4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
5CA0A 4XCQA 3E22B 4U3JB 4DXDA 4I4TB 2GVIA 4IHJB 4YJ3A 2R6R1 5MN4A 5J2UB 3HKEA 5JH7A 5GONA 4LNUA 4O2AB 5JVDA 3HKEB 3VOBA 3CB2A 4LNUB 5GONB 4I55A 3RYFA 3RYIA 5BMVA 5LOVA 5LYJA 5J2TA 5CB4B 3HKDA 5J2TB 1W59A 2RHJA 4B45A 5LOVB 3HKDB 1SA0A 3ZIDA 3WGLA 1SA0B 5ITZA 3N2KA 5LXTA 1TVKA 4U39A 3M89A 4ZOLA 2VAPA 3N2KB 3WGKA 3RB8A 4X20A 3V3TA 2RHLA 3VPAA 5FNVA 2XKAA 2VAMA 4U3JA 5FNVB 2XKBA 2R751 5M7EA 3WGNA 3M8KA 4I4TA 4I50A 4IHJA 3JATB 5J2UA 4WBNB 4I50B 4O2AA 2RHHA 3ZBQA 3VO9A 4X1IA 2BTQB 4HNAA 1TUBA 5CB4A 4EI8A 4O4JB 4X1IB 1RLUA 4HNAB 1TUBB 4KWEA 1RQ2A 5IYZB 5JQGB 4O4IB 3JAKA 1Z5WA 4B46A 2BTOA 4TUYB 3JAKB 5LP6C 5C8YB 4YJ2A 1RQ7A 4EI7A 4EB6B 4YJ2B 3HKCB 4DRXB 1W5FA 3JARB 4TV8B 4TV9B 3HKBA 3JATA 3JAWA 4WBNA 4F6RA 2RHOA 2VAWA 5CA1A 3HKBB 5EZYA 1FFXB 3JAWB 3WGJA 4F6RB 3RYHB 5CA1B 2BTQA 5EZYB 3WGMA 1W5AA 3RYCB 4O4JA 4X1KA 3UT5B 5EIBC 5LP6A 4X1KB 1JFFA 3JALA 5LP6B 4EI9A 4M8IA 5IJ9A 1JFFB 3JALB 5IYZA 5JQGA 3VOAA 4X1YA 5EYPB 4O4IA 5IJ9B 4O4LB 5KX5A 4X1YB 4TUYA 5KX5B 5C8YA 4FFBB 4EB6A 3HKCA 4DRXA 5EIBD 2Q1XA 3JARA 4TV8A 5IJ0B 2Q1YA 5LA6A 4TV9A 5CA0B 5JCOC 3JASA 1OFUA 5LA6B 3ZBPA 1FFXA 3JASB 1FSZA 3RYHA 5MN5A 3R4VA 4YJ3B 5JH7B 4IIJA 3RYCA 3C8LA 3UT5A 5JVDB 2VXYA 4IIJB 3RYFB 3RYIB 4I55B 4ZI7A 5BMVB 5LYJB 3VO8A 4ZI7B 4O4HA 5MN6A 1Z5VA 5KMGA 5EYPA 4O4HB 3N2GA 4O4LA 5JCOA 4ZHQA 5KMGB 1W5EA 4E6EA 4O2BA 5ITZB 3N2GB 4ZHQB 1W5BA 5LXTB 1TVKB 4O2BB 4ZOLB 4FFBA 4X20B 1W581 5IJ0A 3E22A
chains in the Genus database with same CATH superfamily
4JI7O 1WZEA 4I4IA 4PIMA 5LOVF 2NSDA 2C7RA 1W46A 5KHIA 4MVJE 3NVKI 2YR0A 2VPXA 3LOQA 2WLTA 3E27A 4ZTUB 4CLEA 1XQ9A 2OE2A 4I4TA 2QKCA 1IBLO 5EZ6B 3WFIA 2G72A 1BN6A 4FYKA 3VZPA 3SVTA 3G3EA 1ZC4A 3GAMA 4D4IA 1RI4A 4CQMD 4KRXA 5EGNA 1LPMA 5EVJA 2CWDA 5C4GB 2V5AA 3ZWNA 2NR5A 3G0GA 1ENYA 3IAYA 2BGMA 2YNMC 5JO0A 4YHHO 3JU3A 3BGIA 2ZDGA 1B43A 5DNUA 1EG7A 3DMYA 1IB0A 1GH6A 4EF6A 3GRVA 4HS9A 5DTIA 5FPYA 4PDVA 2J67A 4H1TA 1OBCA 5HJ2A 4MVQA 3SLRA 5FF9A 1ZRMA 4D44A 4R69A 2PUFA 1NQTA 2QJOA 1KMIZ 3QVNA 2PRKA 2H2WA 4U39A 2QEXV 2VOEA 2XYPA 4TS9A 1I3NA 3AHDA 3DE5X 1WA8A 4Q93A 1YF3A 5JS2A 4ZVTA 1Z8FA 1OAKA 1ECBA 5D2CA 1U0LA 1M9NA 2ZULA 1YTFB 3BOSA 4EHKA 5FI0B 2JLVA 2X7HA 3M9XA 1CUIA 3IUMA 3N2NA 4RJLA 2GEJA 5C2JB 4HNTA 1E7QA 3IMKA 1OB5A 4L2IB 1I1NA 4B75A 2P4VA 1DXQA 1N0HA 1F2UA 3FTNA 1H3NA 1XGKA 4EKYA 2D00A 2YIBD 3UV3A 3ZRXA 2FMUA 2WNSA 3FI9A 3B9RA 3FDIA 4IRXA 4KXFB 4ARZA 5LKRA 2FP4A 3TMYA 1I4TD 3DL0A 4I3GA 1O58A 1X9IA 3D54D 1UOPA 2FWBA 2HXGA 4DLLA 5TQVA 5IABA 3JCZA 2YWGA 3LY8A 4RLFA 1LD3A 1QHGA 3ZIUA 1YCIA 4YMVA 5HP7A 1ZICA 2P8SA 5G4UC 1GDTA 1XMSA 4TLAA 3A1WA 4WOPA 5FTKA 3IVAA 4N5HX 3T3EA 2D0OB 3PK0A 1YZKA 5ALJA 3I2HA 1XMVA 5CG1A 2Y69C 1XC7A 3IQEA 1ZPDA 1KXJA 4B3SO 1E60A 3BTOA 2CXUA 4BV2A 3GFPA 3LAWA 1EXWA 3Q1LA 5L3BA 4E2YA 1SCUA 3K6RA 5A2QA 1Z62A 3DMRA 2W6JD 3E5RA 4FOTA 4N5LA 3P2JA 4PINA 3V7WA 2IT1A 1NG1A 3UO2A 1QV6A 3IE1A 1FFTB 1EXNA 2ZJ7A 4R1OA 1VYTA 2QTZA 4C0HA 2GXAA 5K20A 4A5UB 1DC7A 2IIVA 4FIZA 3OUUA 2FR0A 1T8YA 4U2DA 2HHLA 1VJTA 3P97A 2RGNC 5LWHA 1RYBA 1WO8A 3WGYA 1SO8A 3WAJA 2O5RA 5AUOB 1SWWA 2AYXA 2OGWA 3MDSA 1EUQA 4TQUS 3KEGA 3FMIA 4Q4DA 4ZP1A 2RARA 4DSAA 2MYTA 4DMFA 5C34B 1XYVA 1CDZA 2JVJA 4OA8A 3RS5A 5D5HA 2DUNA 1P4AA 2CZQA 3WB1A 3D6MA 3L6RA 4JDUA 1SC9A 5U9CA 4U2GA 1Q6YA 1B6TA 3CW9A 4G88A 2O2HA 1VF6A 4AMZA 2NXNA 3LYLA 4S2UA 1UXHA 5KIAA 4MAMA 2ZRCA 3NNDA 3OKPA 4MVJA 1R15A 2PH5A 2WIBA 4YECA 1B8UA 4KO3S 1HLDA 4NR0A 2DC1A 2C57A 3BD8A 3KFLA 2FUNB 2I2XB 2C97A 2FLKA 1J2UA 4LXTA 3TW8B 4CM4A 3AG5A 3O31A 1CK2A 2ZSBA 3UA3A 2JDIA 1VQPV 3FOAA 2Z2JA 1SXIA 3HY3A 4LI3X 5TQ0B 3C6QA 5TQJA 3GHYA 3MSXA 4DLZA 1W7AA 1V54B 2QRKA 2D7DA 2ZBPA 1K2VN 3L7LA 1KEKA 4AUEA 4O3FA 4ZK7A 1N8RH 5ALHA 2ETNA 4C4AA 5CT9A 1QG6A 2WLKA 4BVQA 1K6MA 1WQ1R 1ZOIA 4CH4A 3W8NA 5ICFA 2ZJ0A 1ZWLA 2ZE8A 3R75A 3LQRA 3IR7A 3GA5A 3E8MA 5E1BA 4TS1A 1VJDA 1UM9B 4BB5A 4IGFA 2RAVA 4BEJA 4GI1A 4FFVA 4O2AB 1CJBA 3ABSB 5FDFA 1CKEA 1Z25A 4G2NA 2FFAA 2AW3A 3PG5A 1YFJA 3DOCA 1WZNA 4NOJA 3BREA 4G8BA 3IR9A 4AP9A 3NTUA 4AQYB 2M6SA 4BV3A 3WL4A 3VPCA 1MKYA 4ZEMA 3DEYX 4EW6A 2QKSA 1C4OA 2HWUA 2OV4A 4HB2A 1W57A 1CC1S 2IC5A 2QD5A 4BGVA 1JFLA 5HM8A 2VQEB 2L17A 3NHPA 4E94A 2JJYA 4R8VA 3PC3A 3KETA 3MILA 4JLKA 2ZWIA 5KX5A 1N5JA 5BXZA 4OPHA 1VQVA 1GZSA 3DDOA 2IJJA 1YVWA 4BP1A 4PWTA 2WBLC 1N9ZA 1GM8A 2HU2A 3M9WA 2FW9A 4ALLA 5C31A 2XE4A 1M2WA 3TTUA 5ITZB 2XCTB 4NABA 3UXMA 1K4KA 4CLRA 2ZIXA 5FR2A 4NFYA 1KNKA 4J75A 4G1MB 2FNAA 4DYLA 1VE9A 2F1OA 2JLYA 4MMYB 1FDTA 3N7AA 4K46A 2J85A 3FPKA 4OQMA 3SXJA 3A6DA 3IV9A 3O8QA 2R44A 3PZRA 4PO9A 3AG4B 3QV2A 2H52A 1XV2A 3RVSA 1LY1A 5LCXA 5IK2A 2WJ3A 2PGGA 1TJ5A 3AEKA 4PN3A 2J3JA 4RMHA 3GUYA 5CU7A 1E3LA 1CR1A 4GR9A 1ATZA 3W6NA 4WCDA 1R0ZA 5LDDC 4YAOA 5DDIP 1YTUA 1PL7A 4KVFA 4PQFA 4UVCA 4JI8O 1K0FA 3B1WA 3VYTC 4PHCA 3E35A 4FIPC 4OY3A 4GWKA 3BSFA 2N47A 3OU6A 5LNK1 4B2PA 2QN3A 4XB6B 3IQGX 5T67A 1ODIA 1AKRA 2C2KA 4OPAA 3TXQA 2VYVA 1G4HA 1P4SA 2NU8A 1S1MA 3BBLA 3I6QA 3MTAA 3AHJA 2SBTA 3VO9A 1IHOA 3SPHA 5HKKA 2PD4A 5FP0A 1MJGA 1SIBE 1HQYE 1NG9A 1FQOA 2V6GA 3JS5A 3AR7A 3RK0A 2X2OA 3OQMA 3FJYA 2A0UA 3EG9B 1V5FA 3EHEA 1KI6A 2UVDA 2OPBA 4H3KB 4IHKA 3H9UA 2ADFA 4M55A 4FFMA 3BB4A 3TNJA 1M2OB 1F2VA 4XSHA 3K5LA 1RQLA 2OWOA 1U0EA 1VE5A 5KOYA 1PZMA 5CK4A 3GL9A 4LS3A 3UW1A 1AQUA 2AZ2A 3DXYA 4DRXA 3GP3A 3R3JA 4UUNA 5D86A 1OH8A 4NTXA 4DSOA 1LJLA 2PANA 1G55A 4RJJA 3SDLA 4HGQA 3KPYA 2FWPA 4WKNA 2PLAA 3IURA 3QFFA 3JV7A 4EEXA 1LQ2A 1SY7A 4KO4S 5TLSA 3UH0A 3DNFA 3V8VA 3AVQA 1NBIA 4BQOA 1S4MA 5B30A 1LWOA 2HCFA 4DPLA 1X8JA 1KP2A 1U2GA 4AJ2A 4OI4A 1DDOA 2CMKA 1YJNF 4UXIA 3CCUV 1SC5B 4P83A 1QLEB 4RHCA 2YC0A 1P9OA 4C3VA 2REBA 4J94A 1PYDA 2CUNA 5JWPA 1DXYA 4AX4A 4TUYB 5AXAA 4CJXA 3SDSA 4GVXA 2C0CA 1SJ9A 2ZRQA 2JLRA 1E79D 5E6UA 1R0BA 4O1HA 4GZ6A 3CCRF 3ZH9B 4D6TH 2IXGA 3FAKA 2JA1A 3DFZA 3SJ7A 1TCVA 4KPUA 5JSYA 2XCOA 3GFQA 4B85A 10MHA 2OBYA 4XJSA 3MGGA 1KI1A 4UHBA 2H0RA 2ATEA 4IDQA 5L3CA 3FM9A 1Q1BA 4BBJA 4I1SA 1H05A 3FJOA 3X0DA 4BYGA 4TXJA 2CNKA 1SXQA 4J0GA 2NUAA 4BO9A 1QQCA 4BECA 2V8OA 1C1XA 4EMTA 1UWVA 3UHFA 2GZDA 3V34A 2RIPA 3AR5A 4LVOA 3GUUA 2QVZX 3QKSA 2XAJA 5AKZA 2QNRA 1U43A 2TS1A 1GR0A 1XZAA 2XAQA 1GCIA 5EJ4A 2JIOA 1MX1A 4TTAA 1C0PA 2P9YA 3NXSA 1RWXA 3I73A 1SKUA 3TR5A 1SXJD 4C01A 3EOZA 3QLTA 1RRPA 3HU5A 3SMQA 3LUCA 3AJ9A 5A4JA 2C4UA 4CG0A 1YHQV 1GCAA 1GAWA 4MHOA 4V03A 3LWPC 4KSCA 4YO8A 4YRGA 2B8TA 4X64B 4JENA 3OD5A 4ZU6X 3WBFA 3SI7A 2O3SA 1RKQA 4N12A 4AIIA 2W8BC 1C2YA 3GGOA 3K9WA 3KV3O 4TMWA 3VJLA 4F92B 4NXMB 4RJIA 3WG7B 4GKAA 1ISHA 4UHFA 3DHVA 1H2AS 2O59A 2DUUA 3CURA 3QTTA 3H83A 1HTWA 3LJKA 1LLUA 3T9BA 3I7TA 2QMZA 2LGJA 1U8AA 2MYPA 2ZJBA 4LHXA 2ZGVA 5H8WA 5LYYA 1YJBA 5CFQA 1HE1C 4HMPA 1AJPA 1Z38A 4OQZA 2O3RA 1I2DA 5LBQA 3RRNA 3EFBA 3S55A 2QM7A 1AHNA 3W77A 2C2GA 3A25A 1JU4A 1N2JA 1X25A 2DPMA 3AUUA 2OG2A 1KNQA 5HQ3B 3GXBA 4DLBA 4EFKA 2DLDA 2BCJQ 3F6MA 1PXWA 1XDUA 1CUGA 4BO6A 5AW1A 1JAIA 1Q0PA 1WWKA 4G1VA 3KT8A 1JFFA 1HNXB 4R7ZA 2AN1A 4KODA 3VVMA 8OHMA 2X14A 2XDQA 2IM9A 4TV9A 4F3KA 4MTOA 4FX2A 3SJBA 4QXQA 3MRSA 4OBBA 3B40A 2YRWA 4WECA 3GLQA 1H85A 5J1SB 3W0LB 4C7KA 3U80A 2KWIA 4EY4A 4BNDB 4N7RA 1JHDA 3Q85A 1W93A 4MRRA 3ZIAG 5F7ZA 2CCKA 3CRAA 1WB6A 1BA3A 1A96A 1M56C 4ZKEA 5K2MA 1RBZA 4RPHA 1QX3A 5GIOE 1YFLA 3MAGA 1J8MF 1KP3A 2ZPAA 4TN1A 3MUOA 1EUDA 3UG7A 3OCVA 4S0XA 2VJOA 3E81A 3DV0A 4P34A 2AHZA 2OYRA 2CLSA 1T4CA 1Z7GA 1Z5WA 3MRTA 4DLKA 1JDTA 3C1AA 5K2OA 1F38A 1YKGA 3HSSA 4JLAA 5IT0A 2D74A 4IRMA 1I3OA 3IQWA 4OXYA 4EFNA 1XXLA 3VI3B 3RVOA 1RXSA 1P3DA 4CXMA 3RWOA 3KWLA 1JSCA 1UBRS 7REQA 2E49A 2J9ZB 3JAMM 3NG1A 5TJ9A 3V42A 3CS5A 2GNPA 3A3KA 2Z57A 2QW8A 3IRVA 1J5EO 1TPYA 2PUHA 4MZXA 3TTYA 3R7LA 3CR8A 1MAVA 1SIOA 3ASNB 1FPMA 3UJ3X 4A3SA 1XQXA 4Y1RA 5JIBA 2ZXWB 5JZVA 2GVIA 2UZ3A 2ZJFA 5AJYA 1BVRA 3PEEA 1IMOA 3RRJA 1Q0RA 1EH5A 2SKEA 2ARHA 1YCFA 3OT7A 2PG3A 2Z6QA 1KQSF 3PI6A 4MKRA 4DDWA 1WA8B 2G9ZA 3RSLA 3M4XA 3BD7A 3EPRA 3ZRWA 5IAJA 2DVMA 1CP3A 2ONCA 4DV2O 2Q9UA 2QZZA 1LBHA 8ABPA 2CHTA 3PQEA 1QCZA 1RRKA 1F2UB 1YJQA 5CIWA 1TVCA 4IDPA 3PXCX 1GG5A 4TYNA 2ZWAA 4JYBA 2PYIA 1VQNV 4ARVA 1FX0A 1N33O 1XX6A 1F3LA 1NI4A 1U0BB 4B71A 1F2TA 3IOBA 5EIHA 3KSBC 2FMHA 4PQRA 5AESA 4L4ZA 2FP4B 3NOVA 4ILKA 4IPTA 2IS6A 2GN6A 1FRZA 4KLNA 4C05A 2JFPA 1DT3A 3P9RA 1B06A 2ZBFA 1XEAA 2VAMA 2IH5A 2HEPA 3EMKA 4X60A 3KUUA 3RREA 4N41A 1EP9A 1R5BA 3CCLF 2Z2KA 3COSA 3GVIA 5BSRA 3MLAA 3VYWA 4KDCA 1BEEA 1O87A 3VR5D 2GAAA 5E79Z 3D5QA 4CHGA 1W87A 1I5RA 3VC7A 1FP2A 2XUJA 4DMMA 3CCJV 2GPAA 1A9OA 1OPXA 1G17A 2IUYA 4C8IA 1ZGJA 5BV0A 3W4KA 2VKQA 3GG2A 1FFEA 2Z0AA 3ECCA 4NWIA 3BPZA 2CXHA 5DP2A 1II9A 4IOJA 3TZLA 2OAGA 4ZO9A 4CH3A 3X2QC 4FGSA 1ZU4A 3FNEA 1SCQA 4HN4B 4BIMA 2FN8A 3GNSA 2O2DA 4H4EA 4KL1A 1VSUA 2D3WA 2BEUA 2BN4A 2H4ZA 1YNSA 3C85A 1J1ZA 1SCBA 3EVDA 2GTPA 4TWJA 3CLSD 1Y6GA 2XF8A 5AW3A 3QU9A 1MPTA 1P9WA 1VPDA 3NS7A 3CVXA 3PIRA 4LRTB 4M9UA 3W3ZB 5ITSA 2XX3A 4H1HA 4GVLA 2GRJA 5BWMA 1YEWA 2BMFA 5A1JA 4PSUA 1BCRB 1R6UA 2FJUA 4F9FA 1X9GA 1X1SA 3ZWMA 5IYDO 4RNCA 1KI2A 1JR2A 2Y9PB 3LUDA 3R66A 4DR5B 4NCJA 4CMCA 1X70A 4W1QA 1MA1A 3TUIC 4ZVVA 1KK1A 3GJQA 1Y3HA 3GPDG 4FLXA 5I4BA 4EPWA 3H2ZA 5AP9A 1IY1A 3KC2A 2HIMA 4RZSA 3FKSD 4HWOA 1E99A 1YS1X 1MX9A 4PA4A 1K8AH 4PFJA 1TF7A 4OMUA 2B30A 2JLCA 1P60A 1KQGA 4CM4B 4DT1A 5SZIA 3OFSA 4U02A 1U8FO 1YDWA 4RMGA 5EBLC 4TT3G 2IPAB 3I55F 3H5LA 3Q3GE 3QFTA 1WW2A 3GCDA 3HBJA 4DUZO 4W63A 1ZIDA 3KRTA 3VH4A 4PCAA 3W34A 3BMNA 3GROA 4ZCIA 3NM4A 2ILVA 3RUPA 4WBNA 4PLZA 3TPCA 1KVQA 1OGIA 3G79A 3TN7A 4FBMA 1FXKC 1BFKA 1V5GA 1WQ3A 5IT9N 3PRYA 4YJFA 1NM5C 4FYMA 4L8JA 5H1YA 3FXAA 2GHTA 2I03A 4L8LA 2IHVA 4CEHA 4LSZA 3RW0A 3RE1A 2RFLA 2C9CA 5D7NA 1F8YA 3P0HA 5BV7A 3P19A 1CZRA 5B1HA 5CXXA 5AOVA 3VQXA 1TOAA 1GZVA 3C97A 1O0SA 1X1AA 2QUAA 4LZOA 3PLRA 3RKUA 3U17A 1PTJC 3ZCVA 4XCQA 3LHDA 3APQA 3WJRA 2EZPA 1PWXA 3Q8MA 4U6SA 4QNNA 1RI1A 1CUAA 1HFWA 3CCQF 5AKIA 3E9YA 2OVBA 1IWBB 3DGFC 4LJYA 5FLKA 2A2ZA 1SC3A 2RB9A 5EJAA 1C5KA 1U9YA 4KR6A 5IKPA 2VNKA 4IO0A 3ZJTA 3WTBA 4WJLA 1VQ6V 5DK6A 3KYCB 4DLPA 1GG9A 2EEPA 1DJOA 3VVBA 3SPXA 4N03A 1IATA 4O8ZA 2N75A 2VK4A 4DSZA 1VBKA 5KX5B 5C8YA 2Y77A 3B6JA 3M2PA 2X22A 3FMGA 1GXSB 2YXYA 2QSUA 3OZ7A 1Q86H 3ZIAA 3U7QA 2BEJA 3K0CC 4QFCA 2JAHA 3EE6A 5EHNA 1F51A 1QG0A 4F2GA 1UJBA 3FZNA 5MGNA 4Z1MG 5F73A 5E38A 5GM1A 1YZGA 3HCNA 2PUTA 5DCUA 4S1WA 2O8EA 2PUJA 1T1GA 3DE3X 1GQOA 4FGLA 4JPRA 5HIMA 1FDUA 3R3UA 5FUYA 3V8EA 1K5PA 1E0KA 3I6YA 3IC9A 4ZIBA 5IFKA 3T3PB 2WSYB 4JYZA 2JCVA 4YAGA 2ZYHA 4UCWA 3EARA 4IX1A 3L8CA 4IKEA 1WW8A 3AEKB 4DMCA 1ZVKA 1IN7A 3TL6A 3K2EA 4UOZA 3P32A 5DYTA 1JZSA 4GXTA 1HSZA 1AGYA 4OQXA 4I9QA 3OTOB 3U3MA 1RQGA 3S1AA 1DKLA 1R4NB 3IPAA 2PKQO 3ZY6A 1TM2A 3E58A 4MIOA 3UCEA 1GZDA 3A9TA 4II3A 4RTSA 2XRMA 4PFQA 2P2NA 3PUZA 3PXAA 1PJ2A 3UKDA 2XASA 3EPHA 1WUJS 3F90A 2WM8A 1B3BA 3PNOA 1RPAA 2I4RA 1T3ZA 2GPBA 3DBLB 1AGPA 4US0R 1PR6A 2WAXA 5F7OA 3SJUA 2B1QA 4YJHA 1K9SA 1QORA 3IELA 1B93A 4I6GA 2Z0MA 4BT3A 2NU8B 4O2AF 2D0DA 3ESYA 1XQ8A 4G07A 4RV9A 1T5EA 3ENZA 2O6HA 6Q21A 3K6JA 4DCGA 3LDAA 2H94A 1MO2A 2Z95A 4UEOA 3AOEC 3M4SA 3ABIA 1SN7A 2C03A 4MW9A 4UQLA 3KSUA 3Q6IA 2PUAA 3ADDA 1ZM9A 4P92A 3OM0A 5E9QA 4UMDA 2DYSC 5FI3A 1X7PA 5HEKA 1KR5A 3F9RA 2NYVA 2BP7B 1TYDE 4BY9E 1LGYA 1Y4ZA 2P4EA 2VHTA 4BLUA 3DOUA 4UTPA 2QTVA 4IAOA 2Y0EA 4QYSA 1HT1E 2XDAA 4OU4A 1QRDA 2YHAA 2BZSA 1L5OA 3QPCA 2C1XA 3FLAA 3R3WA 1Q1NA 1NR1A 1B0UA 5J4YA 3EGXB 1GKUB 2WG0A 2WF7A 4J7JA 1LVGA 1U96A 2VT2A 1VG0B 2XHBA 2BBWA 3QGMA 4FEAA 5KJCA 2DECA 4Q7QA 2R8BA 1FS0G 3R76A 5ALPA 1FVXA 4YUAA 4X6LA 4CGYA 3ABLC 1L2TA 3SJQC 2Z58A 4XM0A 5E6UB 2P9JA 5ECDA 3ENNA 3F7TA 1LPAB 4GGOA 3IT2A 3STUA 4IKPA 5L45A 3UV7A 3KK0A 4G4GA 3MT0A 4G8JA 5H3LA 4OB7A 2WNIA 1G7CA 3VO8A 5M04A 4LSGA 4E2WA 1Q3TA 4N6GA 3CVWA 4F3RA 1K8ZB 4DA8A 4W4KA 1CS4C 4NECA 2Q3BA 1C1XB 1NVXQ 5KVQA 3EZXA 1MVOA 2WUFA 3HKDA 1V4NA 3O8LA 3K9NA 4QTZA 1B0ZA 3T38A 3DVLA 2HFKA 2ZETA 5YASA 3WISA 4AECA 5BT9A 1VMIA 2B4RO 4I50F 4LWZA 1T34A 1D6MA 3HZHA 5LBTA 3RFXA 4B6OA 4IDCA 3BGVA 1ZGZA 3UOWA 5EJFA 4YRKA 2QN6A 3E53A 4NBUA 2NZXA 5BR8B 2RGBA 1I7NA 1Z2OX 2DXIA 4KGXA 2G1KA 1E7MA 5IVPA 4TXHA 2H08A 1MV8A 2PA0A 9LDTA 2YS8A 3PJEA 1GEGA 2VDRB 3DEFA 1VP9A 1ECGA 4RUKA 2WQ7A 4GHWA 4TL8A 2OFFA 2YJ6A 3EQ2A 3ILSA 3M6VA 4YRIA 3BH0A 3WGOA 2H2HA 3U44A 1GA6A 2LCQA 5B1DA 1QMGA 4S1TA 3LCMA 1KBHA 3QXJA 2IZ1A 4KQKA 3RVZA 4TT3A 5FAKA 1ZINA 2X5KO 1OI2A 1UQRA 1T9GR 2MSNA 4PZLA 1V0JA 1K7EB 4UM8B 3OT1A 1WVMA 1URPA 1ZMTA 2GEDA 3HN6A 2IPXA 3KCXA 2J0QA 1AJNA 4LFBB 1OILA 2R48A 1U9CA 2NU7B 3WMWA 1VA5A 1SCAA 3NM6B 3RUIA 5BMOA 2B1GA 2OR3A 3BRCA 3J7TA 3UGKA 2VPIA 1GK9A 2X42A 4EB0A 3QLUC 3V4DA 4YRPA 4N3GA 2NU9B 1RYDA 4DUYB 1JFFB 1EQUA 4TUYF 1CY8A 4TXLA 5FADA 2UXCO 3K9FC 3B6NA 4Q7MB 2P4KA 2QN2A 2XDQB 3IP7A 3IMPA 1KJIA 3W1VA 4NBSA 2QRVA 4P58A 2Z4SA 4LJAA 2CV0A 5IF3A 4D3YA 3THXB 3DO5A 1NXVA 1W3EX 3QPAA 2M6KA 4GRDA 5J5CA 3SHWA 5E6RB 4B3JA 3TTSA 1CJVC 1SQVH 3IX7A 3PBKA 2I8LA 2PMWB 2CNDA 5EXPA 5KBYA 4NTYA 4ZZ0A 5CUQA 1EUDB 2J9XB 4U7NA 2PUEA 5A5EA 3BTVA 1ZY2A 2C0PA 2O3QA 3DV0B 3QXSA 3AQ4A 1Q8RA 1M0SA 1SZQA 3DEIA 2AXNA 3LDGA 521PA 1Z0SA 3W5SA 1DEXA 3B5EA 1XHFA 2BIFA 4MR8A 4GPTA 3UUWA 2OTJF 1SIWA 2NZVG 4YCSA 2OCGA 5LLTA 1LVHA 3IDZA 1A88A 1ECFA 7REQB 5FQNA 3GF4A 1B8VA 2BFEB 3T9EA 4PVCA 4Z1MA 3HLKA 4G0WA 4RKRA 3NTRA 3DMTA 2RBEA 5FJIA 1Q0TA 1IQUA 2QL7A 3LV8A 2R66A 1R0RE 2PYJA 4WY5A 4KYUA 4R9RA 1ZONA 4M54A 4OA5A 3ZNOA 1EBOA 2JZNA 1I94O 3SZMA 3NALA 4UDXX 1OZHA 4XFDA 2HSEA 2WTNA 3VR6D 3K5NA 5H80A 1ESMA 1S02A 3F5WC 4PCVA 5BYBA 4GH5A 1I0ZA 5JSHA 4ES6A 3UJAA 2Z3WA 4MW7A 2BEWA 3ZRWB 2CF5A 3OCJA 4ANFA 5ALGA 1YBVA 1PL6A 2VP0A 2Y92A 3AT1A 5AJUA 3AVOA 2HYDA 1H48A 4GMFA 1SC1A 2V6IA 3HYRA 1JKMA 2HJWA 1MB3A 1TCCA 1ONNA 2WSSD 4FFBB 1UCFA 3AOGA 2HQRA 1SC4A 3NBFA 3HA3A 2RGUA 2YXHA 2WFAA 4D97A 4NYKA 1FX0B 4QGBA 1DL5A 1YJ8A 1NI4B 5JRJA 1GO0A 1F2TB 3ETNA 4BW9A 3D7NA 3WV4A 4OXKA 5CTJA 2KMLA 3NWEA 4GEKA 3HP7A 1OCOB 5JXHA 1NIPA 1C1HA 2MDTA 3EVAA 1FPQA 4C0XA 1URFA 2Z3VA 3F5FA 1SBZA 2AWOA 4YQZA 4HNVA 2UYGA 3HR4A 1Z08A 1K86A 2L18A 1NY5A 3GGSA 2HY7A 3BF7A 4CIWA 3ISVA 4NDNE 4YUWA 2MSDB 1M6HA 4KK3A 2VNJA 3FUXA 3BXPA 1UBFA 4FZ1A 5AJTA 3RDPA 1U3VA 4B82A 3TDMA 3MWDA 2IDKA 3WK4A 2OXEA 4X41A 1L9XA 1UBOS 3AMVA 3VNAA 4QWMA 4I9GA 2FE1A 5ALYA 4U3FH 2VNHA 3GFBA 3NW9A 5JJJB 3UQZA 2AK3A 2RKOA 3AFNA 1M8JA 3LKBA 2OO5C 2GHQA 4D9GA 4F8YA 2KQUA 4K35A 4P4SA 3UK6A 3SKVA 4H2DA 4MYSA 2YHBA 4DQLA 1VMAA 2VDVE 2QE7D 3ESQA 4F4JA 2PL3A 3A2LA 2JDIG 1Y9EA 1J1UA 4GZ5A 2AMLA 2ZIWB 1LSUA 3OUTA 4ZQFA 4PX2A 5CDSA 3V8BA 2ANBA 1BDMA 1CNEA 5FBQB 4OSOA 2VJDA 4Y6PA 3LOPA 2PWYA 2P9QA 4WLFA 3LY5A 2P4SA 3ZMVA 3VNSA 1NYRA 5DBEX 1YFKA 2ZJ3A 1TT5B 4TVBA 4D9KA 3DE2X 2BFBA 3P2OA 2BM9A 1TUIA 2A33A 1QB8A 4OAQA 4EFLA 3UJHA 1JXAA 3E9NA 5ALZA 4AY2A 4LG1A 1Z5VA 2OXIA 4LZZA 5HF6A 3B1VA 3NNNA 5I9BA 2FB5A 1QKIA 4X88A 1O6CA 4K8ZA 3RU3A 5LQJA 1E59A 5I45A 2FEKA 2N74A 1T8RA 2J8ZA 4RTMA 2VHVA 3UYLA 2NV2B 4NYMQ 2ZAUA 4HLDA 1YVDA 1ZBDA 4JTAB 4PV1B 5ENVA 4AKEA 5F98A 3K06A 1GLNA 3ELYA 3H4IA 5JBNA 4CTJA 2GPJA 16PKA 4WZBE 4FQ5A 1TA8A 2OFOA 4UJ5A 1U80A 3VDXA 3GHZA 4DR6B 3T54A 3M9LA 3IAM1 2GK7A 4DC0A 3CA8A 1K3EA 1ZH0A 3OAAD 2X9VA 1FU8A 5JBIA 5B5SA 4HPXB 1EFPA 4G26A 3HKCA 4LVCA 3Q8KA 4ATNA 1E0JA 5H7XA 2R6GA 1UKBA 1V1MA 1O57A 4DLAA 3KQQA 4EPTA 1J90A 5HKAA 3Q7QA 2OCDA 1K6EA 1U4SA 4BDSA 2GUGA 4HWRA 1UWCA 5FWXA 4F6CA 1RHMA 3AZQA 5T6MA 3PB3A 1G8PA 1KXZA 3M6WA 1EZ4A 1WZCA 1KDYA 4NXNB 1JKJB 4E7OA 1CBUA 1UBTS 4KAXA 3PR1A 4AG3A 3VGJA 2QX4A 3DYIA 1N5LA 1LFAA 1W36C 1TFUA 1FMTA 2QRGA 5DN6D 3RBVA 4G5FA 2I71A 5I7FA 1CQJA 2OK8A 3PNYA 1PFWA 2HRDA 5KTRA 5LP1A 4YJ2A 5ALNA 5J4KA 2CBGA 4UNQA 1AUVA 3PFHA 2AGAA 2QVYX 4MWDA 1W4LA 3NBZC 2PEYA 4CWAA 1KK2A 1AILA 2JFXA 1Y98A 2AMTA 2FN7A 1N34O 2CDNA 2NW6A 3I83A 4BIZA 3RVMA 3L72H 1QKJA 1E7SA 2WHEA 4OKNA 1SK9A 5EFOA 3NP7A 3KSMA 1RZRD 3GEIA 2XLBA 3S8MA 3U7QB 4C7OB 4WA7A 4QUDA 4Y0AA 2H65A 5TPWB 4ZOLB 4ZK2A 1HG0A 3DO6A 3DZBA 2HMAA 3L0DA 3WZLA 2ZKIA 3K0HA 1R18A 1DE0A 3KZXA 1D1SA 3DWEX 1HR0B 4MVJF 3KX2A 4AJJA 4FZVA 1EPUA 3DEZA 4U9IS 4HVCA 5FO0A 2W6NA 5JD5A 4UHCA 2BMEA 8LDHA 4FDUA 4BVLA 2RHHA 1C1YA 4FNMA 1V41E 1D5AA 2PKYX 1WOMA 4H7FA 1WX1A 5EXSA 1SVSA 4E2FA 2UZ0A 3TETA 5J59A 1B7GO 4CH5A 1MOPA 4QNHB 2OIEA 3C15C 3T5BA 2JFFA 1EVIA 1CVRA 4HCJA 4RJKA 4MUIA 1YRHA 5H4HA 3SSNA 4WUTA 3OD4A 2ZAYA 4HEJA 1EX6A 1HE8B 3H5IA 4AICA 2W2LA 2ZCEA 1GITA 3DKVA 3EVEA 4U1RA 3OFNA 1I10A 4NE9A 1EN4A 2PXAA 4KPYA 4MYUA 4NWOB 5CVJA 4URYR 9GPBA 1IPHA 5ED0A 2VHWA 2WAAA 4FFOA 1R8JA 4RH1A 3V00A 5T4BA 3THYA 2C4TA 4D8WA 1JU9A 2XWPA 4RELA 5AHOA 5GVRA 3L84A 4MYDA 3WOVA 3KLMX 1TJ4A 5AIBA 3ZDZB 1H1LA 1N8SA 3K9CA 1FRQA 2PY5A 2BAGA 4ZQGA 5AM0A 1ZQ9A 3DXRB 4QTYA 3LW7A 1OX5A 3FOFC 1PJSA 5HCUA 5BW6B 3GJSA 3TRIA 3OPVA 4B2LA 4XEUA 2WLJA 2YEVA 3H1IH 1AKUA 1WD5A 2VJNA 5F9MA 1VXOA 4E5YA 1FJ2A 2XNDD 1R66A 4MV5A 1TF2A 4DQDA 5KOHA 2PQ6A 4C06A 1ADCA 3SYNA 3PGA1 1LRLA 3UWPA 3GCGA 4LE0A 3LGSA 3B4SA 4KVZA 1T3GA 4UHHA 3Q8HA 2J45A 1AY0A 3OEEG 3IILA 1T3LA 3FDFA 3SJCC 1JLLA 4UCRA 3WWDA 4XQ9A 4A26A 3E1SA 3NR2A 3RM3A 4Q9NA 3OOHA 3FYUC 1QIGA 1R0LA 2FPIA 2RH4A 3NFYA 4OM8A 4G1CA 4OOEA 2HSWA 2Q5ZA 1O94D 4WZBA 1C8KA 4QAQA 3VISA 4YMIA 4G25A 4BMZA 2QMOA 1OREA 1PNKA 1SRYA 2FA9A 2EFYA 1O2DA 4WGGA 1RSOA 2O4UX 4A36A 2O8VA 1WNFA 1FYEA 2QTTA 1W2HA 4AYWA 4G1EB 1SVMA 3ZGNA 1IK6A 2OV3A 2DB3A 4B5CA 3A37A 3WI7A 3MGCA 2Y4UA 1L7MA 4BLPA 1S5LZ 1J0AA 5I7AA 3G9ZA 3QLVA 1U63A 1VI2A 4KAJA 3KQPA 4Y2TA 4IJKA 4M0KA 1LV8A 2AJ8A 2M98A 4BFSA 3FPGA 1VIVA 2MSLA 4RETA 3CPHA 1VJCA 1CUEA 2Q3MA 3HP1A 2G76A 3HUEA 1C81A 1ZLYA 1UZUA 4I55B 3GD7A 3ZW7A 4X85A 4OLFA 3KJHA 4RTOA 4FGUA 2CXXA 2QRQA 4U3JB 4MVYA 4ZQHA 1OXXK 1XQWA 2OXRA 3D01A 4MB0A 2PLRA 3HKDB 3IBCA 1VBNA 3GMIA 1FFDA 3H3XA 2IYSA 3EZNA 1U04A 1NN3A 1ZK3A 2R751 3ZI4A 2GHYA 2DBZA 1VRCA 1M34E 3I5YA 3JSAA 1BS3A 2N48A 3DWFA 3QYAA 2YV2A 3TQFA 4DGQA 2JNWA 2VQFO 2WWYA 4GU5A 3TLEA 3AFMA 3EDRA 4QOIA 5AI4A 4CIXA 1CNFA 2WFZA 1OKKD 3SYLA 2Q46A 3A9RA 3HDJA 3CRZA 2Q0OC 4TV8A 4YMHA 5DT2A 2FRDC 5EZSA 4ME6A 4JQCA 5D3QA 3C8DA 4CTKA 2UZHA 1JLMA 3EMDA 3GDWA 2YNMD 3ORHA 2C2AA 3KR1A 2QRZA 2PT7A 2RQ6A 3APOA 1ACJA 4BGDA 3BCUA 2O5VA 3JAMA 2ZAMA 1RWMA 1DCKA 3K12A 2G0NA 3EGWA 1PG0A 3CR3C 4TVSA 1B0AA 3H1LH 1IHYA 1E6LA 3GZTB 4KO1S 1SNYA 1NS1A 5HF8A 3WGVA 5CFRA 3HCFA 2XUOA 5FBLB 1M83A 4EHNA 1HWYA 421PA 4ZCRA 2PD6A 2IH4A 2JFQA 2J4CA 1DEOA 3P9KA 3DKIA 1A5BB 1Y5MA 4KPEC 1XMOB 3U7HB 5CT5A 1KAOA 3D8NA 1YZBA 4HXEB 2ZQZA 4GPIB 3C6ZA 2WKPA 3EGVA 3MMXA 1GQYA 1FK8A 3RYCB 4D4GA 1LSOA 4YK7A 1ZUHA 2DY0A 4E70A 2C04A 2I2CA 1TW2A 3W2HA 4QVKA 4ECAA 1XDCA 3DL7A 1ESCA 2IX9A 3UFXB 2AJCA 4D0GA 4G0MA 1TYBE 2PU5A 4FOLA 3ZHZA 4GSLA 3AY3A 2ZZMA 1P2FA 5JO9A 2QRVB 4US2R 1Z4JA 4OF4A 3H2KA 1QVAA 1DKOA 2I2FA 4S1PA 3RKSA 1Z36A 4ZOCA 2QF7A 5EBMC 4OQQA 3UWSA 1IAQA 2RHTA 3ZPXA 4WLVA 4ZIRB 2AEJA 1T10A 3FWZA 3ASOB 1M2EA 3K9AA 2W0SA 1ESEA 4P3NA 1Z56C 3MIIA 5CBPA 3S2FA 2IXBA 3P0ZA 1X74A 5DHAA 4NPHA 4O4JB 1I7LA 2SHKA 4GKJO 3VMFA 1L4LA 4C2UA 2FG5A 1TRHA 1DLBA 1UAGA 4IDHA 1OT5A 1VLHA 3ZJYA 2B4YA 1W9HA 2Y66A 4EDHA 4KHPB 4LUCA 3TIXB 2UUBB 2NT4A 3HB0A 4YJDA 1OFVA 4FMDB 3P4UA 3WGGA 1L3IA 2VK8A 4W1SA 5FBHA 4DKJA 5DSTA 3A58B 3EDQA 1JJ2U 4OHCA 2H5IA 1WB8A 2A3NA 2JLSA 5DBIA 2OIGA 4NEQA 4V0KA 3RYIB 4Q6BA 2CY0A 4UU1A 2P3LA 2I76A 3V4RA 2WSLA 1TNDA 5FHRA 3GEHA 4B7UA 2K2WA 3UMSA 3QX7A 2ZYVX 1UFQA 5ARDA 5FJ4C 2V74B 2X15A 4NENA 2XUKA 4FK8A 4N5IX 1SR8A 1Q0HA 1OR8A 2GSDA 3K9SA 2ZSDA 4KFSA 5LZ9A 1AV7A 3OUSA 3I37X 5IXJA 5CLGA 3IQHX 4DJTA 2NXJA 3U9SA 4O63O 2ODQA 2OQRA 1JJIA 5KSZA 2GAIA 1L4HA 4YAFA 4PSDA 1FNCA 3MD0A 1VECA 3CNEA 1F6WA 4F56A 2Q4OA 1JEOA 3ZUGA 1SDSA 5DF1A 3PFGA 1F60A 2QI9F 4DCSA 2G1AA 4FONA 2G7MC 2HUNA 2W2TA 1YZUA 5DGTA 1GN4A 3JATA 5HKOA 3C8ZA 1Q84A 4WK4B 5EMJA 5F2NA 2VA9A 3S27A 5BORA 1MMMA 2ZYIA 3A3YA 3U4HA 1RS0A 1ID8A 4CQJA 1XEFA 3TD4A 2HMTA 3QVUA 4DLSA 3QELA 4NBTA 4WASA 1DKUA 1U99A 1NJFA 4RGQA 1RPZA 2APJA 1QGYA 3RU2A 5GONA 1X52A 3EVKA 1M34A 3GU3A 4CEIA 5LQKA 4NMWA 2FSFA 1HNWB 4Q7EA 1DQRA 3B82A 2WI8A 2ZTMA 3WX0A 5IKMA 1H4TA 5F52A 3Q10A 1GSAA 1CVLA 2PIAA 1EJBA 3WIDA 2J3EA 2W6IG 4IRUB 1GFZA 4TYMA 2A9PA 1MO6A 4BWFB 1CFJA 2GASA 2XTJA 4Q3CA 2H5EA 3FSGD 2OENG 3KYBA 4PS0A 3CUUA 3ANTA 3OEEA 3BGWA 2EFCB 2D6FA 3MWDB 1M74A 1X1DA 1CIJA 4AZ3A 1WHSA 3C7KA 3EC1A 3CPEA 2XE7A 1I5XA 4GPBA 1UMDB 1XLWA 1XRMA 3QENA 4ZZ1A 2BTEA 5K3EA 2IS4A 2YYYA 2X0EA 3TGPA 1BGXT 2IOFA 3IYLW 1YR6A 4P4SB 5K7SA 4WDQA 3KTOA 4JR2A 4J1TC 5KYUA 2VQ6A 2J41A 2IBSA 2G88A 2OWEA 4MWTA 2TSYB 2G83A 4DYHA 4ENVA 2CLIB 3D3NA 2G3YA 1VIAA 2J3KA 3N39C 3L0OA 4XM1A 2P22C 2NO0A 1PS0A 3HMQA 2NQ8A 3WSVA 2B5OA 3CMAF 4BAZA 3G2PA 2G25A 2D1YA 2XA9A 2ZREA 3G49A 4R8LA 3BAFA 3SZOA 4AQ7A 3K2QA 1UAYA 4FC6A 1R6AA 3V7UA 4EJSA 3KZNA 4HC4A 3H7IA 3D0QA 1NXQA 3T34A 3COZA 5I9TA 4HVLA 1G60A 3SZRA 1KTIA 2HF9A 1JI3A 2L69A 3LFTA 1IJBA 4JB3A 3PC2A 4UHEA 1AQJA 4FPXA 1GPWB 2YINC 1ODLA 3ILHA 4I5GA 4LCBA 4EHHA 1LNSA 2CJFA 2IZ0A 4KV9A 3BD9A 3H2IA 1TI7A 4FXOA 4QC2A 2IW3A 5G0TA 1Q57A 1C4KA 3JQ9C 4JBHA 2NTJA 3NXKA 1NRWA 1C4WA 4QJBA 4PU0A 1ZGCA 1X9HA 2JJ1G 2H18A 4DN6A 1NTKH 5KTTA 5EHGA 1G6HA 2GF2A 1TU0A 4I7ZB 1RE1A 1SZTA 3KPUA 4RGVA 4UBJA 1SQBH 3HL4A 3W2IA 4KN6A 2PGAA 2P9CA 3DTVA 1R27A 1ZRHA 2B2XA 3EMBA 4EUHA 3F4BA 2ZIAA 1GTVA 1ISSA 1KSJA 4PO1A 2CHUA 3UIEA 1M0EA 4X90A 4U8GA 1F0PA 4AXXA 5H5JA 1EFPB 5JC1A 5BUQA 2B6HA 4BT4A 5EQTA 2IPOA 2ABWA 5CVVA 5ADWA 3AHGA 1MJFA 4O2BF 1V1MB 3B12A 1PD0A 1PF7E 3D2LA 2V7UA 3ZC3A 2V3VA 4NMLA 1GTMA 4I4TB 4RGYA 1JE1A 3O85A 1HT3A 4DQKA 4Y6QA 1Q1EA 3LYBA 3S0YA 2KX7A 4HYEA 3ANNA 2C9DA 1ONIA 3NHUA 2VHCA 4YP5A 2XZLA 3F74A 3JWJA 3QPWA 4X62B 4HFRA 4OHPA 3IXQA 4MQ6A 4C4TA 2MYUA 3HN2A 4MKFA 2BR5A 1DGQA 5GM2A 5AW6A 4YJ2B 4BU0A 1RDFA 5LBUA 1ZN2A 4YT4A 4DLYA 1P1RA 4UXJA 4GI5A 2NZYA 3LNCA 5EE1A 1G8FA 1SESA 3AONB 3ZX6A 4X6YA 3LQKA 1JEYA 3DP9A 4RTNA 4QDOA 1KECA 2ZJ1A 4RD3A 4WZZA 4FI3C 2W0FC 4ZARA 3RASA 1M6YA 1PF5A 4J29A 2ODEA 4LHVA 3OTWA 4ADSG 4QGFA 4BIIA 4I1UA 2B83A 3WDLA 1WPGA 3GJ7A 3A31A 4UM5A 2MTBA 1B6RA 1MF7A 3AL2A 1MZPA 4AJIA 1XEWY 4HWGA 2A1IA 4QLOA 4JJIA 3GFVA 3RIXA 1LFDB 4CG3A 3WXMA 2ZRDA 5KNCH 2XOXA 2OAEA 4FYVA 4DTIA 2RHGB 1XJ5A 4CBCA 1WMAA 4JBXA 3F97A 1Y3AA 3U48A 1J22A 2V3WA 4NL4H 5I4IA 2CCGA 2A4MA 3ZDFA 2WEKA 4K28A 3HGTA 3K70C 5E3JA 4AWAA 5ISMA 1MSDA 2D8MA 1CEXA 4QXAA 4W5JA 4LF6B 2XNSA 4FT2A 2GSWA 3O38A 3IUBA 4ARZB 1ESNA 3SDZA 4WBSA 3H5OA 3FBAA 2LJ2A 4DKXA 2OMKA 4CF3A 3VUFA 5HOQA 1F51E 2XMDA 3W2TA 2ASVA 3F96A 1Z0KA 1WUYA 4HQRA 3O65A 4AI8A 1D9XA 2RHJA 1ZH2A 4QUBA 5EY5B 2DFPA 2WZBA 2X19A 3ONDA 3VTKA 1S8FA 3H9VA 1Q1GA 5CBKA 5DASA 1S2DA 3FAVA 4LZNA 3R6LA 4PO3X 5D51S 1XEQA 3BL8A 5D85A 1Y7IA 3A6JA 3CINA 2Z5FA 3AQIA 1YJAA 1KAMA 2Q41A 3E7DA 4JBWA 3I56F 1FRVA 1SCUB 5HKBA 4PX5A 1OH5A 4BKQA 4R7GA 3C4JA 3HR0A 2QV7A 5GJWC 3QTYA 3UWKA 4UCXA 4V02A 3RC9A 1L9KA 4HBZA 1N6NA 2I4TA 4IF6A 2PUDA 5IC5A 4FZJA 3TLJA 4ZT7A 4I66A 2HG5C 1IQPA 1ZI6A 3WYDA 2IJHA 2HWWA 3TOVA 2IRWA 4RSRA 1X7XA 3HO1A 3F3KA 3ZZNA 2BGKA 4MV7A 2FWJA 4ZYYA 2ZDHA 3CRNA 2PFGA 2W6IA 3QKWA 2NPOA 4F1KA 4URZR 1L7XA 3NASA 1W0KD 2XA2A 4ZOLF 3TUZC 2UYHA 4NCIA 4X8MA 4WZBB 2IHUA 2AG8A 3HXPA 2VGNA 3ZS9A 1M3SA 2UXNA 1GJRA 1YZLA 3ENKA 1F8UA 3U1VA 1RSOB 4TOIA 2VDWA 4QAJA 1OU0A 2FZ5A 1HY3A 3RWMB 1OQAA 1QFJA 5T3UA 5B7GA 3T99A 5C4IA 1M2KA 2BMAA 3DWIA 3PICA 1MC5A 4ZOQI 3QHAA 4K9MA 3IAHA 3PR3A 2ZSKA 4JLOA 3BSWA 4YBZA 3U0VA 4FILA 3UPUA 2NT3A 2W2VA 2LKCA 2NPIA 2BKVA 4Q34A 2JIDA 1Z2CA 3SVLA 3RN4A 4CVNA 1FJXA 4IGKA 5F1OA 3HO8A 4LSMA 4I8IA 3SICE 3PCRB 1ZCZA 1KWKA 3C3XA 3F7VC 4Z0NA 4G0QA 5KJEA 5FNVA 4DV4O 3K0TA 3FHTA 3OCUA 4CI0B 2YYAA 2AWNA 1Z82A 2F1KA 4PAMA 2YMLA 3HFGA 2PGJA 2RKBA 1RQ2A 5CDGA 5BQPA 4GW3A 3STZC 3CC2F 1G291 3GX1A 3A7EA 5L40A 4MS3A 1BWQA 4JXJA 4LY0A 5ALXA 2XQGA 4XWGA 5B3KA 5K51A 3LFOA 3ZKAA 1Z68A 3FOBA 2X0IA 3M3PA 2JCXA 1E0AA 3SVZA 2WF8A 1BRTA 2KSQA 1H2ZA 2JJ1A 5FFMA 4DA9A 1J70A 1C7RA 3OETA 4AMGA 5JDCC 2XGGA 2PNJA 1QCCA 4JJ8A 3UTDA 1X7GA 1SHKA 4PQEA 2OBLA 4HATA 3DE4X 2E6KA 3H2YA 1R4ZA 3NT4A 4GMDA 2I6TA 3LMKA 1YDXA 3ER8A 2WU3A 1TYZA 1EWRA 2E5WA 1Y6RA 1AVMA 5E1DA 5AFSA 3LQ2A 1U8XX 3C7AA 3UMVA 2WLSA 3A3NA 2I3AA 1EB8A 1PLKA 4F0JA 1YU9A 2WJHA 3JVUA 3QNEA 4CLRB 2ZIXB 1Y3BE 3ORFA 4B3HA 3JW8A 1MX3A 3V1KA 2BCEA 5HFNA 3VSDA 1EU1A 1TKAA 1C9DB 3SQOA 1UDBA 1QNFA 3IAUA 4CL3A 5DNCA 1Z4MA 2CV2A 2VJCA 1M6VA 3GLFA 3O1JC 3IIKA 3ICEA 3AUJB 4ARIA 1J00A 5JEDA 1E64A 2L2QA 4DCTA 4I55F 3O8QB 1P1JA 1ZD1A 1GZ4A 4PZAA 2WU4A 3ZV4A 4NZPA 4HLUC 3H5RA 4H33A 1IIBA 1Y67A 3FCCA 2QK4A 5CBPB 1AQYA 1V95A 1DELA 4WY8A 2EBHX 4Q39A 2R1ZA 2YTZA 5LIRA 1JECA 1T2AA 5H6QA 3VMFB 2PBLA 1IN5A 4F8JA 3WNDA 4ZFNA 2VPWA 5EJ5A 4H0LB 3N8NA 2ZJ4A 3SR4A 1I5YA 5DEIA 2FWNA 4JAUA 2XZOA 4RK5A 4TMTA 2V8BA 2J48A 3GJXC 3MLBA 3VZBA 2VWGA 3V4ZA 4BJ3A 3TXSA 2X1MA 3URKA 2VK1A 1QZXA 2AKAB 4D9IA 3RAGA 2X0LA 4L8GA 4CMEC 1ZIOA 2ST1A 4FFLA 3GJYA 1JKXA 3LXXA 2Y1CA 1YQ9A 3ZRVA 3GLHA 3KKQA 4U0KA 4NENB 3RIHA 2ZDIA 3NT2A 3PQFA 2RH9B 1WVIA 3D36A 4YN3A 3KJJA 1ZXXA 1Z47A 5FUWA 4OHBA 1I8TA 1KI6B 1M5TA 4D9BA 4J41A 4B7EA 2X0NA 2ZRKA 5DNYB 4Q9KA 2QJFA 5B7NA 2XMZA 4Z3DA 1YA8A 3B70A 2XMQA 2C5SA 2AX3A 5FI1B 3WC4A 3ZVLA 2XF2A 2I7DA 4DRXB 4I7EA 1GDDA 1WAMA 1Z7BA 3PE6A 2RG7A 2NNUA 1EZ1A 1GAEO 1VGQA 5MF6A 4N4AA 1FTNA 4NUTA 2DMXA 1T3HA 2TECE 3U7GA 4WD3A 4FYJA 3AKEA 2XRZA 1QGDA 4F7WA 3D8TA 1P73A 1OAOA 1Q44A 4MQMA 2OL4A 5JMOA 3CCLV 2ECPA 3N8KA 2FGKA 2PZSA 2VEOA 1PGPA 3V8RA 3QELB 4GGPA 2O8CA 2V59A 1EBUA 1XBTA 4EEZA 3MJSA 5LJIA 3MA0A 2VDKB 1U0OC 4P4UA 3LZ6A 5GONB 4OGQB 3RTBA 4OYHA 1M34B 3GY0A 4XVUA 3L73H 3B9PA 4I81A 1TCUA 2IG8A 2HZ7A 1E2HA 4DF3A 5CCBA 1ZM7A 4DDKA 1ZH4A 3VM6A 2TRSB 3D8RA 3H5VA 4WF9V 4LPKA 4TQDA 4KPUB 5AVJA 1J9ZA 4RF2A 4BX2A 4NB5A 4LXQA 3U7RA 5KQGA 4ID3A 3QTLA 2K6GA 4N7MA 1XCOA 2G36A 2OP0A 4O4JF 1QRRA 1UFKA 1XMQO 1ZIXA 2G06A 3LBAA 3RBZA 5COBA 3HBAA 3TI7A 2ZKOA 5F9FA 4IGEA 1RKUA 3EAFA 2Y2UA 4AZ3B 2NUAB 2X7RB 1J42A 2W9XA 2RAPA 1R0XA 2AN3A 4IJUA 3QKSB 2DBRA 4H15A 4FMDF 3EAGA 1DBWA 4F9TA 1L4YA 3BWMA 3QEOA 3OZCA 3NDIA 3KXIA 1DC5A 1YKSA 3IVMA 4LJ8A 5FWDA 3HTXA 5H9CA 2V0NA 5KYUB 1H2NA 5FV4A 2ZPTX 4FNGA 4JNKA 4R54A 4IINA 3NUGA 2ZR3A 1QJ4A 2PGLA 2NVOA 3EQ8A 1KU6A 2A5FA 5KTSA 2EIMC 2QI2A 3TIIA 4Q02A 4HN9A 3S3TA 5T8KA 5D7BA 4BOYA 2YQ5A 1PT7A 4L5CA 3ZE9A 3LGXA 2ZM6B 3X2SA 2W6QA 1H66A 4EJSB 3STYA 2D5AA 2GBLA 3MCAA 1P6UA 2I4IA 2DFNA 2WMYA 3OECA 1JOYA 4RS4A 4UTOA 3MB8A 4JJEA 1WG8A 5KNDA 1QIHA 1K7CA 3Q9UA 3GA7A 5F4ZA 4EYQA 1MMFB 1WL8A 1PHPA 4JJKA 2NUBA 4AIRA 4RIGA 4OFBA 3L8MA 3GCWA 4PLHA 4J10A 5K6AA 2EZ9A 3QBVA 1JAYA 3ZTTA 1FQWA 4CMAA 3LT0A 4GX1A 3EVTA 2M6YA 5EERA 1UWKA 5HZHA 3SJZA 2VQSA 3M8KA 3PQDA 2P9FA 1JXQA 3G0BA 1WPRA 1TZJA 2XTNA 2FZKA 4V1CI 1D2HA 3IQIX 4FHZA 3COJA 1V5WA 1WLYA 2RAFA 1NUUA 1NUSA 3HUDA 2KI5A 3RTAA 2XNHA 4TV9B 2J9RA 4M1TA 4YRCA 2YZMA 5CFMA 4EPYA 2RONA 2NAPA 4OFXA 3NZEA 4QNRA 4R2JA 2I6UA 1PV4A 2OQVA 1SHJA 2IHYA 2AXEA 4XPZA 3TXYA 2DQYA 5C1OA 5J3JA 2B1JA 1E2LA 3MOGA 4XD7D 3JSXA 4DPMA 1BU8A 3FRHA 5L6MB 1YNOA 2UYKA 2QUJA 3KZ1E 1RR6A 1SEVA 1PL8A 3I04M 4DK0A 821PA 1Z5PA 4Z8XA 3N75A 1T4CB 1JBQA 1OZAA 4L3WA 2V1DA 2VXCA 1UEXC 1IHXA 2JRLA 3K0KA 1JJAA 1VB5A 2UU9B 3PU6A 1E77A 4K0KB 4FGWA 2Z3ZA 1BG6A 1GN2A 3TCUA 2CLCX 4QE9A 5KCZA 3NCHA 3RSHA 4ICGA 2BRUC 2H1VA 1G0NA 2WHPA 3VBEA 4TVOA 3HJBA 3TX6A 4RQTA 1W88A 1NBMD 1JEYB 2P9GA 1I08A 2C9YA 3CNQS 4Y1RB 3ZR4B 1YL7A 4D4HA 5E8RA 3T7AA 2YUTA 2JFBA 2PRZA 1YL5A 3OFNG 2OFPA 4JT2A 4RHYA 2QXYA 4RW0A 1U9JA 3B3FA 1YRAA 3GQVA 1VF5B 3IBFA 4BHTA 4BX9A 2H7VA 1DTOA 3YASA 3ZCQA 2XR1A 3AK2A 3RU7A 1FYDA 3WXMB 4RDXA 4PXSA 4CCAA 1RFLA 3IT0A 2E4XA 1ZESA 1NBEA 3BCSA 5AK4A 1OF1A 4G4SO 1XMXA 2HTEA 5B36A 2BLLA 2ET6A 2OZPA 5K8IA 3DDWA 4EY3A 3NM5A 1J1IA 3PC8A 1MP0A 1G8GA 3ADCA 3Q6MA 5ALEA 1ZD2P 2OZLA 3L0PA 2FSHA 3USES 4IUYA 1XHEA 3H8VA 1YS7A 1VSTA 1VLVA 5IH3A 1EA5A 2HX0A 4J90A 1XRRA 2GLXA 1APBA 3A4NA 1KKMA 2PGNA 5ELMA 3QRWA 3KQLA 1R0SA 1EG2A 1ES9A 1YVPA 1DAFA 1KBOA 1ZH8A 3WYCA 4U9UA 3CKKA 1LU9A 1ZOPA 3CC8A 2QZ9A 5IXYA 1AK9A 1M7GA 4DXWA 1WBBA 1O5TA 1OW3B 1OUMA 4AF8A 4DYDA 2OEPA 1CEQA 2WIAA 1FNNA 3PGVA 3EPLA 2WWGA 4I4TF 1SPXA 1JFRA 1OZ0A 3RJZA 2BJVA 3FPIA 2HL6A 3GTZA 3DGEA 2VHQA 2IXDA 4PIPA 3OX4A 1L7AA 2XCUA 1GO3F 1STOA 2WYIA 5KYYA 5IHXA 2IYWA 3EXHC 1F0YA 2PK3A 2G9NA 1ISGA 4AMBA 2BEUB 1VCHA 3L4KA 5FLXM 4D6YA 4CDRA 1SEPA 5J47A 1YR2A 3NEPX 1IZ0A 1QLWA 1XNRB 3KZIZ 1IQ0A 5IVHA 1XZEA 2Y1OA 5K09A 2UDPA 1IZ3A 2HSGA 1XR3A 1JIQA 1Q81W 4FX5A 1E0SA 3L1JA 3AXSA 2WPNA 3GWGA 4IXWA 4FMPA 4LTMA 3R0XA 3BX1A 1M0WA 4DJFC 1XDBA 3LY7A 2PO5A 4E07A 2JK5C 1IL0A 3W9SA 4MQBA 1SKQA 3BT7A 5E1AC 4WK0B 4AZ0A 5KQLA 2WZDA 3D81A 2B61A 1YUNA 3T7DA 3AGKA 1BIFA 1CR6A 4Z9AA 3U4DA 5FQOA 3M5CA 3QXGA 3BA9A 2FP3A 4J1NA 1KY4A 1JQ3A 4CRWB 2CE7A 2HIGA 2BFOA 2J33A 1CEYA 2I6GA 3VDNB 2N46A 1KL7A 2QS9A 4V3CA 1XZLA 3VU9A 2ZVDA 1OXTA 1C0EA 2ALJA 2Y0BA 3HQ4O 4DCUA 2IYEA 1ZUWA 2PKQP 1XL0A 4E2XA 4G0OA 4DT1B 4FGJA 3MELA 3KYJB 4KO2S 1U31A 4C9BA 5AMXA 1RT9A 1M8PA 1VJ0A 2YWHA 4HAZA 1XI2A 3R7NA 1ZVJA 5CBFA 1GGNA 3UMJA 4PDRA 3BMNB 5AKEA 1CDDA 4WHMA 5FNVB 1MB4A 3IESA 1Q19A 2PRIA 4AWBA 4WBNB 1XNQB 4J0JA 3AYXB 4RS3A 4P9OA 4YJFB 1A77A 3KHUA 3ER9A 2G5PA 4CEHB 2V1XA 3PEVA 3CG6A 4MS3B 4W1PA 4HRYA 1DRUA 3G88A 3GVCA 1LUAA 3L6CA 1KMHA 5GINC 4PG7A 2IJGX 3JCUZ 2M9MA 4PHGA 3H01A 1PV2A 4QYMA 2I87A 3I2FA 4JXXA 3STVA 1NNEA 3I5MA 3ZS8C 1H5QA 4OXXA 5AKJA 2EP5A 2H8GA 5TMBA 4PCLA 2FX3A 4U2KA 3ZHOA 1QOQB 3RADC 1DKNA 1D04A 3WB9A 4JWKA 1MH9A 3LKDA 3DLAA 4P0PB 4LF8B 5AKLA 3I5DA 1J6UA 1P0QA 3DG9A 5B58T 5F76A 3A06A 4B4KA 4AUKA 4JR1A 4X63A 3JQRA 3OT4A 3QF4A 1O6GA 4O2LA 1X94A 3O92A 1GNVA 5F12A 1QZTA 1XROA 3M2TA 3TAUA 5C18A 4YCAA 3NMUC 2HCRA 3OFKA 3QOFA 3PKZA 4EDFA 2X2PA 1ZSPA 5C8YB 2F43G 1LQTA 3CB4A 1SQ0A 2PL1A 1P0PA 4B17A 4YT2A 1Y4MA 1KYIA 1XTSA 2O57A 1AOXA 2W70A 2Q3DA 4YMLA 2E48A 4KOAA 2ZUWA 4YR9A 4ETMA 3E3MA 1MAWA 2FB9A 4OX9Y 1A8HA 2ZAIA 1A8SA 3AK1A 4DLWA 4QDZA 3ET5A 2O8EB 1QO9A 3T2MA 1K2WA 4IP0A 4G5OA 4PELA 1NKSA 1T9KA 4YCDA 1M6VB 4E5UA 3ZQUA 4OJNA 3SMVA 5EXXA 3VSEA 3B51X 3B78A 3MINA 2PZAA 4KAAA 4D8UA 2X0JA 3B9BA 3U19A 3BWDD 2OTJV 3K16A 1OY1A 4GDMA 4MI1A 1FSGA 3L1KA 3TRKA 5FL7G 2V6FA 6PFKA 3NDRA 4CS3A 5A06A 4OGGA 1EX1A 3CWQA 1FRFS 4DC1A 3HBLA 2FSVA 4BBPA 3S1AB 3FX7A 4TTJA 5TE9A 2H57A 5LZ8A 4G89A 4GSYA 2VQDA 2ID9A 3W4JA 1R6TA 3L02A 5I7RA 1QK5A 2W37A 3N0RA 3DW3X 1KHTA 1P33A 5JRDS 4CQMA 1QF9A 2O7RA 3GP8A 3HPRA 4Q1BA 4JI4O 4B83A 2QTWB 4YJHB 3W5IA 4YCBA 1GOTA 2GZAA 5LMUB 3RVRA 1YBAA 1Z2PX 1V8ZA 2DJVA 1KQSU 4Q24A 1QPGA 3W7VA 5FULA 4C6TA 2UYJA 2I3ZA 1FAFA 1Q3HA 2Z2XA 1BDJA 2PVCA 4H6XA 3I9FA 5M7EA 1D5NA 3ZN0A 3OQNA 1MC1A 2V1UA 4PWYA 4MWGA 3KOMA 4DSUA 2AOTA 4OFWA 1T5OA 3PXUA 5E4TA 4P30A 1W1IA 4JOQA 1OCZC 4JVMA 4A91A 3ZEAA 5CHYA 4EHDA 3ZVNA 1E5TA 2B9EA 3JQ7A 5EP1A 2D5LA 2XPCA 1B1CA 4LOKA 3X1XA 4F8EA 3NVKE 4DV0O 5KX5F 1M2JA 4CG1A 1SWVA 3C3CA 1PZHA 4YT5A 2QTVB 1FFXA 1U8ZA 3E2EA 3HVHA 4TRMA 1CQZA 1RXUA 3ELBA 1RPTA 4KMRA 3OIFA 1CQWA 4J6FA 2O8CB 4KLAA 4V24A 1NULA 3A8TA 4ZXPA 1XMJA 2YIBA 4P53A 2WHYA 1IM2A 1WF3A 3IALA 3HJWC 4N49A 2GEVA 4RLSA 4H31A 5IMBA 4IS3A 1N9KA 5ERYA 3I6ZA 3H04A 3NPMA 4LRXA 3DH0A 2ZRIA 4BW5A 5TEVA 3D1JA 2YZGA 3OIWA 1E89A 1K8XB 2EL7A 3B1FA 1A9QA 1P17A 4PG6A 3DC5A 1ATIA 2DMRA 2CKMA 4DR1O 3W06A 4GL4A 1ZCAA 2BT4A 4B3CA 4C0BA 4EUKA 3S0HA 1DWPA 2CF6A 2WZQA 1KYYA 4NP6A 2L35A 2GJ8A 2Z6UA 4L8YA 3I2YX 4KBYA 1PEYA 4ZTBA 5K9ZA 3LWDA 4HXFB 1L7VC 2V7EA 3T0GA 1H9AA 4LX8A 1IBKB 4OL9A 2RJ3A 1JSLA 4Q9IA 3AESA 4Q4CA 5HZKA 1TADA 2WJIA 5ICCA 4QREA 5EINA 4X24A 3OIGA 2W6JA 3GUZA 5IP5A 2BFCA 3FW1A 1SQGA 5ITWA 1ZI9A 1P5ZB 1MB0A 2QRPA 1C3VA 3V1YA 1U2DA 3ND7A 1DT9A 5TGTA 1DJPA 2QTBA 3AW8A 4GF5A 4LOLA 2BBTA 1W36D 4JV5B 1F1JA 4IZIA 4PAGA 3TECE 1KO8A 2JANA 5LQAA 5HIIA 1UAAA 4M0DA 2YIVX 3GBVA 5CBHA 4EG3A 4UARA 3C16C 3WLPA 2C98A 4I2NA 2HHHO 4KLRA 1YS6A 4E4YA 7MDHA 3B85A 3GDHA 1OBFO 3U44B 3KP1A 1YB7A 5HFMA 3AEYA 1U8UA 5JZ9A 4WLNA 1QAQA 5FI5A 4I5SA 1U40A 1D2MA 1SPBS 4H7PA 3IFSA 1G59A 4L8VA 3W7XA 4C5BA 2BLNA 1TJYA 3D31A 4B47A 1FUEA 3KALA 3OT1B 3T7TA 2QLJA 3KB8A 1WXXA 4JVLA 3LX4A 4BNUA 2CJWA 4IICA 1PP9H 4RSHA 4WFIA 2W2XA 2B98A 1ENZA 3ORSA 2HQSC 2ZJAA 4EQZA 4JLJA 2F1RA 3AF5A 4RQBA 4EO4A 3M6MD 3UGTA 3ZWDA 2GXUA 3D5EA 1RP1A 1RZVA 4YPVA 2W58A 3PPIA 1AI5A 4DY4A 3JYNA 2XRFA 4RMNA 1V71A 4KPFC 1U1EA 1YZQA 5EKXA 4FUQA 4HXGA 4OIMA 4I9UA 1NMYA 1U9IC 2OLJA 3ZCSA 2OSBA 4UNNA 4YASA 3A2MA 1A95A 4FD2A 4LBWA 4NZOA 2QYOA 1BE6A 3N6VA 1KO7A 1GZHB 2Q1YA 3DWGA 3G9QA 4I5FA 3CZ5A 4B0PA 4FR5A 3BRSA 5MDHA 2BKUA 3E5HA 3ZOKA 5ES4B 4BC0A 4L57A 2RCYA 4D80A 4JCCA 4BNGA 2Q5FA 3A3PA 1PK7A 2C4KA 2DERA 1YQUA 3NC1C 3UBTA 5HNKA 1YRQA 1NHGA 3E5MA 1PYOA 2ID7A 4XR4A 5FA5A 3FHLA 4K1LA 3OLWA 1K08A 4NQRA 2GD1O 1K4DC 4D9HA 2F43A 2WA4A 4C76A 2B9ZA 4NV0A 1K5SA 2AG1A 4X1IA 4HNUA 3SDBA 1F4NA 1YE5A 2ZNIA 5FWNA 4MR8B 3HPQA 4C2AA 1SCNE 5CDUA 1PR4A 3CD6F 5GW7A 3Q0IA 1VZ3A 3NDPA 4YI5A 5K6TA 2Q6OA 1GN3A 3DOFA 2J6HA 1E1LA 2WHPB 3IE0A 3W7UA 1ZISA 1SHLA 4R1PA 1W88B 1DC3A 2XT9A 4PG8A 1NWHA 3ZEDA 4EIWA 4CKXA 2F4NA 2O2IA 1PX2A 3HCEA 1OLUA 2ZUFA 4WKOA 2M7WA 4UVBA 3WLMA 1B6SA 1B14A 3VR1A 3UY4A 1R10A 5J5VA 5FL7A 5ALLA 3GYQA 5HRAA 3SXUA 1YAHA 5DYNA 4I9FA 1RWBA 1O0BA 4X97A 4LNUA 1BE8A 1T1RA 2OO3A 1HOTA 3SYRA 4M1QA 4ESVA 2BEWB 3NUQA 3X2FA 4IDBA 1M57B 4CM1A 1KY3A 2B2NA 1T0IA 2W43A 4U7WA 1GZUA 1GPJA 3BM5A 3ASZA 1J5PA 1KDRA 4NIMA 3VPHA 1XNHA 4CM9D 3FROA 2PKCA 1GSOA 4ID9A 1VK3A 4C29A 3RGBA 1DDIA 3S7TA 1L6RA 1WXDA 5KAFZ 2PIDA 2GYYA 2OZLB 2C96A 2JFYA 4YMUA 4YDRA 1J0EA 2A57A 3UMFA 1JWLA 2OT5A 2VTBA 1X1RA 1PJ4A 2BELA 621PA 2PI5A 3UGQA 1VIMA 3WGHA 4TV9F 1ODKA 2FF7A 3PA8A 4HDCA 1BMQA 2A86A 1YITF 2PRJA 1ZKDA 1HF3A 5IM5A 4KR0A 4FNAA 1JB9A 4WZ6A 5BN3A 1J2RA 4UCVA 3I2IA 5KNBH 3I30X 4HOYA 4HTAA 4KZKA 3RR2A 3B3JA 4BZQA 1RRVA 2Q4RA 2E87A 4MTCA 2DQSA 2BKAA 1KI3A 2HA6A 2GTHA 2F67A 4LKOA 2JFVA 2RGDA 4UD6A 3T3GA 1KYTA 1MG5A 4GOND 3EFFK 3VR4H 3DLCA 1GFWA 5K0ZA 1FXVA 4ZPXA 3R8FA 1H0RA 3P9PA 2Q7HA 1X92A 1L4NA 2CXRA 2GXSA 1UKEA 1IH8A 4E0BA 3T41A 4ONEA 4HXYA 3C3TA 4AZWA 4KPGA 1YACA 3V6LA 5EFZA 4GM0A 3PZBA 2AMYA 3RTGA 3D8CA 2H6EA 5H68A 3SBDA 3TWOA 2UZ4A 5GPBA 1K3FA 3KR0A 5HJ5A 1YI8A 4GD3Q 2PZ8A 2QPTA 1I13A 3R6WA 4P9PA 4I36A 1PDVA 1UC9A 1P5JA 1WABA 2MCFA 5B8FA 1N1EA 3QE0A 3T9AA 4OJTA 4XBFA 3BTSA 1IJKA 3BMXA 2EZ8A 3AO0B 1FLAA 1LBEA 3KEFA 2QUZA 3PFWO 4CF6A 2MQEA 2AG6A 2DH5A 3UT6A 2NO7A 4BFZA 3VKHA 2FFQA 1L3BA 1KNXA 2WYWA 1VHWA 3CVYA 3T4PA 1R1BA 3R9IA 1CYEA 2Y1GA 2NQ2C 4H0NA 1J39A 2BFBB 3ESCA 3FAZA 2I55A 1Y1LA 2ZBRA 1KMMA 1RAIA 3N3BC 2QSAA 3F5QA 2G7ZA 3SEQA 2XE8A 2E3JA 2ORED 3IOEA 4PWZA 2I62A 1MIOA 1TK9A 2QRHA 3V7EA 1X86B 1D2CA 3L4EA 1QDEA 2X6QA 5A0FA 2C2OA 3FMOB 5A0VA 2YJNA 2OLEA 3KKPA 4EJ6A 4NR1A 4FYWA 2Q2WA 3P9CA 1E32A 1E79A 2BE7A 4Q1FA 4F3NA 3RVBA 3GJZA 2WP8J 1M66A 1VQKF 1PNTA 3LP8A 1QK4A 3GVXA 1GUYA 3ESXA 5A5GA 4II2A 2XZPA 3N1UA 2DEUA 4WFBV 1EINA 1ZMXA 4KMSA 2ZT6A 1SQPH 1JQAA 4QT0A 1ZRNA 4MQ5A 3BGDA 2AMVA 2ZBDA 2WSIA 1PFVA 3S99A 1PLJA 1VHAA 2O05A 2R7NA 3ZBQA 4YR7A 2V03A 3HB4X 2XMRA 1XXHE 4YAKA 1CJCA 3RT9A 4JI6O 5FUXA 3R0QA 3A4VA 3VAAA 3CT6A 3HKCB 3CFYA 5L3GA 3DE0X 3C6BA 4WFEA 3AJRA 1SXJA 1U3CA 2Q6LA 5KWIA 2QTAA 4RAIA 3NB0A 4F5ZA 2COKA 4P9NA 5SY9A 3FJ1A 3LUTB 4OXRA 5D1NA 2VYCA 5FWXB 4LXIA 1UBNA 4JQZA 4P82A 4WOBA 3LP5A 5FA6A 2P6UA 1JHMA 2ZBGA 1O4WA 5KZMB 1E5XA 2ZD9A 3DNMA 4MP6A 2O7QA 3FB4A 2LCAA 1QIMA 5ECYA 4M21A 1CQJB 3ETJA 2PM8A 4WXEA 1IURA 3T1YB 3GEGA 3QF4B 3HK2A 2JGIA 2C7OA 4B4DA 2AR7A 1Q15A 3ZUPA 3KVYA 3KTFA 3E4DA 1KVTA 4K8XA 1JIUA 1Q22A 1ZWKA 1ZJJA 1KFJB 3SHOA 4HMQA 4WPGA 2FVXA 4UCQA 4RANA 2HU5A 5IDVA 3JD2A 1V5IA 3BE5A 3M1LA 2ZE6A 5CLHA 3INNA 2K1SA 4E4RA 2R8OA 3S2SA 2W22A 2FWRA 1MB2A 5HDBB 1QV7A 3ACDA 3O8NA 2NO1A 4QBIA 1R88A 3CU5A 3DV2A 3MYRA 4WNYA 4KXQA 4LBVA 4QOHA 4LRWA 3SHQA 3VR2A 3Q12A 3ZV7A 4H44B 2FK7A 1XPUA 1M2VA 2ZJ8A 1UOOA 5AXDA 3L06A 1EBFA 1E2FA 1XBLA 4ZVQA 1X7ZA 2X86A 4MYHA 3WQSB 1NF3A 3RQSA 2QLFA 1WJGA 4K6MA 4URWR 2V6JA 2GJKA 3BJEA 1KORA 2O0JA 1EFCA 2F9FA 4JD5A 2D1SA 2O50A 4EENA 1QE5A 3BFPA 3CRMA 4O0MA 1NUPA 1E20A 4LQDA 2N05A 3OMLA 3SBXA 3IUSA 4IEEA 3J7AR 4OKSA 2JFOA 3THSA 4YGYA 1N3LA 4MT8A 5FNVF 3ILYA 3OPNA 4WBNF 1D4AA 4HPJB 4H60A 3G8BA 3T4XA 2VWKA 4RY0A 3WQRA 2OHFA 3ASVA 5LZ2A 4S04A 4CEJA 1MG0A 2DE0X 2DBYA 3QV1A 2Z1MA 4BLSA 1USGA 2BI8A 1DGSA 3EC7A 3WWCA 4QSHA 5GWXA 3AKZA 4YRLA 3THYB 1MC4A 1Y8CA 2IV7A 2DPXA 3GLFE 3TR0A 3CONA 2Y2VA 3B20A 1ZM2A 2C5EA 1E3MA 5KREA 2ZS7A 3TD2A 1H1LB 3N6RA 2E85A 1KETA 3N2IA 3TJMA 3DZDA 1E0DA 4C6TB 1D2NA 3DOHA 5BWNA 3IAS6 1XZNA 5A9TA 1L1EA 3E20B 3CEJA 3LBIA 4QE3A 2XWQA 2YEVB 5I5GA 2VYNA 2FEOA 2MINA 2OB2A 4MVJH 4E08A 1JQLB 2HC9A 5KOHB 2YIJA 2YUIA 1RHJA 4HAWA 3H4MA 2R7AA 1EK1A 3RABA 4HX5A 3H5WA 1FFAA 3A1CA 2YXZA 1YJNV 2ZRMA 2VSQA 3P9YA 4HAXA 1NMQA 2XMBA 3LHSA 5P8WA 3JQ7B 5EIFA 1GTSA 1YQDA 2DOKA 5EKDA 5C8YF 2ZYTX 4IGAA 1ZFNA 1JLLB 5GAJA 4XLLA 1W52X 1BKSB 3K0BA 3C3WA 1BNCA 3B8EA 3CCRV 2OT3B 3CCSF 2FPIB 2G1PA 1CDOA 4RULA 4P22A 3PUHA 2QQ0A 3PSHA 2BGIA 1DX4A 4PAQA 3ED1A 1CUYA 2UXBO 1CRLA 3ZVRA 3GLHE 3KXKA 1FZTA 4CMJA 1DMSA 4J3FA 5LB4A 4H27A 3AVYA 1XXHA 3BKWA 1P3JA 1FLDA 2JGKA 4DPKA 1K5QA 1QFSA 3NVIB 3K8YA 3N2ZB 3GDOA 2X9LA 4D42A 1KGDA 1T1IA 1E2EA 2O7SA 5D84A 3WJ1A 4YMGA 1E4EA 2QTOA 5IAAA 2VH5R 4K9OA 4G41A 2NYRA 1AZWA 4TRJA 4YXWD 4GBED 3M6XA 5ADHA 3A6HA 3U9TA 1ZNXA 3OLVA 3GP5A 2NACA 3B2EA 4JODA 3W2GA 2H07A 4NEHB 1F23A 4K7JA 4KTVE 3VR5A 3AUXA 4WESA 2JLBA 3KZVA 4LGCA 4UE6A 3OLZA 4LC0A 1ETUA 3D8BA 5GAPK 4JT8A 1VHQA 1VQ7F 4KWHA 3W9UA 4X65O 2MU1A 2QAIA 8AT1A 4H17A 4LHWA 1A5ZA 3JQGA 3CMAV 5LD2C 3ECAA 3P2MA 1PJTA 4IFBA 2VGMA 2Q50A 3C8UA 1JA0A 2YVKA 2YS7A 1AHHA 1CW2B 4ND6A 1L4UA 4TTVA 4HH4A 3VV3A 5CXSA 1IPAA 4LJKA 4JEHA 1ND6A 3PTLA 4KMOA 1EFDN 2H5JA 5A3SA 7YASA 3KL4A 4Y98A 3ZCTA 1Q5PA 2RMKA 3I04A 2Y3IA 1U7UA 2H1FA 3CSXA 3CLHA 3CNHA 1N25A 5DNEA 1L4MA 1TJNA 4Q66C 1XTRA 4IJWA 2PRSA 1JSXA 1K33A 2JI9A 1BC5A 4CMBA 4TV8B 3CEHA 2OORC 4GUNA 5I48A 2GK4A 4HB3A 2J7PA 1BMFD 1Q11A 3E8XA 2CW5A 5K5EA 1EI9A 1FEZA 1ZIPA 2V7QD 2DU8A 3IXLA 3MPOA 4UCUA 1AP6A 3MTDA 3SYPA 5AW8A 1KP9A 4G5GA 2CJXA 1QIJA 3C6XA 1AMUA 2NMVA 2Z5UA 4RZ2A 4YRZA 3RAJA 2CYBA 2WPDG 2YC4C 2DQZA 2J31A 2GAFA 3HLYA 1GNRA 4HDNA 3WFJA 2A35A 1PAUA 4HUTA 1ZHFA 2PX0A 3ER6A 4EK9A 5LDHA 4RD4A 1NVVR 5MN4A 1CETA 2HHJA 3VQWA 4R8KA 3GLRA 1WOYA 1FSPA 1VCOA 5DULA 2CSUA 1I7PA 3Q98A 4YROA 4A8TA 5B2FA 2ON6A 4YCLA 3RB8A 3L4JA 5CM9C 5L51A 1DIAA 3I72A 1RA4A 2E55A 4S05A 4KXYA 2XODA 1T8UA 1T3TA 1I6MA 3GHHA 2R97A 5ARBA 2LQTA 2YIAA 1PW7A 3HU2A 5KAPA 3O9OA 1UL1X 5FKJA 4RCYA 1GPBA 2JHCA 1H22A 3K5IA 1TM3E 4E5PA 1NX6A 4MWSA 2ZWMA 1C30A 1ND5A 1NUQA 4LI0A 3W3AD 1CY4A 1Y66A 2GUWA 4DMGA 1T8PA 3K70D 3QJGA 2JI6A 1QZZA 1ZAYA 1L8DA 3K72B 2O2EA 4BEVA 2ZANA 2OILA 4MRAA 5FHQA 5JDIC 1N4CA 4PZYA 5IT4A 1A9SA 1U7OA 2HLDD 2E21A 2QN8A 2AT1A 1W5SA 2VSXA 1UJMA 3ANYB 4C87A 4B33A 5JEEA 3R65A 3TK1A 2E18A 3ND9A 3ZH2A 2E76B 3KAKA 1TK3A 2VBFA 1FVOA 2B69A 2XQJA 3OQ6A 4K87A 2ECOA 4YA6A 3V4SA 1XK6A 3LSSA 2IBMA 1BN7A 3J80N 4ZEOA 3W7WA 2PTGA 1JJ7A 5L4SA 1Z7EA 4X1IB 4PDLA 1NVWQ 2ZIGA 2ZJ2A 1ACMA 4U7HA 3AHHA 3WGTA 4D8TA 1XRGA 2BFFA 1XALA 1F7VA 1E1RG 5GIPC 3UMGA 5IAOA 2ZRFA 4OK5A 3H6KA 3BQNB 3HPLC 3NEYA 2GQ0A 3K15A 1RXVA 5AQ1A 4CV3A 3ZI7A 1IU9A 3CPQA 5K0EA 1LW7A 1VMEA 2IS1A 2PXXA 2Z83A 1YTLA 4C2TA 1OLUB 3ZY2A 4QJ3A 1S1CA 3EVCA 1VKJA 2VCHA 3QG5A 1EUZA 5K0BA 4J42A 3DHEA 3GR6A 5FLXA 1HM5A 2W0MA 4AS2A 3WLAA 2QBYA 4O1IA 5F78A 4LNUB 3UM7A 3A4YA 4YNBA 4LFAO 4EBFA 4J03A 3E82A 3B8HA 3H9GA 1Y8AA 2C8JA 3NK7A 1PKXA 3NU1A 3H65A 3JATB 5AH0A 1N4DA 1YU6A 1JS1X 13PKA 2YRFA 5C46F 1RQPA 3ROFA 4Q37A 4DVJA 3P2YA 4J9YB 5LP6C 1NVPD 3B2NA 4M9XA 1FD9A 4RIIA 1NVEA 3AY6A 3MQ2A 3PGLA 5GTDA 3ONVA 1UBEA 1UZNA 2ORIA 5A04A 3PQ7A 1BVHA 1A27A 2R6CA 1I7QB 2GEFA 2WIFA 3S2EA 1YIJF 3H1KH 4FYHA 1QG2A 5CD9A 3C9TA 4KB5A 3C6KA 3JQAD 2W83A 3D0KA 2G5TA 1PWHA 4FUTA 4GBGA 4DWOA 4CEIB 4TKMA 4ZI5A 3DKPA 1S01A 3HRIA 1BEUB 4N01A 3IVXA 3PQ8A 2GUZA 2HPHA 4JJFA 1Z06A 1S0UA 1XRSB 4ZMRA 4QX6A 3KLNA 4D81A 1TJPB 1RRGA 4E1VA 5T4HA 3PVZA 3Q2KA 4N8EA 3EF1A 4XARA 3TLMA 4PZ9A 1XF9A 1WJZA 2PX4A 1DG9A 3MG9A 3KJGA 4C21A 3S1LA 1QQTA 4Y9SA 1YA6A 4OXIA 4MKHA 3TG2A 1WHSB 1XWFA 2AKYA 1QHTA 2QWXA 1JMYA 3NGMA 3NNSA 4AJLA 1J56A 1R3KC 3Q15C 3MJTA 1DB3A 4B3TO 1GG8A 3IAXA 4Y30A 5I4KA 5EUMA 1IUNA 4ZT4A 3QVWA 4CG2A 1U7WA 4QUJA 3RC1A 2PLNA 1HQDA 1ILWA 4FCWA 3NWBA 4IUDS 5DU2A 2GD2A 2OCPA 2ZRBA 1N0VC 1XZKA 4E51A 4JKYA