKWB 5ES4B 2PS9A 4FSDA 2HU2A 1PTKA 2A35A 2EOAA 3ON5A 4NBUA 4I4TA 2GJAA 2FJUA 2QKYA 1AB3A 1M2GA 2XA9A 4PG7A 4P4GA 1IOVA 5EHGA 4ZOLF 5EE1A 5B1DA 3GVIA 4DT1B 2HHJA 5G1NA 1A9PA 3EXG2 4DQ0A 1BJRE 2A8YA 4TUYB 3CEIA 1A8PA 4MRNA 4NENB 3TL2A 3JQ7B 3G0HA 4CGYA 4RZSA 1OTXA 2V7XA 121PA 4ZO8A 3HY3A 4AKTA 5EWLB 5BN3A 2RMKB 4H27A 3JZFA 4XEUA 4Y2QA 2J7PD 2P9ZA 4JUAA 4C5CA 3CB2A 3CUEF 5JO0A 1F2UB 2VDUE 2HEGA 3PITA 4ZFNA 3ZDAA 2GVZC 1WRBA 2VN8A 3IH5A 1GDDA 1N5KA 2XVAA 3RBVA 3T4UA 4PCVA 3MZ0A 4DMRA 3CYOA 3FVTA 3G0DA 4WN9A 2HQRA 3FOFC 4CT4B 1CY8A 1C41A 1UC9A 4F8YA 1DWUA 1JHAA 2EG5A 3R7BA 2DAPA 4NCIA 1T13A 4UVAA 1VQ6V 1M2VB 1CQIB 3ET5A 4QO8A 4ZO9A 5CB4A 5DI3B 3RGBA 3BF8A 5B6JA 4G4GA 3RRJA 1D5AA 1N5DA 1F8XA 3VDRA 3THYB 2DHRA 2F8LA 4BN0A 2GCOA 3E9CA 5L9AA 1C3OB 1DJOA 3N28A 1P2VA 2AD5A 2DLCX 2EARA 2OK7A 4HDKB 1X8XA 3CN9A 2H0RA 2N42A 3WFVA 2Q6IA 3NTVA 5EN4A 2FZCA 1N2EA 2RQ6A 4LI3X 3D36C 4JUBA 3WBBA 3WWEA 1QF7A 4CMEC 5EIHA 4YVFA 1DCMA 1OBVA 1IL0A 4B8WA 1YHNA 3HO6A 3B3QA 3ICOA 2UYNB 4FE4A 3W5BA 1NJIW 3VR4A 4U7OA 3F3SA 1O5OA 3BCHA 3HXOA 2Z6VA 3O0DA 2IZZA 2IA5A 3R3YA 4R81A 3BXZA 1M76A 5DM6V 3DEIA 4H1VA 2OP0A 3UW3A 1CIJA 2Z98A 3J80A 5F2VO 1TJ3A 3DL4A 4RX1A 5BUCA 1FTYA 2Y4UA 2HU5A 1V9SA 4F85A 4RSHA 3HUTA 3X1ZA 4BAYA 3QBJA 2G8NA 4MYTA 3RA5A 4UNNA 1KEZA 2F3SA 4B7AA 4ZOLA 3ZTTA 5KSWB 3BBPA 5D01A 5I4CA 5LP6B 2DJVA 3ZD7A 4DCVA 3HRKA 4X61A 2RJ3A 1N9KA 3O3MB 3NHFA 3TCNA 2HR1A 4LFBB 4L4SA 3JYQA 3RSGA 5KQPA 4MPTA 3ZLVA 5WRFA 2GYYA 3DTUB 4DWJA 2ZJAA 4KUGA 3PEFA 1EVZA 3E9QA 4AX4A 4GX1A 4JJ4A 1MJGA 4BFZA 1GZVA 1F48A 1IY9A 2W2LD 4ECAA 3Q6IA 3ZWCA 5A4FS 5LD2B 2WD9A 1M1YA 4FHDA 4LW8A 2JLZA 3DR5A 4PAQA 3U3KA 4ZQHA 4BIOA 4DO2A 2FX5A 3WLIA 3ZHBA 3WAJA 1U1CA 3PNOA 1C29B 2ZBRA 4NG4A 1E62A 4X90A 2FYTA 4KLNA 4RSGA 3Q5GA 1OZFA 3AEQB 3GCWA 3OH8A 1LDGA 4ZWNA 5A1JA 1THTA 2ZTHA 3AFGA 3RS4A 2WUEA 5BSFA 1ECLA 1JFLA 1EH5A 1IVNA 3RBZA 1E7QA 1N6OA 1B43A 1V5GA 5K6AC 5KC9A 5B1YA 3H87A 2C3UA 2ZJZA 5LMUB 3HDVA 4H4CA 1TXGA 2Y1CA 3PUKA 2DOSA 2Y0CA 2X0RA 3T06B 4JZ2A 1RHRA 4AFNA 2AR9A 2P11A 5K03A 4FDVA 4AECA 4KPFC 1LDMA 4RQOA 3IP9A 1GN6A 5JSYA 1VF7A 2PAFA 2Y67A 4YCCA 3X2QB 4Q9KA 4WZBB 4JXZA 2O6HA 5T67A 4LFBO 3I55F 1O8BA 1WDMA 1IOLA 3VC1A 2B30A 3NCHA 2MYPA 4PWZA 5EQJB 4D7TA 2W0SA 2CLFB 4ZQIA 1CIPA 1EVKA 4IIJB 1OU0A 1XDSA 3JAWA 5IVIA 3VVBA 3CRW1 1QB7A 5KAIZ 1KMHA 2PO5A 3DMYA 3MK31 4YUXA 1XG5A 2BM8A 4LZJA 3T9DA 1YHZA 3G17A 2PRYA 3TVYA 1UJNA 2O5EA 1J70A 3C6QA 4DLLA 3R65A 4NI5A 4P36A 1S9HA 3W3AA 1UBHS 1TAUA 2DYYA 2YFKA 3NVIB 4LCEA 3UAXA 1Z73A 1IWPB 2O3JA 4LYFA 4L5BA 3RWMB 2VCYA 1Q3KA 5BWOA 5LP6A 4US2R 2Z4SA 2ZPAA 3GMIA 4Z9FA 1AURA 5JHGB 3PQ4A 5I4IA 3GQBA 3I4CA 4QXOA 4RULA 3BRCA 3H2HA 1E4EA 2VZ8A 4BBAA 2ZRQA 4G1FA 3M84A 1T2EA 2JJ8A 2R2AA 3EIXA 3II6X 4KQKA 2PXAA 1EFPB 1C4KA 3I0NA 1N8RW 3M89A 2DHCA 5IJXA 2VF7A 4ATNA 4UFPA 2Z6AA 4ZU6X 3CCEV 4H6VA 1X2EA 2VHCA 4KOEC 4MVJP 5ELLA 2V7QA 4BB6A 4FDUA 5HZKA 1CF4A 4MTLA 1EEXB 1ZWIC 2CTQA 4MVUA 2VTKA 3I9V6 4G9BA 5MGBA 1E7RA 3U7QA 3ABKC 4PA6A 3CUSA 2ZZNA 1A95A 3T1OA 4X7MA 3B70A 4IGGA 3M1IA 4Z2WA 1GAEO 2HBQA 4ERHA 2IFTA 4RIIA 2QENA 1BMQA 3AUXA 1HE8B 2J3QA 4GP9A 2PYIA 4JBNA 4JGIA 5EL0A 1B41A 1Q92A 2RAFA 3CT4A 2E76B 2ZSDA 1QKKA 3E7FA 3D3EA 1RPRA 2OQRA 2PT6A 4B4VA 2HRCA 3JVDA 1AH2A 1LVHA 2Q5ZA 3WK9A 4CGZA 2GRAA 5ERGB 5TMDA 2XEXA 5CBPA 2CVFA 5EIBC 1A9ZA 4E03A 4EY4A 4XWOA 3PFWO 4LYHA 3PPIA 1F4PA 2DYKA 4H3VA 1B23P 4JLWA 4PGAA 4TXLA 4RLHA 4YRKA 1LBQA 3OY2A 1ACJA 1EFDN 1J33A 1XL1A 2VHXA 1U5BB 1M90H 1EA7A 4MWCA 4RY0A 3ZZTA 4PHGA 4KJZA 2BSAA 2WJGA 4CM8A 3RSHA 5J2UF 1SUFA 1Y1QA 3QEMA 5JSFA 2JCBA 4UUPA 4S3MA 3MUFA 4ON9A 2H1SA 1XPRA 4X20A 3DZIA 1K73W 1FK8A 1EQAA 4G4JA 3A7DA 4ENVA 2HYIC 2WU4A 1FLNA 1SVIA 1K63A 2AFIB 1Z56C 4JB8A 4OJQA 4NENA 5DHUA 2PMEA 3ZIAD 1GGMA 2ZJ8A 2ZM6B 2F2TA 2Q2NA 4UVBA 1MJ5A 4Q7QA 4YV0A 4BNJA 1HW7A 3DDWA 1H05A 4H77A 3PQ2A 3H7IA 1AT1A 1EFPA 1ZLYA 2JD2A 2HVJC 3L8HA 1WZIA 2VNSA 4RK0A 1S1CA 3RC1A 1SU6A 3D6NB 2CYCA 2B0JA 1NW6A 1IAQA 2PBZA 1BDBA 3JQQA 4KAAA 5EP1A 4NR0A 4NU6A 4DSZA 5BNZA 2QDXA 1WSWA 1GTMA 4HVAA 4YI3A 1JPJA 5ITZB 4AP9A 4GE0A 3WAGA 1VMKA 3OP1A 1N5IA 5EZ6B 1DF4A 5ELMA 1RZ3A 3A2LA 4DVJA 1TCBA 4ZEOA 1T1JA 4UTOA 3FFBA 5LZ8A 3TSCA 3H1KH 1QU3A 3AG4C 3L9DA 2IDZA 2A67A 2WP8J 3OMLA 2PK3A 1L3CA 2H6LA 4LC1A 2K2QB 3DMRA 4KIJA 2AQHA 4G0OA 5D3MA 1PP4A 2ZZMA 4M86A 3AUYA 4PICA 1CY2A 3AR2A 1V7PC 4DY6A 3R20A 1QUFA 1T1GA 2WJPA 3NM5A 2YXBA 4DSTA 1HYQA 1E3SA 4HJXA 1JI3A 2VNHA 2CMFA 3RRMA 1VI5A 2EWVA 3S28A 3WIOA 3PC8A 1CVLA 4EG6A 5KTOA 4ENQA 3BVPA 3DLTA 3NFYA 3OLXA 4MW8A 3I30X 4QFCA 2X0EA 1VJ5A 1FMJA 2GT1A 1SD1A 1L9XA 4NUTA 4DADA 3JTMA 1M56C 3DEHA 1DKNA 3IBFA 3OY7A 2GNPA 3QPDA 4KO8A 5DTIA 4BAGA 2ECFA 4DCPA 1R64A 3DHVA 2C2GA 3HUEA 1SG6A 2XPCA 3MPOA 2Z0AA 1B6SA 5EC8A 3RTAA 5C5IA 3MTJA 3C6MA 1KZ9A 4Z9BA 1R4AA 1J1IA 3H4TA 3FPEA 4J2HA 4F3KA 1ADFA 3WLNA 4TMWA 1RPZA 5HP4A 3AJ8A 1UBNA 5LHGA 1CB0A 1RM4A 2VPQA 4U8HA 5NULA 2RGUA 4KGVA 3PUVA 2AWNA 3ZXIA 1T43A 2B2CA 4Q4DA 3F0GA 1T2CA 3QUBA 1JA8A 4MB2A 1I36A 2CDBA 4PV7A 3GCXA 1JIXA 1NX9A 4IIFA 4M9CA 1YB7A 1QDLB 3GLGE 1NI5A 3BFPA 5HY0A 2P1ZA 3IDZA 4GOLD 3C97A 4QGGA 5HIIA 3MF4A 3I62A 1BFDA 421PA 3WNVA 4ENRA 4G5FA 2FE1A 1BU5A 1JU4A 2ZT8A 3PJEA 4Y6QA 3W2IA 3W5DA 1M5RA 2ZRAA 4QIWF 4Q4LA 3BM5A 3BAFA 1DT9A 4UCSA 2OFFA 2QRJA 4PGHA 4QEZA 2WWWA 3G0BA 3ANXA 4RTPA 3GFFA 4NU0A 4CUKA 2BKXA 2HIHA 4PZ0A 2Q3CA 1KI6B 4H13B 3B7GA 4Y6RA 2REQB 1KYWA 1FUIA 1NT2A 2HMUA 3TOZA 1W3EX 3PGMA 4K28A 3E23A 1FLVA 4Q7LA 3U44A 2OTCA 2WA3A 1XZDA 3DO5A 3BKWA 1M57C 4PNHA 5ICEA 1HT1E 1UP4A 2Q9LA 2BFOA 1H9AA 3BE8A 4P9PA 3OT4A 4UDOA 4FYXA 2OPBA 1L5MA 3V4LA 4CCAA 3FTPA 2AKYA 1UKBA 2B9VA 2B78A 4JASB 3OD5A 3N5CA 4TLLB 4QHTA 1UXHA 3VPXA 3TNFA 2FW0A 3CEMA 1DC5A 4J80A 4FN4A 1KKDA 4YUWA 1N0IA 2H51A 5COQA 4ZPXA 3CC2F 2JGDA 2I54A 2D8AA 2P2DA 4FHEA 2OV6A 4RHTA 4MVJA 3ITDA 4RGVA 5K3OA 3UCSC 1OFVA 2BFAA 5IAJA 1YQUA 4UNIA 4ZDIA 3N5KA 3GWZA 5L4LA 2ACVA 4WKBA 3X1MA 1FU4A 5I7VA 5KWVA 1WLYA 3BULA 4Q21A 3UAWA 1GPDG 4EHNA 3TBHA 2PSHA 4ITVA 4LOKA 4R1TA 2D74A 1JHYA 4MW1A 4MWBA 5GV8A 1QG4A 2R6CA 2YJ5A 4MIYA 1J5EB 1CLEA 1Z8DA 1NXWA 2IYEA 4PX3A 2X41A 3EIQA 3R0PA 1IB0A 5E0KB 1W5BA 3SC2B 4KW7A 3TQIA 2G06A 4LBVA 3COPA 3VYSC 3OTWA 4FLEA 3TSYA 1CRPA 5K3DA 1ODLA 1TCVA 5JUWA 1QOPB 2B7BA 2EX4A 1P1JA 1W25A 3QO5A 2Y1GA 4X66O 3KKQA 3F5QA 5F76A 3EXFA 4KQ1A 3KUUA 5BQOA 1R6UA 1HDGO 4YXWA 5C8DA 3PTAA 2IH4A 4D79A 1JSZA 3NRCA 3O9MA 1UOEA 4CH5A 1YONA 2GHIA 2IS2A 4Y9SA 3M6LA 3VOUA 1XZLA 4TUYA 4ENPA 1UDBA 3WYNA 2ZNJA 1KD1W 4ZVNA 5CUQA 1BXGA 1EK5A 5IUJC 2GPYA 1Q0ZA 3D7SA 5B3JC 4BVQA 1IEQA 1SM4A 3K0HA 4J1NA 1WZNA 2IJIA 1G6OA 4W7IA 3E9DA 5FTWA 1E79G 3H5LA 3CCLF 4RV5A 1N32O 1JPUA 3TTXA 3UK0A 3SC4A 1OUMA 1VQ8V 1TECE 2CXUA 2X76A 2ZTLA 3D54D 4JT8A 4MYCA 3SIVA 3MAQA 1JV2B 4O4LB 2P4SA 3FN4A 1QCYA 1DBWA 2AF3C 3F0DA 2ATCA 2QVYX 5EPUA 5HK8A 2IWRA 5MDHA 4WBNF 2A0LA 3LKBA 3EX7C 5FBHA 2JGKA 5FUQA 2IXBA 2ENUA 3AG2C 5J43A 2FDCA 1DFIA 1U2PA 2FXVA 4QX6A 2FOXA 4B79A 2W71A 3KWMA 2WKSA 4CKZA 3OQNA 2CFSA 1MQAA 1TYZA 2W37A 1N33O 4MVJF 4AULA 1QYRA 4KAFA 3G71F 4U63A 4MVYA 5LBIA 1YA6A 1RPNA 4EG4A 4TXNA 4DA7A 4PDRA 5B36A 2ES4A 2LP4Y 1JQ3A 2JLCA 1KDTA 3BHMA 4RDXA 2BTQB 2VTVA 4JMLA 3RSSA 1X1SA 4PY2A 5TF0A 1JH9A 1KOFA 1IXBA 1Y4SA 3ICVA 1RPJA 3AKYA 3T1YB 2XE6A 4RWUA 4JI0O 3JQFA 5T5QA 2BEKA 1GPMA 3SZRA 1O97C 4CCYA 3UJ6A 5KYUB 3HR4A 1GQRA 2AMFA 3KB2A 2M6KA 3VSCA 1LNZA 3D4OA 3PHCA 4UBJA 1TC2A 4WZAA 3I09A 3O4FA 4IDQA 4P8RA 1PFQA 2HWUA 3SIRA 1MENA 3HU2A 2CV2A 3VQYA 1MJGM 1QYVA 2HWKA 3FPAA 1WB7A 4RIEA 3A1NA 4L8JA 1US8A 1YL5A 3QTLA 4XWTA 4BATA 1U65A 3GRFA 3H2YA 4LSGA 4XYBA 4QYXA 1I3NA 4I55B 1X0XA 2DLNA 3S2ZA 4AG3A 3GHHA 2VWPA 1PV0A 1ST3A 4QO7A 3RH0A 4E51A 3DXRA 1PNRA 1JMYA 2FP4A 3GGPA 4AS2A 2ZAMA 3K96A 4OHPA 3EORA 2IEGA 2JIRA 4ZT3A 4GF5A 1D4ZA 1M67A 1V9LA 5D86A 3CSSA 1WPXA 1EFTA 1YI8A 2BGJA 2XMCA 1TU0A 2ZIWB 3DE3X 3L6DA 2LO1A 3OZTA 4FYHA 1EGMB 4WXHA 4X8OA 3VDMA 5D7BA 3T9EA 3LCMA 3OJOA 3REFA 1C8LA 1Y76A 5CLLA 1MR3F 2PGAA 3DNPA 4MUYA 2Q27A 4JJKA 3EXG1 4QDXA 4YCBA 5EGNA 3ZXXA 9ABPA 4JODA 2ERXA 4S35A 1COWA 5FO1A 2OMEA 2ZAUA 5HKBA 1CQIA 1JF8A 4YAFA 4GKKB 3X3HA 1DDGA 1O96A 3AERB 5FA8A 3UK2A 1L7MA 1TF2A 1HH4A 1FJGB 1SUWA 1ZQ1A 5AKGA 1BHO1 3RWBA 2YNMD 4MUGA 4OD0A 2G07A 3IJ5A 1FRZA 2JIZA 3Q7EA 2DC1A 3PXCX 3BK1A 4P33A 4TMXA 3TRIA 3D54A 1Y8RA 4GECA 2GHRA 4PXYA 3I6YA 3M4JA 3FCYA 1HFEL 3I5UA 5AKLA 4DPKA 5JOQA 2XAGA 1NBMD 5CYPA 4WKCA 1DC6A 2EINC 2OD7A 2QA4V 3DZBA 3H1TA 4WZAE 3HK2A 2QMUA 1TDJA 1I33A 1XNGA 2YX1A 1Z2GA 5CJPA 1NVGA 2EAUA 3UAZA 4WESA 2IOYA 2FOIA 1HZZA 2NO5A 5C5DA 1JA9A 1CDDA 2DQ4A 3KR0A 4G63A 1XZKA 3QFFA 2BJWA 2WIGA 2KHZA 1R0ZA 1PR6A 3CGGA 3JQAA 4KPUB 4LGYA 4G5HA 4CKBB 5JZBA 1X7OA 3SQOA 2YVQA 3MBIA 5K99A 1LQ2A 4D26A 3I9MA 3L0OA 4N0EA 3UVEA 3O92A 1YAHA 1JIKA 3S8EA 2XXJA 5DWDA 2X0KA 4FNAA 1HL3A 1Y7PA 1C3XA 1M8PA 4DIBA 4DM7A 5IXYA 1D2MA 4B3MO 1NJ6A 1PBTA 3AW9A 3IBSA 3IUEA 3O1LA 2BFBB 3QA9A 4DV4B 2EX3A 2Q3HA 1N75A 3FYUC 1G7CA 1A1VA 2C20A 2PKYX 1IHPA 2DFKB 4IY1A 1P2DA 4AS3A 1YIDA 4D81A 2IV2X 5AG2A 2ZNIA 3DOCA 1OX6A 1ULSA 1DZIA 5EBLC 4N41A 4QOJA 1ABEA 4LIPD 2LKDA 2RH5A 3J81N 4GLJA 2P7HA 3LX4A 3EWNA 1D1PA 4Y18A 2DE0X 4L87A 2B37A 1W5FA 1VG9B 1QGUB 2XF8A 4YAEA 5CH8A 4JUCA 1S1MA 2RHJA 4ARCA 4ZVQA 3BMNA 4FPPA 5JVDB 2UU9B 2RHOA 2EJUA 4QPPA 3DBLA 1YE5A 4MCAA 1USWA 3SJUA 1FXHA 3TLKA 1Y3BE 2VAXA 3KDSE 3W8DA 2H4JA 3DD5A 3QOYA 1E0KA 5U1PA 1EHYA 2BFFB 4D6XA 3GJ3A 1GQFA 2DYRB 2VT7A 4S24A 1KR5A 4EGCB 2QZPA 5K1PA 3ZCPA 1Q7YH 3NBKA 1QK3A 3EXIA 4PC3A 3JYHA 4ZI5A 4S2UA 3AR7A 1C81A 5IDXA 5LYJB 4X65B 1PYDA 5FHQA 3S99A 4BNLA 3I5DA 2QPTA 4NZPA 4PLPA 1N1MA 3HP7A 2W83A 1LDYA 4PYOA 4XH9B 5I4BA 3ZDEA 1YA4A 1AN0A 2GKSA 2XTAA 2GAJA 3AC0A 4DCUA 1F0NA 1YIAA 3THXB 5JXGA 1JR3E 3IAUA 4XIYA 3EC7A 2FEKA 1MPXA 3NDIA 5I9TA 3LD9A 1RQGA 1O87A 2JAQA 3KQOA 1WCIA 5B2ZA 1WXWA 1Z37A 1ZTEA 3IS3A 4MR7B 5B5SA 3BHJA 3OHSX 5KAFZ 2X8JB 5F2NA 3SXPA 4IJVA 3PNLA 3P9SA 5ALDA 1BQZA 4HNHA 1N6PA 2FLWA 2BSQA 2CE2X 4FK5C 1EAYA 2DQ0A 2QTGA 8GPBA 1XZ8A 2PU7A 5EIBD 2EINB 2WJ6A 5TPZA 2X0IA 5CAEB 2ILMA 1D4AA 4ZI7B 1U2EA 1ZIXA 2FX2A 2JLSA 1L0LH 3MRSA 1MT3A 3PR2B 3GB7C 2GM5A 2AFHE 2VQEB 1EM8A 1RFYA 1U28C 2PZLA 4UOQA 4Z99A 1VQNV 1BEZA 5F5LA 3JQAD 4Z0PA 3LP5A 5EQFA 1KPHA 3NKFA 2FP4B 3CCUV 2RG7A 4G1EB 4HS9A 4M7WA 3ACBA 3CR8A 3PA6A 1JDUA 3G6EV 2C5BA 4MW7A 2E5WA 1JSXA 4PYRA 4JI3O 4OXQA 1ZRNA 1H2RS 1JKJB 4LWSA 2YWCA 4IF6A 4R0NA 1M1UA 3QVMA 5DXAA 2EZ8A 4LWSB 2QLBA 1L4HA 2YHBA 1UFVA 1Y9JA 3OLCX 3PYXA 1C2YA 1FRVA 4G8DA 4R3NA 5GZ1A 5EMMA 5K5EA 4JYYA 1J2EA 2EZ9A 2FMLA 3AUTA 3GD7A 3H9JA 4H08A 2P5UA 4M54A 1XYVA 4Q48A 1UEXC 2E4UA 4GFDA 4WBSA 5BW4A 1SKYE 3H1GA 4NV1A 2ONCA 3D4IA 3QPUA 4HBGA 3QMMA 3UBMA 5E8RA 4YO8A 1EZ4A 1SC6A 3L82B 3MXOA 1OAKA 2JFUA 2WHEA 5FTMA 3A3KA 4XQ9A 4BKRA 5HM8A 2Q9CA 3TE7A 5THKA 1MUUA 2B61A 3CTPA 5IS2A 2YYYA 2ISSD 3V2GA 3V2IA 4B84A 4CM9A 1DTWA 2XRFA 3UW1A 5B8FA 3R3ZA 3V7FA 5H5JA 3IUQA 3M6FA 2WWVD 1XHZA 1JFVA 2D3WA 4JS0A 1MA1A 1O6ZA 3C85A 2UV8A 4UM8B 4MR7A 5IN5A 2LRHA 4UM7A 4HDSB 3FKSG 4U2GA 1C30A 4IIGA 5HVNA 1C9DB 1J39A 4BTLA 3CA8A 1GR0A 3CUVA 3NXKA 2HSGA 4KGXA 5EXEA 1UC8A 3EMKA 2QTWB 2FPOA 4EB0A 2CFTA 3KWJA 4DARA 4BP1A 3IPRA 3FG9A 3PU6A 2FRXA 3FCOA 2FMTA 1K7CA 3FWNA 3PWZA 4N76A 2D6FA 5K01A 3ND5A 3OIVA 4NJEA 1RWKA 3PTLA 1RLUA 1G6UA 2WTXA 3I2KA 3U39A 4AUMA 4MPDA 3NJRA 4TS9A 2WPNA 1M5UA 1RI4A 1NQAO 2R44A 2W6CX 4DA6A 3DXYA 5DYWA 2Q4PA 1Q2UA 2B8NA 2OXRA 2Q3MA 3O21A 2PLFA 1RS0A 2R87A 5C5EA 1XLWA 3U5TA 3VKGA 4EJ2A 3GGDA 2O2HA 3SHTA 5JI2E 5A3SA 3SG0A 1I3OA 5T41A 4J6FA 1UDCA 1DTSA 1UWKA 4M1WA 3KKKA 4QGHA 4R8LA 3E82A 4HBNA 1IZ8A 2YUAA 3BVOA 1M74A 4U6QA 3CCEF 1W52X 3MJVA 3LCJA 4GWGA 5CPBA 1TZKA 4MEJA 4E15A 3W7BA 4UDYX 4YJGA 4Z5XA 2QTHA 5CDYA 4KP4A 1W85B 3R7AA 1UFYA 3O9OA 1ETHA 1RYYA 3OE7A 4F5YA 2QX8A 2CGEA 1P18A 2EP7A 5J2TF 4FMCF 1JJAA 3WYGA 2ZIUB 2ZVZA 1JVMA 1YE3A 3GCZA 4RTOA 2HW8A 1QCZA 3G85A 2DBZA 3E5NA 1QR8A 3E1YA 1Z4QA 3A9VA 5E7IA 3U11A 4LXGA 1RAIA 3RYTC 1ADCA 1JXAA 2DRIA 2FK7A 3WKCA 1NJFA 1WB6A 2ZBFA 3N2LA 4ZD6A 2Y1WA 3H5IA 2QL7A 4DXAA 4HATA 1ST2A 1Y89A 2WJVA 4JELA 5LM3A 3JYCA 3K72B 3NANA 3KEQA 4YREA 4Y3UA 5EMLA 1GZ3A 1G2IA 3R6GA 4IJKA 5FQOA 3R9WA 4PD4F 3DE5X 4QREA 2A9VA 1HDRA 1G20A 1W6UA 2HLNA 2PRZA 4HRVA 1Q3EA 3RD5A 2JHGA 2R4QA 3B51X 4DTIA 2BSXA 1VBFA 3H0EA 1SERA 3MQFA 4J1SA 2WWXA 4I9FA 5FFNA 2HMAA 1OVMA 5A4AA 2VXCA 4RFSA 3BICA 2AEEA 3C3EA 2PYZA 1QH1A 3HA3A 3RRFA 2QLLA 2HEIA 5L3VA 4QQFA 3BK7A 3P45A 2R8OA 3ZDXB 3SIUA 2QTNA 3G2NA 3R5JA 2A3NA 2CL7X 1U7XA 1Q16A 1Z4LA 4G4IA 1NW4A 1C3LA 3L71H 1KI9A 2V97A 3A9CA 4KODA 5I5GA 4G0ZA 4X3LA 3NK7A 2C9CA 3MT8A 4HQOA 2B21A 4PNPA 4RC9A 4A0FA 5A4MS 4DJFC 5GQSA 1UDXA 3FCEA 3I32A 1E1KA 4QOHA 5KCMA 3V7WA 3AK2A 4YIPA 2QN9A 3CC7V 4WBNB 2OTJV 1RFGE 4CG2A 4OMFG 3K1AB 1Q6YA 1CRQA 1E7SA 2DWCA 1ZAKA 2OAGA 4J0CA 2OT5A 3BY6A 1ATIA 1EXNA 1ZXLA 3FOAA 4TWZA 4UKDA 4D44A 2CFOA 3GRYA 1G66A 5I9MA 2XUFA 2O2ZA 4WWHA 5KHGA 3HP4A 3R9XB 1Y76B 2B4RO 4PWTA 1H93A 1RYMA 2FWRA 4MV3A 3Q41A 3DVSX 5BVHA 1CZOA 2K2WA 3TGWA 1AF7A 1J7JA 4JP1A 4BB0A 4Q93A 5G4KA 3B1WA 3K0BA 3RODA 1Q81W 1KTVA 2C9MA 5BN1A 4E08A 1TMKA 2VG8A 3SZOA 2QD5A 2HYDA 2JLBA 1KI8A 3GUYA 4D45A 2P4QA 3EC1A 2R3SA 3C87A 3MMPA 4I4CA 3ROZA 4BFUA 1H5UA 4WXRA 5MN4A 4E6PA 4V02A 2H0AA 4W9MC 2EYQA 2C5EA 2X14A 3HVKA 3VH1A 3BTVA 4ZVMA 2FWPA 5F2EA 1W4BA 3LUKA 2PUDA 5JRZA 1QXSA 4XCXA 5A0FA 2EC5A 1Z0UA 3K9FC 2EATA 3AEKB 4UW9A 3PDCA 2QNIA 4ZVKA 4KQHA 3O4JA 5DYIA 1YJQA 3U26A 4WLEA 5CW1A 4ZTZB 1K8AH 1J8FA 1NXSA 5FWXA 2H8PC 3GXOA 5C52B 4PXSA 4HT3B 3BX1A 5IKOA 2I4LA 3QTTA 2EEPA 4C82A 2QORA 4I5FA 4A1FA 3CE9A 3DT8A 4AJLA 1SZQA 3L93A 2B9ZA 5LZ9A 3HKDA 2QXTA 5L3SA 1TB4A 3I2IA 4IWYA 3SE0A 3STLC 4D9FA 2VZEA 1H7MA 1CUWA 2PTMA 1NHWA 3PXUA 5F12A 3RVRA 4CE6A 2CV0A 1DIGA 1I2ZA 4MTFA 4NULA 2VHQA 3OE7D 1N6LA 5I8PA 1PNMA 1D5WA 4YN3A 1Z15A 2NTYC 1SBQA 1V54B 3G6WA 2JRCA 3S1AA 2Q8NA 1MV5A 1YUMA 3G2MA 4C3ZA 3AK4A 4KQJA 3ZUPA 1RXCA 3M7IA 3NWEA 2Q0HA 4GICA 2LP7A 1UMDB 3FYDA 2P2GA 4JJ7A 4DOMA 1R37A 2FQ1A 2ZUCA 4M0MA 2QHXA 4ODIA 2FF5A 3CQ9A 4KPEC 2OD2A 1R1DA 1GKFA 2F1RA 1GXSA 3IULA 1AA9A 2HMSA 5EP4A 5K09A 4NIMA 5HJ7A 1NN3A 2R6AA 4S12A 3RTDA 1CQZA 2QQ0A 4NAVA 3O47A 4BZWA 3DEJA 2BFEB 1TA0A 1V5WA 4U7HA 2X0FA 1AJPA 2ZIVB 5F7JA 1YZFA 1TVCA 4QXAA 4NBRA 4WMLA 3HDJA 3UEOA 3WRYA 2WJ3A 3QJYA 4RYLA 2DBVO 1Q2XA 4N7JA 2DPHA 2QS9A 1ZN9A 5E9QA 5GM2A 5IWCA 3D81A 2A0YA 3JQ8B 3GBPA 2CZCA 2NUTB 2ZUDA 4D9KA 3D7MA 2AR7A 2PLWA 1XZHA 2Q5HA 4UJ3A 3AF3A 4V0NA 5CIWA 2AW9A 2C29D 2ODEA 1FX1A 3KKYA 1MIOB 1SXJB 1VIYA 2E0IA 4QUJA 4TMTA 1N34B 4ZU1X 1MOFA 3A1WA 4YP5A 4BO7A 1RBQA 3CG6A 2QZZA 3F3YA 1HR0B 2PT7A 3PJGA 1YWGO 2BE9A 4GSYA 4RNDB 5LQCA 1FFXB 3CNEA 3MBKA 4NNPA 1XPOA 3L7NA 4YLEA 4ZO4A 2QR2A 2ODMA 1MXFA 1PFKA 1QGYA 2HM7A 5HF5A 1ORWA 3JASB 3G13A 2BVNA 2P6NA 3G7UA 3RT7A 4QECA 3W7VA 4K8ZA 3HR8A 3U9LA 5LQAA 1D1SA 3A3NA 3GVPA 1PHRA 3H5WA 2JA1A 3OKCA 3ZK9A 1KQ3A 1R4NB 1U0LA 4YI5A 1L4EA 2JAHA 3FB5C 2CUKA 3SS7X 2BZ1A 4TUYF 1G7RA 4A23A 5AI8A 4Z7OB 1OLUA 3F0EA 2ZWPA 5A6VA 3RJTA 1QGED 1F8YA 4ZOLB 4IW3B 3N8KA 1O9GA 5HTKA 4DLNA 2FP3A 1GTVA 3EW9A 1KB9F 2RCYA 1Z7YA 4ZDKA 1E2QA 4R54A 4RCVA 1V7CA 2JBAB 5E6SA 4Q01A 2CJPA 1RZVA 1NVPB 5B1IA 1L4NA 5CNJA 4AI6A 1F0PA 2GLXA 1G5QA 2Y68A 3H9UA 2R5FA 2XGOA 1WCV1 1AB5A 1HA3A 1DPGA 1Q0QA 1TPYA 1NZFA 4B76A 1Y1LA 1ZL2A 3OCCA 2FAXA 1YR3A 3LJKA 4HQRA 3RFXA 1Y1PA 2AC4A 2Z1NA 1P2SA 2OYSA 3GIDA 3RS7A 2WUGA 4HXEB 1T9CA 3INNA 3NOXA 4RIFA 1Z82A 2BEWA 1SIOA 2I62A 4MEAA 1MORA 1HETA 1HOXA 3R7WA 2FPUA 2VQ6A 4E88A 3MMZA 2O8DB 2A4MA 3J7TA 4MKHA 2ZCVA 5IJWA 4FYMA 4DMFA 2A30A 1E1QG 2Q7DA 4B7EA 1WMAA 3IAXA 3HU1A 4QQRA 1ENYA 3GAFA 2HDNB 2AI3A 1VHAA 1BE8A 2RHTA 2V45A 3EQZA 4UPVA 5IBRA 1SQFA 4N21A 1QOZA 3WK8A 3SKYA 1X0VA 3G5LA 4BQFA 5F1YA 1PJAA 2AJCA 4B47A 1ZA2A 2WU3A 3OQPA 2QV7A 1GQYA 5IJZA 5K6AA 1RQPA 3KJKA 1SZCA 4TSFG 3W5VA 3PHLA 1T0PA 3GLIB 1IN1A 2F23A 2FFBA 4LZWA 4UVEA 4MVRA 2REBA 5D6OA 4B2LA 2YIAA 1VQ1A 3C1AA 2VUIB 5JEEA 4BX9A 3OIGA 4TKUA 2Q4OA 3ZCVA 3AG5A 1JXQA 3NEPX 4BZQA 3F47A 2YBDA 3JASA 3FCCA 3ROQA 2JJQA 1JPXA 1KC1A 4N7BA 2BGTA 3LOUA 1QPBA 1TD1A 2I03A 3E9YA 4BMXA 1NR5A 2ZQZA 3FDZA 1XD9A 3IT3A 4JEIA 3P32A 3WPWA 4TYMA 3IODA 4I6JA 2UUAO 1DC4A 4Q4HB 3WQRA 4U2DA 1MQSA 3LDCA 1TKCA 1Y1RA 4DLKA 3SF0A 4BFVA 2PHNA 3C9SA 3ASNB 1YGYA 2PRJA 2WAOA 3AWIA 1IIBA 4O5AA 4CKEA 3DKKA 4ZVPA 1Y4MA 2O3TA 2GD0A 1JLHA 1M0SA 2O4CA 1GDTA 3PEYA 2MR6A 4HB2A 2XASA 2C0QA 1N0VC 2PNJA 2GFQA 1J00A 1WPGA 2QTTA 5CX4A 4AYWA 2YQ5A 5LN1A 1EX1A 1F51A 3D3IA 4M1OA 4E30A 4JXXA 2ID7A 3OX3A 5DLYA 3I45A 2M6LA 5AOBA 4MQFB 5C80A 5JIBA 2W2TA 2X3FA 3KLBA 4CHGA 5JI3E 3NYQA 2NV2B 4DV3O 2WU8A 3ONWA 5LXTF 5CITA 4XD2A 1G0OA 1GXSB 4O29A 4BCDA 4CDMA 1QVAA 4HFNA 3VJMA 2Q07A 2Q4DA 4FE7A 1PEKE 3R3HA 4TTIA 5JD4A 3NMUC 2NZUG 3G2QA 1TM3E 7REQA 1K8ZB 5T8KA 1V6CA 2JGEA 3N6RA 4LA4A 3QH4A 4QDTA 5EYPB 2H7CA 2XLCA 1SCAA 2DN9A 2YS7A 4A5SA 2ZAOA 3EZYA 2L6LA 2EIMB 3T7JA 2PANA 5C1IA 4BLUA 4DXWA 3QTCA 2H4XA 1A76A 2BJHA 1MOZA 3VQWA 3GBSA 4IKOA 4OMDA 4A0RA 2ATKC 3CRZA 2B5VA 4FWBA 4H1TA 4C01A 3A4YA 2WTAA 5KREA 5JCJD 3UT0A 1XB2A 3PPVA 3M9XA 3QF4B 1PLKA 4PO9A 4UV9A 3AONB 3ZMUA 3ZWNA 3MLAA 1ENPA 1O94D 2BI4A 5E1AC 4RD0A 4H1UA 3SXUA 1ILWA 2AHYA 4B2PA 5DMHA 4BKUA 4DCTA 4D74A 4G0QA 4G5GA 4MEBA 3GWGA 4Q3CA 4FEEA 1BQ3A 1MEJA 5HRCA 4J1TC 5TQJA 3W6OA 1FVHA 3QGMA 2D5AA 1ZK1A 1YRLA 2I9PA 2I4NA 3DHYA 1FS5A 3OJEA 3W79A 1H2YA 4KVGA 5L95A 1EZZA 1XTTA 4ZQCB 1VYVA 5HILA 5AKEA 1NV9A 2HNBA 4MAAA 1XDGA 4FW8A 4LX0A 1ENVA 3UKMA 2V4UA 4MVMA 5KTMA 2DEUA 1P73A 3L8YA 3JVIA 1IN6A 4FOTA 2DU8A 1CYDA 1DG3A 4HWKA 5KYWA 3A0HZ 1XBIA 3DOJA 4NLLA 3NIFB 1M66A 3KKPA 4J4HA 4W4TA 2GYWA 2IQ5A 3TO5A 3ENKA 1O6BA 3PJDA 2HIGA 4KKVA 2BGIA 5B3SC 3QXHA 2DQYA 3N8IA 3UAGA 4EKGA 2OCGA 5E8JA 3A4MA 2EF0A 1NSYA 4AXXA 2ZG6A 3AILA 2I1WA 2J0QA 3KEMA 1O6FA 4KDEA 3ORQA 5BT9A 3K5LA 5KOJB 1EFLA 1NXQA 1EIZA 4ALLA 2V0GA 1YVWA 2J9XB 3L84A 3X1YA 1E2LA 1EJBA 2UYYA 1JSLA 4PWYA 2H3OA 2OTLF 5HEKA 2RGXA 5HDBB 5SZHB 5C53B 1A2KC 1WG8A 5ERYA 4X92A 3W77A 1IV3A 2QR4A 4BIIA 2H0QA 4LK2A 3B4SA 2JJ1A 4M21A 3QIAA 1X8JA 4PPGA 1I5OA 4ALMA 5KJ1A 4PXAA 2I4RA 3CV3A 4LMPA 3NAZA 4A16A 4AMUA 5CFOA 2G71A 4JAAA 1FDSA 4YNBA 5LGUA 1BDIA 3H18A 4AQ7A 1T8WA 3NU1A 3MHSC 1HYGA 4UUBA 1J9EA 5JS6A 5EJAA 1I2DA 3UWSA 2MWMA 2FWBA 4WLFA 5K0FA 3GEEA 1FQKA 2ZEJA 4BHTA 1PNLA 3HYCA 4BLOA 1ZR4A 4B0PA 2P4EA 3U5ZB 3ZLJA 1SQPH 1PF7E 4DJJA 2YW9A 5GAJA 3T5MA 2IUYA 3MWLA 3PVSA 1Z2OX 4K81B 4DCOA 1YF3A 5JAZA 2Y66A 4HNTA 1O95A 3HXQA 1A9XB 3TZEA 4JP5A 4YCNA 4C6SA 1GN9A 5AI4A 1E4OA 3OKPA 1BU8A 1B8PA 5HXZA 1MP0A 4X62B 3GEBA 1GNPA 5CM9C 2R6R1 2IVFA 1EINA 3P27A 4R05A 2J4CA 3GZTB 2YHAA 2JFOA 3H11B 1JLMA 2AJTA 2GUZB 2Y92A 3MT9A 5TPWA 1P62B 3T3HA 4BASA 5AVTA 4YRPA 1I08A 1RQ2A 5E4FA 1WOMA 2ZR3A 2E4XA 3B6ZA 5ALIA 1JG7A 4B73A 3H3JA 1LNQA 2A7XA 1TM7E 1W8DA 3BXFA 3DTYA 3IV9A 1QF9A 1RT9A 1BNCA 3KJHA 4L5YA 2VYVA 4NECA 4PIMA 1Z6AA 4KWCA 1WLSA 2BE7A 1T15A 5KVAA 3JVEA 1UH5A 1XXHA 3A26A 3LLSA 3AHEA 4BO3A 1QR2A 1CQXA 3X1JA 1PG0A 3M81A 3ILXA 5DN6D 3R7LA 2HS3A 4LRQA 2W90A 3ZY4A 1N33B 1OHHG 2KTVA 3OMNB 4FFBA 1CUAA 1L7PA 1U2GA 4WF9V 3IAHA 4Q3EA 2H5LA 3TX2A 1NYRA 2ANBA 1Q6UA 2FSVA 5ER6A 3RUIA 3MA0A 2BBTA 1GSOA 3R09A 3L0DA 3RIMA 4DMHA 1A04A 4EPXA 4IEFB 3EVTA 3SCZA 4NYKA 3H1BA 2IL1A 3MAJA 4K9QA 3WMEA 1LY1A 1IV1A 5BYBA 4RHCA 1J97A 4BW0B 1E2IA 2QGZA 4RV4A 1SWWA 1XDZA 3RHZA 4B2IA 4EG5A 4L4XA 4CEJA 5D84A 1CY1A 4QYSA 3JD4A 2YQZA 5EQTA 1JGTA 4B3XA 3U4MA 1QF6A 2ZRFA 3GMTA 3IMCA 4PO1A 2E3CA 1XDUA 3E3MA 4NTXA 4D7SA 1HO3A 4G0UA 4UEQA 1PG2A 5C8YF 4RMHA 1HP8A 3F67A 4O02B 2IUUA 3I2GA 3V7UA 3RE3A 4W5OA 1GL3A 3D1VA 2PS0A 4HDNA 3ZG6A 1H8ED 4B3BA 4EHAA 1K0FA 4YR9A 1L5VA 2WF9A 1HYEA 4A6DA 4FFVA 1XZJA 3V4VB 3GGCA 2OO7A 2XMGA 2Z6UA 3ZNPA 3X2FA 1SVKA 3FJOA 4HOYA 3LT0A 1VYUA 3H05A 5CH3A 3C9TA 2C99A 2PA0A 3DXXA 1R6TA 4JIGA 3AVPA 3ZQ4A 2D1SA 2XWPA 4R1UA 3TK1A 3QEAZ 4BY9E 2V7BA 3O8OA 2CNNA 3SXUB 3WNZA 4DSNA 4QE3A 3DZFA 5KTKA 4GAEA 3COSA 1D6JA 2QP9X 3WYFA 3EZGA 4UM5A 4X6UA 3KPJA 3R8XA 2GH1A 3Q8MA 4XX0B 3L05A 4JDPA 1RTKA 1RW4A 2QQ5A 3AUAA 3CJQA 4AN1A 1XTJA 3ESYA 1Z9BA 2W00A 2Z4RA 4WVLA 5BNFA 5HF8A 1E94E 4DMGA 2P22C 2AF4C 3P8ZA 4LY9A 1OWMA 5KNBH 3NB0A 1ZJ5A 2G1PA 2IYOA 3I34X 4YT2A 1WJGA 5CNKA 3VSDA 2WSSG 3PGJA 4LYDA 5CLQA 4RTNA 2ZPTX 2D06A 3HV2A 4QM7A 3DE1X 2OZLA 3KIPA 4RZXA 4A15A 5KVCA 2HG5C 4FPXA 2OXTA 1VLVA 3SICE 3TBKA 1FXKB 5JTUA 2FSHA 2O0LA 3QG1A 1DXOA 3TJRA 4D8XA 4ZYTA 5MN6A 3U16A 1YHYA 1NVTA 1B6GA 1W2HA 4W1RA 5K0JA 3L41A 4H0FA 2VA8A 4JI5B 4AYXA 2GBFA 1FNJA 1FUYB 2G0AA 3KX2A 4ZDWA 1K7FB 3DOEA 3TLJA 1VPEA 3HYTA 4ZVVA 1MRSA 1IXYA 4NXMO 1N6KA 1UJ2A 1YI1A 2HBRA 6REQA 3H2GA 1QAQA 1JQ0A 1MOSA 1MEEA 1IEVA 3QE9Y 2GBLC 2X0JA 1EM8B 2IW5A 2FR0A 4L2IB 4YIKA 3W7SA 1I3MA 1W4RA 3NYWA 4ZI7A 4Q24A 2LNDA 5KYXB 1Q7YW 4FQ7A 5FEUA 2IHYA 3RC8A 1K9SA 4MVXA 1ORHA 1ABBA 3OCYA 4Z49A 3LYHA 3IAM6 1BS9A 1XN4A 2NACA 2O6LA 4Q4CA 3U4QA 3RYFA 1SB8A 2GXSA 2FTKE 4IJ6A 3A4NA 2RH9B 3L1HA 4DV2B 2LGWA 4DR2B 4QDKA 1JBQA 4GYCB 2W8ZA 4TZTA 4YP0A 3EARA 3DW3X 1T4DA 1TJ5A 1T9KA 2RGNC 3ASYA 1E6WA 2JAXA 3IKVA 2QZ9A 2AZ0A 3N1UA 3O2QB 3IVXA 3ZX4A 3AEXA 1I0HA 2GJ4A 2F1MA 3R3JA 5EWMA 3ABUA 3FDXA 4D92A 1QIFA 2DY1A 4ER3A 3T41A 2O7NA 5B1HA 3FLEA 4M0PA 3W5JA 2J9ZB 3I4LA 4IMJB 3MT0A 2JIPA 4M1ZA 5DX1A 3C14C 3OMIB 3O0TA 1PGNA 1Y1SA 4OQDA 1MO2A 2X23A 4ZJUA 2B4KA 3F73A 2D0IA 3H6KA 3DFUA 2HV9A 4PPQA 5FB3A 4WJZA 4D3DA 5KYYA 1C0KA 2IYWA 2RD2A 2PMDA 3DVAA 5DBIA 3DGEA 4B46A 2TECE 2P9JA 3LPDA 4RACA 2VJAA 1MRZA 2XNSA 1OW3B 3ZE6A 5LGNA 1U3CA 4KL8S 3C3PA 3TCXB 4D57A 2BY4A 2R1VA 4QTYA 4KR9A 3H5AA 3EGEA 4BEWA 3JZMA 4DUYB 1NU8A 2FFJA 1GMGA 5FOQA 3C24A 3HL4A 3HJNA 1FNKA 3VUEA 1DAIA 1QVWA 1XCGB 2YXHA 1Y82A 3ICCA 4QKQA 3O85A 4L0QA 3QENA 3WGKA 1JJBA 1Z6YA 3K15A 3C2QA 5BPHA 4B85A 4TMKA 4LVNA 2MSWA 4ZCMA 5LQRA 4EBFA 3NC1C 1S2IA 3KEOA 1W29A 1TLTA 4X0EA 3Q9UA 1EVYA 2QPAA 1USVA 3RYHB 4MB6A 3UJAA 1VMGA 2FEWB 1G19A 1W9HA 5CLJA 4JC4A 1AKUA 5THXA 1I2AA 3GRZA 4N03A 1EK0A 2AZTA 3BMXA 1W42A 1Z26A 3KUKA 5IDJA 2H16A 4O4HF 3UOWA 1TIKA 2CAZC 3INTA 4BMZA 1V26A 2I8LA 4AKHA 1QP7A 1O54A 2QUAA 2V4ZA 3LNCA 2JZCA 4GLBA 5TEVA 1HEIA 2YXZA 4PLVA 3OEHD 2BFBA 2K4MA 3NVMB 2SKDA 3UAYA 3VR4H 4P0TA 3HCAA 1U2DA 2FDXA 4G4SP 4B35A 3SZMA 3RDPA 2J3LA 2PZEA 3ZYCA 4UEKA 1NRXA 3IT1A 4AJ4A 3QWBA 5ALXA 2AG8A 4CKYA 2FH5B 3H99A 2F3TA 4PGGA 1O94A 2JD1A 1ULUA 4HDRA 3DZKA 1T5DX 2VQ3A 2H7YA 2ZQMA 3I3OA 3NASA 5G0UA 3UICA 4QTUB 1TUIA 1AK1A 2I22A 4DILA 2OGSA 2IHNA 4XCVA 1T5OA 3ICXA 1WS6A 4NVPA 4Z7QB 3AHIA 3RS0A 5ITSA 2YMLA 4Z53A 4P32A 2VWKA 1U80A 3EPKA 4UVDA 1JWLA 2QTRA 2H29A 1JMKC 1Z2AA 4J0KA 4OIMA 3L0SA 5KYYB 2UZ0A 3K0FB 1NUSA 3LECA 2VRCD 1EDDA 1SXJA 1UKEA 2D13A 2D5CA 3D0OA 3AVUA 3WG9A 4A3SA 2APJA 2BZ0A 4XPIA 1RKUA 4JI4B 2VYND 5E7MA 4LVOA 4XRGA 2F43B 4BPRA 1MV8A 5SY6A 2ONKA 4LXQA 4AJ2A 3LBIA 4DJTA 1OWLA 1P0PA 3UM7A 3GRKA 3V1MA 4YMHA 4S1NA 4JAVA 4KIUA 1TT7A 3TAHA 4KNYA 1G5FA 2KGWA 1QGDA 4F91B 2X5XA 3ODGA 1OFTA 1ZD1A 1BIFA 2CLSA 4OI1A 4D9GA 2FY8A 3RS9A 4F5DA 4F8EA 1VH8A 1OFGA 4MRSA 3QUWA 2OBLA 2O48X 4W1PA 4AXBA 3T54A 1RTTA 2FFAA 3JX9A 4FJ0A 3S5JA 5ICMA 1ZNXA 4EEZA 4TYWA 2HX1A 2R6ZA 4YASA 4CQLA 2GK7A 4WNAA 2OM2A 5FOVA 5L3RA 2QKAA 2WA1A 1YL6A 2DYRC 1WUHS 4IXDA 4HNVA 2IYFA 3L4BA 1KI1A 1FSZA 2CVZA 4F06A 1FW6A 1HG1A 3HWWA 2A57A 1TC1A 3QUQA 3KV3O 1T0KB 3NBYC 4K0KO 5KNDD 3KCYA 1FYEA 1RHUA 1UBUS 3I39X 4MNTA 4NOMA 5CLGA 1E3LA 1YCHA 5AHKA 4GIBA 5AFSA 1OB5A 2E75B 3ANNA 4OSEA 3HJFA 4WFFA 4UREA 1JQJC 3T5DA 4V0KA 5T7BA 1PJ2A 3Q6MA 2OHOA 4ENTA 2VXBA 4RA6B 4BLSA 3W7TA 2V55B 3ADBA 3EA4A 3V4PB 4XJXA 5DP1A 5KJCA 1YZBA 4C0XA 4QFDA 4OBEA 2FMKA 4KCGA 1R73A 3B60A 2JANA 3CN7A 4UUNA 1Z7GA 2R96A 3VV2A 2C78A 2WF6A 4D0NA 4HEA1 4IOLA 2CHEA 1BG6A 2JW5A 3ASOB 1UJMA 4YJ3B 5TARA 5ELXA 4M1MA 1G8HA 2OBMA 4DLAA 4EFDA 5JAPA 4HB4A 4PN7A 2CUGA 5ADWA 1FQJA 4E6EA 1S89A 1RRVA 2I4OA 4GG1A 2MSEB 3K58A 2AW3A 3TTWA 4FMTA 1ITZA 1PK7A 3KKZA 3GLFB 4P5EA 1S4QA 2ADOA 3H11A 4GRIA 2Y05A 2IUEA 3PUXA 4E70A 3STXA 3JS5A 2O3UA 1GADO 2DYSB 4Y7CA 1JZQA 2KX7A 3R5SA 1GK9A 4KYUA 2OC4A 2X6AA 2UYKA 1W5EA 1QDEA 4IH4A 4QVKA 2KLBA 3TG8A 1Z2EA 3EDQA 2WFZA 4WGGA 5TQ0B 1LLUA 1UPCA 4EB8A 2OBFA 1XEQA 1DSSG 1Y34E 3F4LA 3IDFA 2XE8A 5CXXA 5JH7F 1DUIA 1SQ0A 4XIIA 1G8SA 2W6NA 4GZ6A 3WB1A 1GDHA 2FYUH 2Q1TA 5IDYA 2DLDA 4RVCA 2AOUB 1CW2B 1IJFA 2ZWAA 4PG6A 2PUWA 5EJMA 5IY5B 3E1KA 3FUVA 2QN3A 4TTPA 3T7IA 3AG1B 2Q7EA 1QHGA 2I8AA 5EZQA 4B44A 5EOVA 3HC7A 5D87A 2WE8A 1JR4A 2IBZH 4BVGA 3ZP4A 1GLNA 4EQZA 4R3WA 2ZQ5A 3M34A 4YJ2F 3AB8A 4WUTA 3D0QA 4C0KA 2G76A 5LBQA 2WJIA 5KNLA 5IVHA 1T2AA 4GR5A 3TUZC 3G7SA 4ZQEA 2MSKA 5A5VA 3AX6A 2X5NA 2EGUA 2OM6A 3A14A 4AMVA 4D3YA 3G4SF 3P9IA 3EAFA 1CBUA 2L18A 1SBYA 2Q3DA 3BCRA 1GM7A 3CNBA 4BZXA 4Z1OA 4M22A 2LE0A 2NTNA 4Q7JB 1G20E 3ZMTA 5FOSA 3WRWA 1F6DA 4G4YA 4HAVA 3JATB 4MW2A 2PEYA 1IZ3A 1IZ9A 3H8JA 1Q5OA 4XQGA 3T12A 4RTSA 1ZOPA 4HDRB 2AMLA 5JLJA 3SGIA 3RK1A 5KQRA 2N48A 3OBIA 3HJUA 3DBLB 5DNUA 3ZJUA 1E1CB 1OCEA 1UZLA 1ZUNA 2HRDA 1TVKA 2IH3C 5H68A 5A3JA 4ILKA 2XRMA 4PBTA 1LX7A 1P91A 1C3EA 1LVUA 4G6ZA 4OQZA 2ZM5A 4R8CA 2JK1A 1THGA <