4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
5JVDB 3C8LA 5ITZB 3CB2A 4IHJB 4WBNB 1W5FA 4I55A 1SA0A 3RYIA 1W5BA 4HNAA 4DXDA 5KMGB 4EB6A 4YJ3A 5LA6B 5IYZB 3RYCB 5FNVA 5LOVA 3HKEA 4O4JA 5CB4B 4EI8A 5LXTB 1Z5WA 4I55B 5LP6C 4TUYB 4YJ2B 4YJ3B 5LA6A 5IYZA 3ZBPA 1TUBB 3UT5A 5EZYA 4ZHQB 3JARA 3JATB 4O2BA 5JCOA 3VPAA 4ZI7A 3R4VA 5EIBC 5IJ0B 3N2KB 2VAWA 5JQGB 3VOBA 5J2UB 3HKBB 1JFFB 3WGLA 4O4HB 2BTQA 5MN5A 4I50B 1RQ7A 5CA0A 4O2BB 5MN6A 5JQGA 3HKDA 4KWEA 3HKCB 3JAWB 5C8YB 5CA1B 3RYHB 3JATA 3HKEB 4O4JB 5EZYB 3ZBQA 3ZIDA 4X1KA 5IJ9B 5JH7B 3JALB 2VAPA 4EI9A 1W581 3V3TA 3JAKB 3RYIB 3JAKA 5C8YA 1SA0B 4X1YB 5LYJB 3VO8A 4E6EA 4EI7A 5LP6A 5IJ9A 4EB6B 3RYCA 5JVDA 4X20B 5CA0B 4TV8B 4B46A 2RHOA 4IIJB 4F6RA 3VOAA 1JFFA 3M8KA 3HKDB 3E22A 2XKBA 1FFXA 1Z5VA 2VXYA 5BMVA 5MN4A 3WGNA 4TV8A 4ZI7B 4LNUA 5KX5B 3HKBA 3RYFA 5EYPA 1FFXB 4YJ2A 3E22B 3N2KA 4X1IB 4X1YA 5LYJA 2R6R1 1TVKA 1RLUA 3M89A 4X20A 3WGMA 1FSZA 4O2AA 4U39A 1W5EA 1RQ2A 3JASB 3RYHA 5JCOC 1TVKB 3HKCA 3JAWA 3N2GA 2RHHA 4TV9A 5FNVB 4IHJA 4WBNA 5LOVB 5ITZA 4O2AB 4X1KB 5JH7A 3VO9A 4M8IA 1W5AA 4LNUB 4U3JB 4HNAB 5CA1A 4O4HA 4X1IA 5EIBD 3WGJA 5GONA 2GVIA 4O4LA 5KX5A 4IIJA 4B45A 4O4IA 4O4IB 4U3JA 4I4TB 4FFBB 5J2UA 5GONB 4TV9B 3N2GB 5IJ0A 2RHLA 5M7EA 3WGKA 2Q1XA 5CB4A 3JASA 1TUBA 3UT5B 4ZHQA 1W59A 5J2TB 2R751 5LP6B 2VAMA 3RB8A 4TUYA 5KMGA 2BTOA 5LXTA 2XKAA 3JALA 5J2TA 3RYFB 2RHJA 4FFBA 4I4TA 4I50A 4DRXA 2BTQB 4O4LB 4ZOLB 4ZOLA 5EYPB 4F6RB 1OFUA 4DRXB 2Q1YA 3JARB 4XCQA 5BMVB
chains in the Genus database with same CATH superfamily
3BK7A 4FD2A 5BNFA 3V4FA 5CEFA 1XX6A 4IHJB 1L3IA 2QN7A 4CFYA 3GEGA 2I2DA 3GVHA 4LCKA 5DYWA 4J9VA 4UBJA 1G38A 1J2JA 4EB0A 2CCGA 2OUIA 5CNJA 3WJAA 3VKFA 3KT8A 5BWLA 4J7JA 1YZQA 3L3BA 4DC9A 1QO9A 3Q98A 1IL0A 5LA6A 1T5HX 2EDCA 5K3OA 5AUPB 1MP0A 4DYVA 4O2BF 5D5PA 1E1YA 2XDYA 2ZR7A 3GQBA 4YP6A 3TSAA 5IJ0B 1ODSA 5CIQA 1E2NA 1AGNA 1MHPA 5H70A 4ZZ2A 4AKGA 2VAWA 1OCCC 3A7EA 3F97A 1XCLA 3QEMB 2ID9A 4XUGB 5IAOA 2ACEA 1EFPB 2CFRA 4JHLA 5TF4A 3TXAA 3CU5A 5LMUB 1U0OC 2JCBA 4KR9A 3QEAZ 5JMTA 2ZYTX 3Q85A 1BEEA 4LYEA 1WXEA 3D8HA 3GLHB 1CR0A 4M37A 2PU5A 2IJGX 1KGSA 1QG6A 2IUFA 2BP7A 3I3SR 4IQFA 2MSDB 3UQZA 1NF9A 4A8JB 4L50A 3EXFB 4R1OA 1GCAA 2PMCA 3OKFA 3FB7C 1R5OA 1J8MF 5T67A 2V3CC 4KX3A 3V4RA 1JHVA 5LMNO 4K9SA 5I6DA 1ABEA 1P4HA 1OREA 3FWZA 5JHGB 2AN4A 4Q47A 1J1IA 4QM7A 4LV5B 2X2PA 3NIBA 4PA3A 3AOEA 2GBLA 3WDSA 3KUUA 4L16A 2PA0A 1TA9A 4WTOA 2BO1A 1TLLA 5DRYA 5FHRA 2EHJA 5H7XA 4KV9A 4QSHA 3V1YA 4DYDA 4R71A 1LSSA 3MD0A 3H4IA 4MKZA 3JQGB 5EYPA 3WYEA 3SYQA 4Y6SA 1D4AA 5KHKA 1DMRA 3H65A 3PUVA 2XE8A 4P82A 5B6PA 1ESDA 3PYXA 4QUIA 4DV5O 5E9WA 1IHPA 1VQ1A 1W49A 4MXDA 5AQEA 1OC4A 3GRPA 5IJWA 5A3VA 3QNUA 2BJVA 2JJ1G 3OTOB 1OCOC 3LP6A 4Q12A 4C2BA 4TYQA 3CZMA 4YBZA 4DLAA 1CJTC 1RPJA 2QN3A 3TXSA 2AXEA 2QRQA 4R31A 2H1IA 4ERXA 2WLKA 1L5FA 1MIOA 5AVOA 4YAUA 2ZM6B 2G4CA 2P4QA 2PH5A 1C50A 2ZT6A 3CX7A 3FA2A 3MRXA 1JX6A 5TEWA 3TDMA 7ABPA 4L15A 3B1YA 5KYWB 4OI1A 2XQGA 5C8ZA 3RLFA 5MDHA 1GU0A 4OK6A 2YR0A 4YFVA 1YIAA 3MXTA 2WLSA 2UXXA 1P9OA 2Z1FA 3FYCA 1WUHS 3KUCA 4ZHQA 2AVNA 1NL3A 4OQEA 4ZO4A 2IYEA 2HJWA 1F8XA 3VYWA 2W00A 1GM8A 3BX1A 2P9GA 3K0AB 3NRBA 1N9KA 2JA1A 2BKLA 3H3XA 2J9GA 2ZR8A 3HCRA 3OE1A 3BHPA 3FUVA 4IWYA 4HDKA 4LMBA 1FVOA 3ASYA 4NWIA 2IH3C 2IDZA 4BO8A 1LX7A 1XJ0A 4FFBA 2H8KA 2DLDA 2OHVA 4R2XA 4ONEA 2RK4A 4R2IA 1M5IA 2C8JA 5T64A 2EZ9A 1NH2D 3W7VA 3DVAB 1KKLA 3GRVA 3DF7A 1XVLA 3EXEB 2O2EA 4LRTB 4DMMA 1OH6A 4XASA 3SPGA 1PJ2A 3SBXA 1NNEA 3TZCA 4B82A 2QA4F 1KEPA 4B4WA 1V9CA 3UJNA 1WUTA 4ERHA 4JVSB 2B5UA 2QEXF 3QUBA 1DOZA 4HRXA 1XBIA 2OBYA 4RZQA 5DIZA 3RTCA 3VR4D 1B14A 5TS3A 4A8HA 2X0NA 3G2LA 3VSCA 4F6LA 4QATA 5IUNC 2IYXA 3WGYA 3WRXC 5K3EA 4MRAA 4K9NA 1A1VA 4OX9Y 3ECSA 4BLWA 3STYA 4WVFA 1YVUA 2NNWB 1SHLA 1K0FA 1FYWA 1WMEA 5DN6G 5JSUA 2ZTVA 4X8OA 1US8B 2O8FB 1IV1A 4URWR 3SJ7A 2C57A 2ZVQX 4G9BA 5HXAA 1P7WA 3UO2A 2VSNA 4OU4A 3V8PA 4G6ZA 5CT6A 3VVCA 4II3A 4CF3A 3N8GA 4AS1A 1VSBA 2ANBA 2QRNA 4NBWA 1KZHA 2J67A 2JEUA 5B36A 5I4KA 5EC2C 2UYPA 2E4UA 2ZRNA 3HVUA 4P5PA 4RHUA 5KHJA 2PY6A 4URUR 4DQDA 3BL6A 1BZKA 2ZSKA 3O8BA 3ML1A 4TSFA 4D9HA 1D4FA 2H2WA 4PYKA 1JEYB 1BDBA 3BQ9A 4O29A 3LWDA 3IP1A 4FUQA 5EZYB 5JMWA 1Q3KA 3RVOA 4EGQA 1R6UA 3LWZA 1PQ4A 5E4YA 4KAFA 2IXFA 3HXQA 3K79A 1GG9A 1D9XA 5JATA 2POCA 4KDCA 2C99A 5DT9A 1RYEA 1E18A 1PK7A 2ZT9B 4A5UB 3IRUA 1T9BA 4NECA 3ONEA 1R3KC 1CV2A 3CNOA 3QPUA 4W4KA 3OC0A 3MTQA 1HGXA 4FFNA 3FOBA 2P62A 2JW5A 4G2KA 1F7YA 2FZKA 4KIFA 4PV1B 1EP1B 4HFMA 4AY3A 4W8HA 4ENPA 4D79A 4JYAO 4AQYO 3A2FA 1DLJA 2X3FA 2WI8A 4TMTA 4UNIA 3RS9A 4C4OA 2F90A 2DBRA 3HJWC 1GTJ1 3HUFA 1YHQF 4KWTA 4NJMB 4AX4A 4US0R 4EVIA 3CVVA 3PEEA 5A2GA 2PUBA 2YIBA 1EYZA 1NU8A 4X6LA 3ZC3A 1Q6YA 1FP7A 5JCOC 3WKDA 1KQPA 4CDGA 1WP4A 3IC5A 5IVKA 2XWQA 3WYNA 4D9FA 5L45A 4CR6A 3KQVA 1RSOA 2CW4A 2NACA 2IJKA 3D6VA 3KUDA 3OMWA 4QBTA 4KO1S 5JDCC 4ECEA 4X1OA 1QPGA 1J0DA 3VYUC 3ZDXB 1I3CA 1U0NA 2J46A 3Q88A 4LXUA 1H5QA 5GOZA 3AIIA 3C9UA 3VMMA 3S99A 1WA5A 1DXHA 1H85A 1VKJA 2V5AA 2ZRFA 4FK8A 2XF2A 3BSYA 4L08A 3JQRA 2P9FA 4PXAA 5A4KA 3HJFA 2RJZA 1ZK0A 1QQ6A 1NPTO 3ND5A 4XZ3A 1F60A 1AP6A 2CVHA 2RIRA 3IAS1 5BRNA 4JXJA 3H5AA 4WXPA 4B4OA 2JGEA 5CVCA 2IJHA 3SYTA 1OROA 2OLJA 1ADCA 3ADOA 2WWRA 4RF4A 2I3ZA 3HDYA 2C2OA 1GCUA 2ZUSA 2ZTUA 4K86A 1AX9A 3L7CA 5IW8A 3Q3EA 4EM6A 4X92A 3JQAA 3NJRA 4AQ7A 5IDVA 1PZFA 5IDYA 5TMDA 4TTTS 2FYUH 3D8BA 4YV0A 3CCSF 4IIGA 4QPJC 1TW2A 1HE4A 4H3HB 5FFNA 5L3QB 1Q7YW 2G1JA 4QOHA 5JSKA 4ZI3A 3C74A 1RZRD 1YJWF 1MC4A 4LJ9A 3AEZA 1Y1TA 2DAPA 1HG0A 1EXNA 1TU4A 5DLQC 1MT3A 3K09A 5KSPA 1G5QA 2C84A 4FPXA 5J63A 3FFQA 2XXAA 3SYCA 1G3UA 3PNVA 2RONA 1UT8A 2CYAA 2IV7A 3S8MA 3TQIA 4DZTA 4HDCA 2VCYA 1KRXA 1R0ZA 1VL6A 1MB2A 1S76D 5CBHA 1VE5A 4JGBA 4RTOA 2PUTA 1PKXA 1SCDA 5FP0A 5TX7A 3C3PA 1F2TA 1OB5A 1HNXB 2BOBC 2IP1A 3PUWA 5EMHA 4C6TA 1EFVA 4OGKA 3TE6A 1EU1A 1VRVA 2AFHA 4BV2A 4XSGA 5CAEA 2J9FA 4MS1B 1O0SA 3N4ZA 3VPHA 5G4KA 1EX9A 4KP4A 1JAHA 3HR7A 2OCLA 2OXIA 3VOBA 1NSFA 2QAJA 1K8YB 3LC2O 4H08A 4DEYA 4BO3A 5KB3A 4Q6GA 5M3BA 1NF8A 4B17A 2PAAA 3DFKA 3SN6A 3F6BX 2CGNA 1PGPA 3IT3A 3ESYA 3K6SB 2B1JA 2B3DA 2HLNA 2WHPA 2QTGA 3H6KA 1YQUA 4HOYA 4A26A 1E1CB 1MJNA 2A8YA 4JC4A 1ORDA 2AOXA 2R8EA 2XWBF 1P3Y1 1F0KA 2ZRJA 3U37A 5J9PC 2I2WA 2AYZA 5IYCO 2F93B 4OJMX 4UULA 1E0JA 3T7RA 4MQBA 1J39A 4KE6A 4B46A 1FKAO 1J1UA 1WHSB 4KTTE 1H1DA 1I2CA 5CB4F 2GK3A 3IPRA 4LI3X 5C3MA 3OZWA 1Q6HA 4RCVA 2XE4A 3AHJA 3WJ1A 2OMEA 3LSTA 4GC5A 4GPIB 4QU9A 4YMIA 4D8XA 5HZGA 5KINB 3O8CA 4L22A 5D2CA 3W3AH 4DIDA 3OCWA 4DK0A 4MVXA 4DZRA 4I0XA 1YCDA 5EJ9A 4IMJB 2G06A 3GDWA 1IBLO 3R7LA 4BWGA 5HHTA 5AM0A 2AW9A 5DXFA 4MGHA 3SSMA 4WDRA 4EI2A 4UB6Z 4MIOA 3DQZA 4Q21A 3C5WP 2HCFA 1MOFA 4D6YA 3LY7A 3CCJF 1LCIA 4G0NA 4GUDA 4ZVTA 2X5XA 3TSYA 1M6EX 2JFZA 2IQIA 2R9AA 2REQB 4NE7A 4NU8X 3UKOA 1MT0A 4BIIA 1MG5A 5DMHA 3CZ5A 1VBNA 1R1MA 1NXWA 1YMQA 2CF6A 4G23A 4YR9A 4KVZA 1ANKA 1GRJA 3PQ2A 1X7HA 4B62A 3AJ9A 5DPMA 2HPZA 5U4QA 3UHJA 7REQB 1OCZB 2BSQA 1DFHA 1IATA 1XD2A 3B85A 3LJKA 1A9OA 4NENA 4PX2A 3DLIA 4AX8A 2X4LA 4OJYA 4CQMA 2ZUCA 1AUQA 1W7AA 2P9EA 4TT3A 1Z2GA 4ZK6A 5FOXA 4LS3A 1ETHA 1JFVA 1XEFA 4KXVA 3YASA 2IPAB 3OUSA 3A27A 4IDOA 5I7AA 2K1SA 4O2RA 1I2ZA 1I5OA 2AI1A 2R11A 4HLCA 4MK4A 2VBCA 3ZWXA 4UEJA 3ZHCA 1TCBA 5I5GA 3O9MA 3RT9A 3R77A 1PL7A 3GGCA 4IG9A 2WSMA 5KKAA 2I0FA 3ETGA 2I9KA 3EZLA 3BXEA 3BABA 4FIPC 2C96A 4HQKA 5TVKA 1K06A 4J0CA 1MNGA 1EFTA 5LP6F 2W11A 4BYGA 3ILVA 2YV5A 4X66O 2FZEA 3K4QA 1GHTA 4TWZA 4B5KA 3CYQA 4HVAA 4JJ8A 2D5CA 1O9GA 5CVJA 1WZEA 1TAUA 3O3MB 2Q6KA 1V54B 1XLUA 4JQYA 4UHHA 2X7JA 4YAIA 2RH4A 4UMEA 5LMUO 4BXOA 2QRMA 2WUWE 3BT7A 3E3MA 5DM60 4TYPA 1L5ZA 2QTTA 2LV8A 4TRRA 1B6RA 2RGNC 4HXGA 3PUZA 3IEVA 5JQWA 2P9TA 1GPUA 2P8SA 1IK6A 3MCWA 4FGJA 4MDYA 4WLNA 3IJ4A 1BH2A 2IDMA 3FKQA 4E4TA 5LOVA 2IL1A 4LF4O 1M1XB 3FXAA 3H11A 1BH6A 2YICA 3E7FA 2WE7A 4ZYZA 3LLUA 1VGVA 3EIFA 3D7MA 2QL5A 4MAFA 4Q24A 3EIUA 3EXHA 3R1IA 5F3RA 4G1VA 3OIDA 2WLLB 3PXAA 3E89A 1Z38A 1KJQA 4LYFA 2Q3FA 3NWEA 1GPNA 3GK3A 1X8XA 4P3NA 1JEEA 3E9MA 2R68A 2WUFA 3W34A 3WGLA 3CZPA 4BQRA 5K09A 4Q9JA 2V74B 3ZV4A 5KWIA 3O3CA 4IGKA 2L17A 1P4AA 3N58A 4OAQA 3HQ4O 1WDMA 2VA8A 1KERA 2Q1WA 2R00C 3GEMA 5CA1B 2GLZA 4IO1A 1Q5PA 4J0FA 1XU7A 3QXHA 5EVCA 1D1QA 1RACA 3S3XA 2VTEA 2ODAA 2II6A 1Z08A 2MT9A 3JALB 3LU1A 1CT9A 3N87A 5BYAA 4LWSB 4ZO7A 3GRKA 1F9EA 4FZ5A 1YUNA 2CW5A 3LX5A 1F2UA 3IB6A 3SS7X 2D59A 1I7QB 1F4PA 4XXHA 1YXBA 1AHHA 2CLLB 4E94A 2R85A 5BV1A 1Z7WA 1U2DC 4Y2GA 3VR4H 4FHGA 1GO3F 3G2PA 3HVJA 2I4LA 2PJUA 2ZRPA 1MW8X 2A9HA 1K33A 2ZSIA 3I6BA 4I3GA 3WOHA 3ZDFA 3HCEA 3BIWA 3RVSA 4BQIA 1YI8A 1EAMA 2CXSA 1UBSB 1FL9A 1WDWB 4B7EA 3EYAA 5AI6A 4TMYA 4UU8A 3OT4A 1QE5A 3ROQA 3TKLA 3HB9A 4R3UC 5BSFA 3RW0A 1O97D 3PPXA 3P0RA 5DX8A 2VN8A 2A7WA 2JRCA 2PX8A 2LNDA 1EFRG 1XROA 3SPHA 2EP5A 4FQ7A 1T36B 2CV0A 2BBOA 4UW9A 3B8EA 1T9DA 3OX4A 1DCMA 3A37A 3U19A 1SXIA 1XDDA 4DXAA 3N07A 1UZLA 5B5EZ 1J4AA 3OFJA 3P9IA 2FFAA 1JY8A 2G9IA 2GI4A 4JBGA 1TNDA 2IV2X 4X3CA 4BZWA 1I7PA 1VEWA 3HCPA 2BPOA 4DR2B 2F2TA 4EJSA 1YIOA 5CFMA 3WLTA 1WXDA 4HRVA 4A5SA 2XMCA 2A0XA 3KQHA 1N7IA 3WHLA 1HEIA 1QQ5A 3P0FA 3D2AA 1JR4A 1Y4MA 1JJ2F 3SR2C 4L3VA 3M6UA 1KC8H 1I2AA 3QPDA 5GV7A 4YV2A 1TJ4A 1DTSA 2RHWA 3RVMA 1XVVA 2R4UA 2G0NA 2UXDO 3DHVA 3VHQA 4DV5B 5ALHA 1W59A 4MB6A 3HCNA 4JKOA 3CF4G 2GZSA 1K34A 4KNWA 4PQGA 3K94A 2VF7A 4L78A 5AJZA 1O57A 1PZNA 3U4DA 3VR6H 8ATCA 3CS5A 4RO2A 2JGDB 3R9XB 1EWYA 3JQFC 3ASZA 3R44A 2IPLA 4N7JA 3ZHZA 4PY2A 3WHIA 4TZKA 1XPUA 3D7NA 2CJFA 3EDMA 1C0LA 4FIZA 4L73A 2C9MA 2B36A 2W6CX 2CVOA 1DJLA 3PLAC 1CKEA 2XCQA 2ZIVB 5UKDA 3RRBA 3L49A 4EJ2A 3FD6A 1P9LA 1ZN7A 4YACA 1ZLYA 1UJ2A 2HHCA 2W43A 3JYLA 1GRRA 5JDCA 4TOIA 1JBQA 1X4TA 5CLFA 4PHZA 2QMHA 1LUVA 2X6BA 1T0KB 2ATVA 4QXQA 1Z6TA 4WLEA 1MXFA 2FFQA 1YZLA 1IEVA 2K2QB 1BMTA 2WT8A 3H1AA 3NYQA 3CMEV 2GHIA 1KNKA 4PA4A 1AVMA 1VB3A 2PLRA 2DTDA 3HXKA 5HE9A 3TSZA 3GLGB 1FP2A 5IF9A 4UHDA 4WNAA 1M1NB 2BR3A 1XQ8A 5K6AC 1H2KA 4UCUA 1YRLA 3I34X 3MAJA 5FD8A 5HY4A 4TLCA 5K51A 3T9FA 4EUSA 1TUBB 3UT5A 2VKTA 4OH1A 3T54A 2LR0A 3QE0A 3DDZX 2JEOA 4FCCA 3LY9A 4P08A 5JAMA 2VRZA 1AK1A 3RSSA 1N36O 4QPJA 2PI5A 1AUVA 2Y1DA 1GLNA 1UK9A 3NJ4A 2XZTA 3L8HA 1J24A 4NBKA 3EH2A 4RU1A 1AVTA 1GKKA 2BGWA 2E0IA 2Z58A 3LXMA 4M9ZA 2JK5C 4U2KA 3FSRA 1SQFA 1SXJC 2Z08A 2C4KA 3ELBA 3HKDA 5CLHA 3VDXA 1W87A 4RY0A 3HKCB 1KY3A 2FSPA 4DLYA 1CU1A 3IUYA 2JVKA 2XNKA 4MINA 1NF2A 2V7XA 1N3BA 4H1VA 1NN5A 4S05A 2PTHA 1BXGA 4PPFA 4RGVA 3UOGA 5COAA 3MUEA 5M04A 5M2QA 3D1JA 3MUNA 1EK1A 2PUSA 2GAFA 1D6MA 5DMXA 3EPLA 1Z6QA 1GZ5A 2OCAA 3K6RA 4XCXA 4N5LA 5JZOA 4S0ZA 1K73H 2L18A 2Y9MB 1D1TA 2FX5A 4ZVOA 5FL7G 3RU2A 1NE7A 1VQ5F 2OXTA 4AS2A 2OLKA 4D5GA 4Z2WA 1H9CA 4FPPA 1K2VN 5BSKA 3I6IA 2HEIA 1FFGA 3L72H 1ESNA 2ZWIA 5CHEA 5KYUB 2XUQA 1X7ZA 1XMXA 5AJXA 5KX5B 5TV2A 3UB2A 2IFTA 3L9WA 1H5NA 4W5RA 1C9YA 5EUCA 1S2NA 4E5DA 1VL5A 3VHLB 5KAIZ 3OFSA 4IO0A 4XGKA 2UYHA 5BOSA 1G60A 3LDEA 5EJIA 3ZZUA 3DMRA 2NQ2C 4WK4B 4RETA 5AKHA 2C78A 4A6PA 4W8GA 2BSKA 4CMCA 3ZHRA 3VNSA 1JEYA 2EZPA 1CQPA 3MAAC 3PGJA 2QV7A 4X24A 4RH0A 1QDUA 1K68A 2AD5A 2B34A 3CNQS 4I0XB 3ZGZA 1I5XA 4MPJA 3TLYA 1KORA 5JC1A 4CU2A 5KNDD 2WF7A 3G3EA 4KFRA 4X95A 1MU0A 2ZI5A 5FKJA 3TLGB 4C88A 2WZQA 1GCOA 5HUQA 3PA8A 4F5YA 3T4EA 1K27A 1MFPA 3CLHA 4JQOA 5DN6D 3O5AA 4P93A 3NONA 2J85A 4PIPA 4AYWA 5DNDA 5BORA 4TKVA 1AO3A 3EFFK 5IT9A 3D3QA 3FN4A 3VPCA 5IYZF 3W7BA 3JAMA 1L0LH 2FPUA 1N8KA 4JJKA 3UB4A 2H1OA 5LHIA 3SZGA 3VTKA 3FYDA 1ZIOA 4CTOA 4YHHB 2GJAA 3TIFA 4F2DA 5DP2A 4ENUA 1JJOA 2WSSA 4IXNA 2EW8A 5D00A 2Q3BA 4RVCA 4ARSA 1JBKA 5EB0A 2PVCA 3TNYA 1GR1A 3MMSA 4FIDA 1NWHA 2QVYX 3R0JA 3ZX5A 3UG7A 5CITA 4P7FA 5HOEA 3ZHBA 5ER6A 4BO5A 3Q5GA 4GQBA 4PYQA 4X60A 3VNQA 5HW0A 5L3BA 3UO3A 2XUKA 4MB2A 4I3HA 5H9CA 1PAUA 4LZAA 1VP9A 2HTEA 2YCBA 3CX6A 3ORYA 4DZZA 4HN2A 1JDPA 1L4LA 2R5NA 1G5HA 4PHTA 3OMNB 4B84A 2ZINA 4KXLA 4B76A 4BVQA 2GD2A 4YN3A 2XB9A 1VQ6V 1QIHA 3EHDA 4BO6A 1FJ2A 1SUSA 2BH9A 3E9EA 2O59A 1GR0A 1WVIA 1EGMB 1AE1A 4ZQIA 3UC5A 4B8ZA 4IY1A 2BFOA 2Q21A 1M1KH 3S2IA 2M2IA 1QO0D 1FS6A 1USKA 4DB2A 3A6FA 4QO7A 3ZVMA 1AKTA 2OVFA 3D0RA 2H6EA 2XDWA 3D2BA 4JUFA 3EJ6A 1XWIA 2OTMA 1LS6A 3KKMA 4YMLA 2ET6A 4NS4A 4HC4A 1IJEA 1KAGA 4U2GA 1GG8A 4ZZ1A 2GZAA 5K3FB 2DU8A 2XB6A 2CMHA 3FKSA 4LBWA 4DCVA 1T5SA 4C89A 1Z82A 1Z2NX 1GZ0A 4Z8YA 2ZXWC 4EHBA 5JV5A 4ARVA 4D80A 5HPYB 1TFUA 3CXRA 2PCJA 4NJOA 3MD9A 4HK4A 4LE2A 2R6CA 1FFBA 1OX4B 1H2MA 4R5HA 4ITUA 3QYAA 2OQIA 3ONFA 1QAMA 4KR7A 5MHTA 4YI5A 3IPXA 1WV0A 1E6CA 4CM9D 5KHHA 1QZ3A 1RXEA 2WAMA 1T0BA 1DKOA 2A7QA 5KA5A 2XDAA 3NOOA 2D2IA 2Z9DA 3LECA 3PKZA 2ADQB 4JSRA 3ZI7A 4IP0A 2GDZA 2XUDA 2NO9A 1Z5NA 2PR7A 3CEJA 3VPGA 2HUNA 1UMDB 2REBA 4E6EA 3OM3B 1PT7A 4I9GA 5A9TA 4NFSA 1NX6A 1GPAA 2OBXA 3HHPA 3N76A 5ENZA 4A73A 1W85A 1OLOA 2P7TC 4YJFB 2XUMA 3VI3B 3W79A 3LZDA 4B6EA 4DLSA 2AZDA 2LFSA 1E7KA 2V6JA 1BE1A 1DUSA 4X62O 3TTVA 2UXBB 1N5OX 2XCIA 2GF0A 1E8DA 3GQBB 2Q5CA 3QKSB 1N2ZA 4LNUA 2LDXA 3H5OA 5EQTA 1A4RA 1ICEA 3T1QA 2HU8A 1VPDA 2C2WA 4DM3A 1CQJB 1TMGE 1Y74B 3R6LA 3QX8A 5JSYA 3RC9A 3U4MA 3R75A 1JNXX 1Y5RA 2V0CA 1NQ5A 2IX9A 4IDNA 2TMDA 3RANA 2HMSA 1R64A 5K01A 4LWOA 5ELXA 4GKKB 4HDQB 4PBTA 2ATCA 4DIUA 4C7JA 4J0EA 3F3SA 4RM2A 3H01A 4A27A 2H94A 1WABA 3SLGA 1OZGA 1PG2A 3N9IA 3X1YA 3RREA 4Y9SA 2A92A 3P9YA 5G1OA 3T7JA 2PJRA 1AS2A 4ILKA 4ZCTA 1W35A 1QVFF 1EVIA 1I3NA 2PMFA 3H86A 1L5SA 3NAZA 2OV4A 1SG0A 2JI9A 1JR3D 3X2QC 3CJHA 1IBMO 1EK5A 2P75A 3CH5A 1Z62A 5C8YF 1EH5A 3IKMB 3FKSG 2EG5A 1FUKA 2YXNA 2M9MA 1AF7A 2WB2A 1Y3DE 1IHUA 4KAAA 4KQCA 4DQLA 4D26A 2H4XA 4JGGA 4NR0A 4WXYB 3LYBA 5G0TA 2HR1A 3HL0A 3KFVA 4XA8A 1DAGA 5F1PA 2WF9A 3WRYC 2PUEA 4M89A 2ACVA 5KWJA 1DWQA 2YN0A 3NASA 2BTOA 1RCFA 3NBQA 4OAPA 1R4AA 4OIFA 1N8TA 2EZ4A 1EVKA 2VDLB 4P3YA 4U5QA 5KZMB 2PUVA 3GJYA 3WWYA 2AOWA 2VQEB 4A7PA 1BHSA 1D1SA 1P1IA 3FYTA 4ZU1X 1JJAA 1SRRA 2YJ4A 3TL6A 1TD1A 2F1JA 1RM1B 2FW7A 1DBFA 1K7FB 3KE9A 2YIAA 3ENZA 3KX2A 5DGXA 1KJ8A 1L4FA 4HAZA 3ZH9B 1UPBA 2V4MA 2YXPX 2YYAA 3KTFA 2DWPA 4AMUA 2PLFA 3RFUA 5A1TA 3JZFA 2PT5A 2WG2A 2WM8A 4TM7A 4ZANA 5IAEA 1EX6A 4PLYA 4F1KA 2GYWA 4LF8B 3FLEA 1XO1A 4OGWA 1T35A 1YRYE 4WK0B 3ZVRA 1GTZA 4RFVA 4YJ3A 4FBGA 9LDBA 1RWXA 3QBEA 2HLPA 2YHIB 2V8BA 2F43A 3P2JA 3HXLA 4PYOA 1QX4A 2RH9B 1Q22A 1CNFA 3F5QA 1UF9A 1ZEMA 1LSOA 3NIWA 4J1SA 4A1OA 4BV8A 4U7TB 2NYRA 3GEEA 4JAUA 5GIPE 3ZXIA 3VBEA 3C1OA 1GUZA 3T1YB 5LYJF 3C4VA 2GMWA 1XHEA 2O14A 3GFPA 3PBKA 4HNRA 4KQXA 2X23A 1SHZA 4XWAA 4HEQA 3NVAA 5C7LO 3RV3A 2HQSA 4MS4B 1RQRA 3WWPA 1JDBB 1LTKA 4MKRA 1W3EX 1DC5A 3R6TA 1AJEA 2Q8NA 4YMVA 2Q5LA 4M9RA 1NQVA 5EC8A 3OO1A 5AKKA 5JRDS 2XB8A 7ADHA 1ZWKA 3H9EO 1SXQA 4JXKA 4ZDIA 4DSTA 2Y0BA 4JXZA 1G8FA 1I08A 4ZHWA 1W5TA 1L7QA 5J4VA 2J0QA 5ED4A 3U80A 2BZ0A 4W6QA 5EIHA 4ABTA 3DBHA 4M8LA 4OFXA 3Q72A 1CUDA 2P1RA 2CVZA 3UTCA 2PWPA 2A3RA 5IXSA 4DNFA 2QVZX 4K6GA 4CF5A 1J8YF 4ES6A 5JXJA 2C8KA 2AN1A 2ZBQA 3M4XA 4E4RA 4AYTA 5K5EA 2WT9A 3TSOA 1RW4A 4HDMB 1IQUA 1Q0RA 3ABLB 3WK4A 2DUWA 5H5JA 4DUZB 4I14A 5SYNA 2WKPA 1FUUA 4LTNA 4PN7A 1G7CA 3LQ1A 2EILB 3O91A 4Q02A 2R8PA 3ESCA 3VKGA 1P1KA 4EG7A 4MKFA 1X19A 3A6LA 1QIGA 3ESBA 1R0LA 1OFIA 2P5YA 4TL8A 4BWAA 5IDXA 2WWIA 2EC5A 1K6MA 1DVRA 4BO0A 4PSCA 5KWSA 2PG3A 3REOA 1PGOA 3LXRA 2CWJA 1F14A 1PVVA 2ZT7A 2AVDA 2PXAA 2D8MA 3A4IA 4EITA 1Z12A 3KE1A 4TS1A 3U17A 2R2AA 1NW4A 3GLHE 1D2DA 2UYNA 2PBRA 2E74B 1OA0A 3OWXA 3QLVA 4IRXA 2I8LA 4JENA 3PEVA 3PXDA 3KIZA 3U5TA 3CVXA 1E32A 4IRUB 4KE7A 4PZ0A 4O02B 1UDAA 5EWMB 5AVQA 4U9HS 2RJOA 5LR6A 3SPIA 2VI5A 2BEJA 2EZOA 3CS3A 5C93A 1C1DA 4LHEA 5JZVA 2YUTA 1XBLA 5IHXA 4NNPA 4PS0A 4QO8A 2VJDA 4R98A 1M2OB 3AZOA 3DLBA 3B6JA 4G0XA 4LN1A 5T4EA 4CM9A 3FB6C 2G7MC 1Z36A 1PX2A 3VNBA 3UENA 4QE3A 4TKVB 1WPGA 5EFZA 1QOZA 4CLRA 1G7TA 1QZZA 3H1BA 1JN0A 1O0BA 4IGIA 1Z4JA 1Y8RB 1E3WA 1Y5IA 2P9HA 3GBSA 3SHVA 3NBZC 1QB7A 1QVRA 4N23A 2AWNA 1WRBA 4K5QA 2QTCA 2MYTA 5TT0A 1A82A 1D04A 3BMNA 4E12A 1D2AA 5TGZA 1W5BA 4DXDA 1DDOA 1EGHA 4QHYA 1S3FA 5DWQA 3WQHA 3RIGA 4L5JA 2NXWA 2GF2A 4O5AA 3FF4A 4NHOA 3JYNA 4OGLA 2DPGA 2H2AA 1M56C 2A9QA 5F5NA 3P19A 4HVCA 1ZWIC 1RFGE 2QN9A 1U1GA 1CBUA 1LPPA 3T5GA 2C3YA 2GUWA 4KO2S 4MTOA 2IRWA 5LGNA 4NXMB 4QUAA 4D46A 2B2NA 3EGXA 1IWBB 3W5BA 4ER6A 2LUOA 3M4YA 3PDIA 4RQOA 1DIBA 2C4TA 1R4NA 1J0EA 1M6YA 4HGRA 4XEUA 3T3HA 1JFFB 3QXGA 4CF4A 1ONSA 2CZWA 3PUYA 3QOWA 5ALIA 1XNGA 2W8BC 4Y2SA 1VLJA 1A4XA 1CY6A 1DWUA 2W5UA 3C3YA 2X8JA 2OHIA 1XZFA 2ZM5A 1KJZA 1VLZA 1YDMA 3DDOA 2VZ9A 4B40A 1LPMA 1LXCA 4EQ6A 2ZI6A 3L8DA 5G2OA 1N2CA 1ZX3A 1U31A 4GPEA 5C46F 4YCLA 3WAJA 1PTJC 1RRVA 3FJYA 3QHAA 5IEBA 1XREA 3PNBA 3UMMA 1D09A 2AX3A 4B7KA 2X2EA 4R9NA 4XUEA 5DI3A 5CCBA 3N5KA 4RLQA 4F86A 2WWHA 4C82A 1DLBA 2E76B 5LYJB 1UBHS 4MWTA 1RI4A 2WVAA 4R2MA 1K8RA 5BP7A 5IEJA 2IBTA 4JBYA 3LZCA 1NZDA 1KZ7B 1XXHE 5G3ZA 1CP2A 4V3CA 2X9VA 4DUPA 1H3NA 1M2WA 1QQ7A 2WP8J 2BUAA 2X8LA 3RVDA 2VCEA 1RC0A 4IJ5A 4L7QA 3VZQA 3KQTA 1P4RA 3AG2B 4CLRB 2IHTA 3DAOA 3ELWA 1FNJA 2O3QA 3RRXA 3GA0A 3TDKA 4LNAA 1MO2A 2ZR3A 1PNMA 1CFJA 1NXXA 2NO1A 3ML0A 2C31A 2ORIA 2XEXA 3AM5A 4N1AA 5FUVA 3VU1A 4L8GA 3VVLA 4RANA 5DNEA 1Y89A 4N0QA 1SULA 3BJMA 5A6SA 1BX1A 2PZFA 3NCHA 5JNWA 1FNKA 5G0SA 3ZQJA 5GINC 2I3AA 5ADHA 2D1SA 2KG7A 3AOEC 4IIUA 1KQNA 3IEWA 3VUFA 5LNK1 3IYLW 1ZAUA 1XZPA 3LCCA 3OHMA 4JLJA 1X9GA 3LDCA 1RC1A 2J3MA 1LDGA 3EEBA 2TYSB 1Y34E 1SGWA 5BQXA 3V8EA 1BYUA 5AM3A 4R6ZA 2B1QA 3IAM1 1H0KA 2L2QA 1JE1A 2ZQ5A 1R18A 2Y4UA 4IG4A 2JBAA 5A5GA 3L6RA 4C4WC 2OTJF 1ZX1A 4YRDA 1TJ5A 4XYBA 4B08A 4EYGA 1KWGA 2E55A 4WZAE 3IP7A 1TGOA 3K9CA 5BOVA 2JGDA 3FYUB 3R9XA 1Z0KA 1H0HA 4R8MA 5JJKA 1BA3A 1U90A 1WY5A 3OY2A 2WILA 2C4VA 3A2NA 4FTWA 1RCUA 5KDLA 2JFYA 1Z3CA 3DTNA 3EHEA 2VYFA 4KLNA 5JJCA 1QCZA 3NHWA 4YQFA 3FOEC 1ECGA 3ANTA 2W2KB 1ECFA 4XFKA 2CNDA 1ISJA 3EA4A 3O8LA 4ER3A 5CBPA 5CEEA 1QR2A 1YOVA 3GGDA 2EKBA 4AY2A 3UCXA 1H4VB 1ZP6A 2MINA 4J0JA 3SMQA 4ETIA 5B4VA 1XPRA 3JD4A 3CRQA 3WG7C 1G8JA 3T4UA 4HYEA 2F64A 2D74A 4PINA 1KYXA 1DIHA 3CEMA 5F7XA 3PC4A 5LQCA 1HOTA 1AI5A 1C8BA 4UM5A 3NBAA 3T1CA 3SDSA 2WD9A 1UP7A 3OIWA 2OFFA 3BZBA 5I8WA 3ZW8A 2C54A 4HUQA 3UAWA 2Q1TA 5IBPA 1TYCA 1W5FA 4AP6A 1QGUB 3N4YA 1K66A 1G2OA 3I12A 2QV0A 1I0LA 1M75A 3K0FB 2HQRA 1GTL1 3FCUB 3FNIA 4GX2A 3NGLA 3OUTA 5LA6B 5EVJA 1Y7HA 2JH8A 4K0KO 1B4DA 2WFZA 3WBFA 4F4IA 4B3DA 5CCXA 3ZHQA 1BIFA 2FN7A 4HLQB 4BFWA 1RHRA 2GSDA 2VNJA 2YMMA 4ITRC 1GSHA 1R3JC 1K7EB 3U2QA 4QUJA 3ZP4A 2PUDA 2C9DA 5CU7A 5BR4A 3NFRA 4BIOA 1IBSA 3NLLA 5CFOA 3WRYA 1MO6A 3ITNA 4II7A 2VP2A 4LJKA 4ND2A 4DNXA 1E1RD 2UZ3A 4CM1A 1DAPA 4DJJA 1GDTA 2VP6A 2H4YA 2QL7A 3BYZA 3GNLA 2Y0IA 1VMGA 1U7PA 2IYWA 3EG9B 3LAWA 1IPFA 3NETA 3NP7A 5I7WA 1EP9A 4EGSA 4LF9O 4LRYA 1YK1A 3BZUA 3DO8A 5KBYA 3MJHA 1N0UA 1SBHA 2YINC 1G6HA 3EFOB 3IR7A 2XUPA 4QLAA 3QPBA 4EK9A 4TXNA 3G80A 3AILA 5KKNB 2V6IA 4ZJYA 1RKBA 3OOEA 2LKDA 1A69A 1NVEA 3PP8A 4A2QA 4X1YB 5DISB 2QAGA 4F2GA 4M9QA 1VQ8F 3A6EA 4UBNA 1U9ZA 5CIWA 3WLRA 3P2YA 3EBLA 3FAVB 1QYRA 3ENWA 1SKYE 821PA 4WFQA 1PNOA 3GLIA 4O2LA 3ZBHA 1EMDA 4IEIA 2YJ6A 2YV3A 2ZXWB 4ZAWA 3RK1A 3F73A 1ID8A 3WGQA 2C5AA 1KEUA 1CEZA 4X8AA 3HB7A 3ZN2A 3W3AD 1JQ0A 1WEKA 3ICEA 1T8RA 5TQJA 4CKBA 1GOTA 2JANA 2NX2A 2VOJA 2O0MA 3FPKA 3MT9A 4N12A 5DI3B 5TARA 3S27A 2R7MA 5DNVA 3P0JA 1K86A 4ISBA 3CG4A 3W7AA 1BDHA 3GDFA 1S1MA 1PL4A 1E20A 3NKFA 4CTNA 1G4YB 2O5VA 4KODA 5JAZA 2WZCA 2VHZA 1XK7A 4I8DA 3RHFA 1E5LA 1K4YA 3BL8A 1FJGB 4LRSB 4S1PA 3S5JA 4ZCMA 1RHQA 4BWVA 4CUJA 1BVRA 1DPFA 2HY7A 1G3MA 4I8IA 4X00A 3WAGA 3SPJA 5LL6Y 1JB9A 2DPYA 2BE7A 2VBIA 2DUUA 4RDIA 4X8MA 4UCXA 4DM4A 3RC3A 4BJ1A 3MA0A 2CMKA 1YC2A 1V9SA 5BW6B 3VHXA 1FXHA 1NQUA 1TQDA 1J0BA 2HMYB 3KEFA 2VT3A 3LC1O 2Q99A 1BGWA 1PFKA 4R2KA 4UXIA 4ZYWA 3DD1A 4KMOA 4DMHA 1HLPA 1SC9A 1J9GA 2DJIA 4INPA 1W85B 2C2AA 1Z6XA 4QWWA 4ROTA 4ZV7A 4YDHB 2FW0A 2OC4A 4HDKB 1VIBA 1Q3HA 3HK2A 1J20A 4HB4A 5ICGA 1O0CA 3RWBA 3ICCA 4O3FA 4JI1O 3K0AA 4J7CA 2GCGA 2FQYA 4G8DA 1F8FA 4QQNA 4Z9BA 2UXCB 3ADDA 2COEA 3HWWA 1D8TA 4LF7B 4XD7D 2C42A 4Y2PA 2C8VA 2V9CA 4OGGA 1USGA 1XT6A 4L2IB 5GTDA 5JDIC 1UM8A 1X74A 3TNJA 1OBVA 4Z9FA 3CY6A 7GPBA 3CRW1 5JNTA 3WV5A 1A88A 1J99A 3HU1A 3L9XA 1GNVA 3LF1A 1GM9A 2P0EA 4OK3A 1AA9A 4ZOQI 5AW5A 3GLQA 4QAJA 3NTRA 1YGPA 1OD6A 2XHEA 4AULA 4BQPA 4D9EA 3M5PA 1KC1A 3GT4A 2G4LA 3QUQA 1Q43A 4Y2XA 5T8KC 4E5NA 2N74A 2VK4A 4BVKA 1ZC4A 3L6BA 3D81A 2O3TA 4NFLA 4HUTA 5BNTA 5C34B 2H8PC 4L9RA 4LK3A 4Q3NA 2QNRA 4NPCA 4FX2A 1TQ2A 3ZBPA 2BBTA 3BIJA 3GD7A 1QR6A 2UYJA 4DJEC 1JSXA 5JFGA 1PUIA 3OQ6A 3U4AA 4K35A 1R16A 3QTYA 1E94E 3CMAV 3CC8A 5T4BA 4J94A 3NHMA 4PLWA 4X94A 1XTKA 2RB5A 5CN0A 2X1LA 1NY6A 4HV4A 4EKYA 4JI8O 5I7SA 1OIWA 1QHEA 1T0JB 2IITA 4GZ5A 2D4HA 5L3RA 2BM9A 3ILXA 4MGZR 2WB4A 4TXMA 2RFLA 2FN4A 3GO4A 3JATA 1TIKA 2QWOB 2Z1NA 4KQHA 4DLWA 2Q29A 3AY7A 4QQ8A 4JLSA 2FZCA 16PKA 1H8ED 1SN7A 4FJCC 1RKVA 4OG2A 4UC0A 2FPMA 1Z4QA 1XEWX 2V9ZA 1V39A 3DE3X 4WZBB 3K6SA 1SOVA 1QM5A 1VK3A 1ZK4A 1OPXA 3F0EA 2FW6A 1K9SA 2HPAA 4PBSA 2X41A 1GZ6A 1Q91A 2V1UA 1ACMA 3AOGA 3TCXB 5IFLA 3QKUA 5A02A 1SVLA 1MQ8B 2ZYDA 3CEAA 3LFOA 3E48A 2FWIA 3H5LA 4IXTA 4JS0A 4C20A 5IANA 2ZBVA 3PFFA 2UU9B 1IVYA 1VQMF 4KAXA 4CH4A 4RD3A 1UBCA 1YKFA 2XQIA 2IDKA 1QRTA 3NC1C 3VDMA 4RGBA 1PLKA 5CX1A 2HRYA 1J25A 1UIMA 4Y1RB 2QBYA 4OFZA 2EEZA 3L74H 1OFUX 4AI6A 1CB0A 1QVWA 1E6WA 2VQFO 1QZUA 3K1AB 2XZLA 4G28B 4NMMA 4INZA 1B3QA 1WTCA 1W2HA 4B6FA 4PXSA 3CJTA 4YJHA 3MQWA 5HY2A 3EZYA 3HVHA 1U8UA 4GWGA 3TZQA 3PKIA 1Z83A 4R9SA 2ANCA 1KAEA 5BWNA 2IXAA 3OTGA 3L0CA 1U1FA 3L6CA 4HXYA 4MW4A 1XVIA 2R5WA 1O5TA 3B48A 5A4FS 2GILA 2MQEA 1YL5A 4EW6A 1IBKO 4X7BA 3F3YA 4DWOA 1E1DA 1A27A 1PHRA 4PDVA 1UOPA 1X7ZB 1JVBA 3FNGA 4TLEA 3WS7A 1E6UA 2JD0A 4DDMA 1RBYA 1SBYA 4EBBA 4QA9A 3FDIA 3IMFA 3VQYA 3BD8A 1E9RA 2FSSA 3SQWA 9MHTA 1QIMA 4TLLB 1YULA 3IUJA 5LN1A 1DWOA 5LD2B 2YHIA 3B6ZA 4JI2O 4Z2AA 3SZLA 4GSYA 4GXTA 4EPWA 1W1WA 4ZVVA 1MNAA 1RJWA 3NHPA 1YZTA 2WOOA 5KHGA 3A1SA 3DOCA 4YONB 3BB1A 3IV9A 3OG9A 4LJ8A 3VH4A 3SQXA 2JD1A 3EIWA 4EPRA 3VQWA 2QTPA 2BCJQ 3GRRA 1OWLA 4NAUA 3WGGA 2CXTA 4LZNA 3IFXA 2A5JA 2WE8A 4WN9B 1A7KA 2L19A 1HUQA 3DCIA 5ES3A 4HKTA 4B43A 2V7EA 5CVUA 4G84A 4RABA 4OQNA 4ZQCB 3EORA 3H7AA 1H3EA 4OXXA 2XCOA 3STLC 3RV4A 3BEOA 2DUMA 3WK7A 3RRYA 4DRXB 4EZEA 4NKGB 1ZYUA 2ID7A 3KBBA 1XCPA 2F67A 2HA0A 2I55A 1NIPA 2Q2NA 4LXXA 1U5BB 1WZ2A 2WJWA 4CM3A 3U7QB 4ISCA 2GA9A 5GGYA 2OVBA 3QEOA 4MYDA 3TL2A 4J11A 1P74A 2B2XA 2G1UA 1KEEA 5A9SB 3OTFA 2PQ6A 5DM0A 5D5QA 5AI0A 3DBRA 5HCIA 3H8JA 5BUZA 2JK1A 3CKYA 3TJZA 4BQNA 1CRLA 3Q0EA 5ALDA 4ZVPA 2BFDA 1C3VA 3O21A 4XEHA 1M8GA 4L9AA 4CCAA 1VARA 3BSSA 4UVGA 2XMGA 3VV3A 4AG3A 5F64A 1BDMA 2CWWA 3TD3A 1NMEA 3ENQA 3ZNQA 4O33A 1DK1A 4L6AA 3C9RA 3VBBA 1QVFU 3KR1A 4TXHA 1ROPA 4OQPA 4TL9A 4Y1EA 4ZO8A 4FD3A 5TF0A 4D8YA 2V54A 1RPZA 1QXSA 3COWA 2BGKA 2HWYA 3Q1KA 1KQSU 4CQLA 2GUZB 3MTBA 1GRVA 2YNMC 3ER6A 2EKLA 3SR3A 5EWRA 2DWDC 4C4ZA 3EEOA 3MQFA 5B3LA 3T9AA 2DQZA 1Q0SA 3NANA 2EJWA 2GBPA 3ZZNA 2QX8A 3G85A 5BXQC 3AC0A 5EB1B 4TZ0A 2LQTA 4A2WA 1AC5A 4G4WA 5IT9M 2VSYA 1ZUIA 3K7EA 4H0FA 4RPIA 1DBQA 2G88A 4R84A 3SIXA 4EO7A 5IKMA 1LLUA 1R12A 1TT7A 3CIFA 3COPA 3E7XA 3HUUA 4IMRA 3L92A 3QKSA 5K0NA 2OHOA 4AO8A 4BB5A 2EJRA 2GZRA 3VU9A 3WLKX 2ZB7A 4US2R 4HNGA 1HA3A 3TRDA 1N0IA 3ICQB 4QGPA 3FYEB 4G25A 1V2HE 3LWQC 3TGWA 3M6AA 3C6YA 3HTXA 4B3JA 1XHXA 2CCJA 1ZVQA 3BGWA 4LE1A 4R1NA 1GGKA 5CT9A 4ZRNA 4D3XA 3R6GA 4RQUA 2ZSJA 3UV6A 1L7EA 2XRMA 5DXAA 1S4QA 4AO6A 3SBDA 3WKEA 1EVJA 3M99B 1KSJA 3UBTA 3ZN1A 3A6KA 1SR8A 2QI9F 3FNHA 4JNKA 1AQNA 2D2XA 3DR5A 2FXIA 1TCAA 2ZJ3A 5BWCA 4DA7A 4LGVA 2X77A 2D3OW 1FNMA 2TSYB 5ICFA 4LDNA 2F4NA 1OCRC 2W2OA 3OJCA 4TN1A 4BO7A 4E07A 5KNDH 2ZRGA 1XMOB 1GYRA 3FTFA 5B4UA 3WX0A 4X9XA 1P4GA 2OFPA 3UICA 1K89A 2Q62A 3AUAA 2YHAA 4J7AA 2R3SA 1OZAA 2HADA 1IHXA 5SYMA 4XJTA 1FLVA 4HLNA 3DE1X 3S0HA 1SU6A 3OPYB 1DX6A 1DIAA 3F2IA 5ALOA 4AS3A 2VJQA 4QPPA 1G4AE 2Z1EA 3D4OA 5KDDA 4QBFA 2BUCA 1BHAA 3KCQA 4FVTA 5J9FA 4UOZA 2OAP1 1NOKA 4HG2A 5B6JA 1FYFA 5D6OA 5BQ3A 4Q4JB 4CT4B 4JMLA 3E18A 2NZWA 3H84A 1YB6A 1RAGA 4JBXA 3CQ9A 5DWVA 1U81A 1FQWA 3OLQA 2PGOA 1L4KA 2QM8A 1M2EA 3EVGA 2DTXA 3DE5X 3JYOA 3FF1A 4E09A 3F0GA 4H4CA 1SU7A 1E1LA 1HZZC 3SXJA 5BY2A 5FBKA 5L4LA 5DSZA 1IWOA 1MMMA 3DFMA 1Y6XA 1FMTA 4OMUA 5CH8A 4BVFA 5JEDA 1F2TB 4ZK2A 1QBGA 4DR2O 2WD7B 3ECCA 4F11A 3AL0C 5DV9A 3H18A 1L5QA 5EINA 3ZPXA 5A71A 2AJCA 3O82A 1KI6A 1WP8A 2YNMD 2PKWA 4JAAA 5CPBA 3ZRWA 2E3CA 2QRUA 4KFTA 4ZOAA 4DV1B 1RP1A 1FFWA 1DSSG 3W8RA 2P3QA 1UAYA 3RS7A 1JP7A 2OCCC 1TVCA 3FWPA 3IXQA 3NTLA 1TTTA 3HU3A 3MBIA 3BPZA 1J07A 2IH1C 3OBIA 4J9YB 4W63A 2E21A 4F46A 2JGMA 2QN8A 3OR7C 4E3ZA 1QQAA 1XNQB 2F8SA 3M84A 1MN6A 1XFDA 3B38A 1WUIS 3V8BA 2H3EA 1AKRA 5TRTA 1FY2A 4CG3A 4DW8A 3DQQA 1O8BA 3EBPA 2NPOA 4JUIA 2D2FA 3U6BA 3TLMA 1MABA 2BOCC 2RC6A 3GJ4A 3KTDA 1I5YA 3TJMA 4DCOA 4TLDA 2WA1A 1O7JA 2R84A 2QENA 3DB2A 4AWBA 3ZY3A 3W5HA 5A4AA 2W6ZA 5FPQA 2Q3HA 3UPTA 1R0XA 1VIMA 5F5LA 3CCEV 1G7SA 4LY9A 2ZPUA 1YQWA 2P9QA 4PYIA 5DNYB 1X80A 2O1EA 2P6YA 4S3MA 3C3MA 3AU8A 1XQ6A 2X0DA 2G76A 4MHSA 4RPHA 2R6GA 4KXRA 5D1NA 2CFCA 3HPLC 2P2CA 1J23A 3D64A 4RY9A 2WLIB 2J7PA 4GO1A 3RG2A 4PGFA 2HTFA 3B2QA 2Z0MA 1V5GA 1MDBA 2V7QD 5CXXA 5AW4A 2CCKA 2HSZA 2OB1A 1CFZA 2ZRQA 4UBKA 4JASA 3R3WA 4X8LA 4OCZA 4P3XA 3SBOA 3DTUB 4FONA 1BXKA 2DHEA 1Y6GA 1NUPA 3L7OA 4YP9A 3SC6A 3O4HA 1VL8A 2ZCUA 3ELYA 3FRJA 3OZRA 3ROPA 1E63A 1PJZA 2IU6A 4MPRA 3VJKA 1P2BA 1Q7EA 1KWKA 4KX5A 1OA1A 3EDQA 3VMFA 3M6FA 2DPHA 2WOJA 4CEJA 1IUNA 5CURA 2QUKA 1H0RA 1R37A 2AG8A 1NRIA 3P10A 2WP0A 4L76A 4C7BA 1SQ0A 2BYTA 1L0BA 3HTNA 3DLAA 2R1VB 2EF0A 2IU0A 1VZ3A 2JDIG 2BFCB 2CHEA 2G07A 3OZSA 4G4IA 3DS8A 4JLBA 1JIIA 1T4CA 1UEIA 1XCGB 1IY8A 4K3UA 4MPTA 3PEWA 2Z43A 4DCUA 1ST2A 5HF9A 1ECLA 2QSZA 1ZSPA 2P68A 4HTAA 4KP7A 1N1MA 2PX3A 2IU4A 5K3DA 5M7EA 5L3SA 2H9IA 3BGVA 2P7HA 4DCSA 1GUAA 2RHBA 4RDXA 2I1LA 2YVQA 4ZHQF 3DE0X 2N47A 2I2BA 4R1SA 1A2OA 4EARA 1PJBA 1MB3A 2FW1A 4DIBA 1V6AA 1NJIH 3LUBA 1YZ3A 2PH7A 2QSYA 2AN3A 3I2IA 3GG9A 5CIYA 1HQKA 3F98A 3T1HO 2WG1A 3A9SA 5FJIA 4YIOA 1AROP 4UAGA 5LP1A 2HF8A 1U8TA 3U0OA 5IM5A 4AECA 2YYYA 4JI4O 1WF3A 5CX4A 4KL1A 2RHDA 2CVLA 5JD6A 5CX1B 2C7OA 3L1IA 2ORED 3I9LA 2CVQA 4RVGA 3HBJA 2EBOA 1OCEA 1RXIA 2P4HX 4LUCA 2IIPA 5CK5A 4COOA 5C5EA 1RZVA 3FCOA 3I3OA 2VJOA 2YHBA 2H08A 4FEGA 1EXWA 2QT1A 3A3PA 3P5BA 3MDOA 2HWWA 2G17A 5JPDA 1RP7A 4UTZA 5LLDA 3ZWNA 3UFXB 2NOAA 3B78A 4K7JA 1VQKV 3RS5A 3FYIB 4DC1A 4IFIA 1CUZA 3SC2A 2ZJ2A 3CZAA 3O4FA 4MROA 4PC1A 1E9DA 4V02A 5JE8A 5LBIA 3QLVC 5LDHA 1FMJA 2VHUA 4I55B 1CJVC 3R3XA 2H29A 3V1LA 1OGYA 2IYVA 4X0EA 2Q27A 2GM9A 1EA5A 1JW9B 1JJ2U 1MVOA 3EG9A 3IBYA 1LI7A 3NTOA 2XMSA 3P9PA 5AXAA 1SURA 5HIJA 1ZXXA 2YEVB 3GV0A 1RBZA 3AW9A 3M6IA 4KYUA 3DT8A 1CC1S 5KOJA 1JX9A 1WXFA 3G67A 2FAXA 2HM7A 1C7JA 4MQ5A 4C0AC 1MO5A 3IUSA 3R7BA 3LUDA 1XMIA 4Y6RA 3FLMA 1MUUA 3CLTC 1Q12A 3N7TA 1F4NA 5ISMA 4MVSA 1AK9A 2UVDA 3KQMA 3REQA 3EWIA 1CZKA 5H81A 1E2PA 1B04A 2ZW9A 5CEJA 3HKEB 4NK5A 1BMFA 2H18A 3MPUA 3VAYA 1ISSA 2YYSA 4CV1A 2JKYA 4G5QA 1NS1A 1VHDA 3QM1A 2Q6VA 1FYJA 1JEQB 3RYIB 2A0YA 2FGJA 3CURA 3EWSA 3NALA 5H82A 2HRQA 2WG0A 3RJMA 4MP8A 1E5TA 4WASA 4TYMA 5CA0B 2FZ5A 2JBHA 1C2YA 3DL0A 4HMOA 2QKCA 3VOAA 1Q0UA 1ZGAA 4J03A 1U8CB 1E58A 2HU7A 5TVGA 4N7BA 4QPDA 1MZFA 1DDIA 4RVNA 1I2DA 3O1LA 3MT0A 4MCJA 2QRLA 5E7MA 1KE2A 1WMBA 1G20B 5FT9A 1AY0A 5C81A 1OT5A 1NFQA 2PEYA 2JFGA 1RZRA 1A5TA 1RADA 1YDEA 1A9RA 3EHBB 2ZAYA 3BAFA 3FGZA 3TFQA 1E1QA 2ZSAA 4Z3DA 4QG3A 3ASVA 2NMVA 2VUUA 2ZSEA 3DZKA 3F4LA 3CLSC 3KG2A 5HWEA 1E9EA 1KJJA 1NQXA 2VJMB 2Y1FA 4I5FA 3NEJA 3Q3HA 2PTMA 4DBVO 5BVGA 4MQFA 1KO1A 5EO3A 5ECYA 4IOJA 4NOJA 4PYRA 5LOVB 1XRSB 2OB2A 2P0YA 4LBZA 6ADHA 3GAMA 4QUKA 4BNWA 1JS1X 3TQRA 1QD9A 3KXKA 1T26A 3PWSA 1NSTA 1Z4KA 3UGKA 1A9YA 4NARA 1H2ZA 2GF9A 3VPBA 3O65A 1BXRA 1E9FA 3T8YA 2QX4A 3KAQA 1MX1A 1UXJA 1T6YA 3BFXA 2ONJA 1GKFA 2B69A 5ETJA 3N86A 2X0FA 2UU9O 3BIXA 5FWDA 1X7WB 3G2OA 3I4LA 1YQNA 1EVLA 1IMJA 1IOLA 2FWRA 2PA3A 2YBEA 1TZMA 1ZJ5A 2F48A 3KT0A 1UM9A 1MA3A 3ETHA 3IT2A 4HH0A 4D9JA 2YRFA 3AEUB 1ILWA 2AW3A 4FZRA 1TUBA 3UT5B 1UKEA 1U8YA 1SU4A 2BMVA 4PSVA 1QO0A 4PGHA 3P2OA 2ERXA 1L5KA 1JTEA 4V03A 4JB2A 2X0RA 1TQ8A 2VNHA 4FYMA 3VBCA 3FFXA 1D5AA 3MT7A 5I9MA 5BNIA 3K3WA 3VCZA 2P3OA 4KHPO 1JIQA 4S1OA 3PR2B 4IIHA 3QRWA 2Q7HA 4M87A 3DZJA 1N5RA 2HKIA 3F9RA 3QKTA 2OC9A 3CV3A 1LF5A 4JOBA 4CYMA 2RE8A 1CLEA 1MH9A 3NTQA 2VXBA 2P4UA 4PC2A 1Y1KE 1VE7A 1YJ5A 1Y80A 1QOQB 4WBNB 1KC8W 4WOJA 1X0XA 2CK3G 5B1BB 3D7KA 1IN4A 4OXYA 4YAEA 2J0VA 4ZA2A 1DAHA 1UH5A 3H16A 4M9UA 4JQZA 4PSUA 3A10A 4EB6A 3BAZA 5HX7A 1JDVA 1ST3A 1VL2A 3KHNA 3OE7A 3QVXA 4W82A 3BEHA 2I7TA 3LKDA 1U3CA 2X4GA 5CFLA 2H1HA 2DHCA 3H9BA 5IYZA 3L70H 1LZKA 1W4CA 1U5AA 1YZVA 3AP2A 1Z5ZA 2CJWA 1PJQA 3BXXA 2X3UA 3V00A 4JDUA 4BN5A 5FX2A 2O5CA 5K7SA 1QQBA 4FWIB 2IX3A 1NUHA 1OV4A 4FI3F 1JZSA 1P7BA 3OAAD 3UHAA 1OBHA 1PLLA 1X39A 4UTOA 4WIAA 1CJMA 3WJ2A 4OXRA 3D2LA 4Q3EA 4TV9F 2OESA 3U4CA 4BYMA 4I5IA 1KYOF 1NJSA 4IIEA 3I52A 3BCRA 3DVRX 4KV7A 2YVKA 3EPPA 4EELA 1VG8A 4R2WA 4A8TA 2TMKA 5CXQA 1NV8A 4MV0A 2X9QA 2ENWA 2FPGB 2RGEA 1QH0A 2W6NA 3HGQA 1C8VB 1D03A 3L7DA 4XYEA 5KUTA 3QG5A 1D2EA 4JLNA 5F9FA 1J5PA 3INTA 3MWDB 4DIMA 2NZXA 4W1QA 5TS2A 1QC5A 4GLOA 1EEXB 4NF2A 1YS7A 3HCFA 1PQPA 2PQ2A 1D7AA 4ZI5A 4Q3AA 4U0JA 5FBRB 4Q1AA 3GZNB 4LMPA 4QDKA 5C18A 1WVMA 1JHDA 3DKPA 1NP3A 2GEUA 2JS7A 2QUHA 3WP0A 2WHYA 1C0PA 2CFSA 2LE0A 2V7PA 3THOA 2YOHA 3ESXA 4P2BA 3R76A 3T7AA 1F1BA 2JFHA 2HQSC 4JYPA 5H4GA 2AOTB 3KEOA 5KTKA 3U60B 2GRUA 4EKNB 3G2HA 2OZVA 3TNDA 2XCTB 2R60A 3P71T 5E2IA 3WQSB 2FG6C 2HP0A 2W58A 2WJYA 3ORHA 1EVZA 3SZOA 2GA8A 1O2DA 3RFFA 2ZBGA 4GM1A 3ENVA 3ZV5A 1VG0B 3SLKA 3GIDA 4CDRA 1QKJA 3AESA 3I45A 3K1AA 4YJDA 1NXQA 1U28C 3JASB 1AGYA 1U1CA 4H15A 1BU5A 1V4VA 3IEIA 2ZEJA 4Y1RA 5H3HA 3QMVA 4M98A 2ZDIA 4RH1A 4O63O 1XDUA 3FZQA 3C8UA 3VNUA 4N8DA 4CKWA 3A2KA 1XZQA 2ZYGA 4GG1A 3UNXA 4HJXA 4UBMA 4GM0A 4LX0A 5FTLA 1UK8A 1B0PA 2FRVA 5JPIA 3OF2A 4X93A 2B33A 1PZGA 5JW6A 4ZTBA 1FXSA 4LRWA 2GVIA 2BCEA 4E46A 4H1HA 4W4LA 5THQA 1A50B 4B3GA 4RK0A 5KNBH 3OPYI 4YUYA 1P3DA 2FX2A 2XMRA 3FPFA 3LOQA 2Q6OA 1EFVB 1U7UA 5I48A 2QQ0A 2QYOA 3TZLA 3UHOA 3TYXA 3D36C 4NU6A 4QARA 1T2UA 1SBZA 3GJ3A 1C4OA 2A88A 3K9HA 4KGZA 4NU5A 4F6CA 4OYRA 5KHOC 4KO3S 3ZU6A 1FDTA 2W0MA 1DC8A 3HRIA 4GIBA 4Z1OA 1YJCA 5CFQA 2XCSB 2O5EA 5LXTA 1SKUA 2ZIAA 1O96A 4ZYXA 4R8CA 1UKCA 4D3FA 4N01A 1PDOA 3IURA 4I46A 1V43A 5B2EA 1GCIA 1NI4B 2WPDA 1Q6IA 1IXKA 3QUCA 4TKUB 4BRUA 2ZIOA 2XSZA 4PO9A 1W19A 4RIIA 3X3HA 2FGYA 1SZXA 2GZ3A 4Y9RA 4ETWA 4KGDA 1RKUA 3OLYA 1K3FA 2DEUA 2CSXA 1OPRA 2P8JA 3C39A 5ELLA 1K3EA 4MA5A 1RRKA 2Y4NA 3GP3A 4PC6A 1XEAA 3JSXA 3K0BA 4ZQGA 5H0IA 4Y9UA 1BA2A 5ITZB 2GOYA 4QXOA 5FL7D 3UJBA 2C3PA 4UJ5A 2VFAA 3ER9A 3FUWA 5ILGA 1OASA 1K8AW 4HQFA 1EEHA 4B4UA 4YLGA 5LUAA 1E3QA 3LP5A 4B34A 3LS2A 2Q6TA 3C8HA 1PEDA 2JPDA 2FPKA 1BCRA 2WT4A 4XWKA 1MB4A 4JUBA 5T6MA 1P4SA 1WPBA 1AB6A 1GL9B 1UFKA 2QW0X 4Q4HA 4GQAA 1C2TA 1X52A 3B6NA 2CF5A 3T3PB 1NBAA 3WL4A 4BE7B 4GSKA 1A4UA 1E1QD 2ZF8A 5DEDA 2HIMA 3V9PA 2M6SA 2IA5A 3UK7A 3RIHA 1U80A 4MQMA 2PVSA 5IBCA 4KLAA 2WWXA 4CIYA 3N8DA 1JZTA 1KA9H 1IY0A 3J81A 3M70A 3SZMA 4V24A 2QXTA 4WNYA 1ABBA 4BMPB 3DAGA 4C0JA 1LK5A 1P7CA 3W1EA 3MCVA 2AXPA 5GJCA 4F84A 4PS1A 3CCVF 1GMGA 5A6SB 5E6SB 4X45A 5B64A 4LQ4A 2LO1A 1GPWB 1P6UA 1MEJA 4YA6A 2ODQA 2EIJC 5HFLA 2A1TR 3UAXA 3PJDA 1CRZA 1ZL8A 1NDQA 8GPBA 2XR1A 3K1JA 1C0IA 2VQSA 3IAHA 1FVFA 5DCUA 4ZALA 4IIJB 1QVVA 2KS6A 1DO0A 5AJUA 5KDOA 1ULAA 4EFMA 5MF6A 2WHEA 2E18A 4PZYA 5HSGA 5BMVA 1LGYA 1RYBA 1V4NA 3HSKA 4JT8A 4N6NA 4NH4A 4EGFA 4PDRA 3DV2A 4JAVC 4H1WA 3FSEA 1N75A 1UOQA 2Z9CA 3H0CA 3QU5A 2AXNA 2IQ5A 2OA0A 3TMKA 2OXEA 4X1IB 3N05A 5LYJA 3NV9A 4PGAA 4R1MA 1JKJA 2VJYA 4JJEA 3RJ5A 3L02A 4JYZA 2WLJA 2VDPB 2WTMA 1PEYA 4IICA 2ZTLA 3KQOA 2YSUB 4OKSA 4GKJB 1NJIW 2RG1A 1HNZO 4K8ZA 4MUFA 3V7YA 2Q1UA 5EI5A 3AR8A 4KLZA 1ZD2P 3BF8A 3S2FA 4A0RA 1V1MB 4J29A 2NPFA 3T35A 1LDBA 2FDRA 3B3AA 2ADMA 2EQ5A 1QV7A 3EIQA 1L9KA 1MX9A 2V0NA 2XYRA 3A3KA 1AS0A 2NUPB 4RA6A 2C7GA 4ARCA 1T4GA 3QO7A 4J1TA 4KU4A 2FKNA 4Z51A 5J5CA 2OFWA 1EK2A 3BIFA 2ZS9A 1XTSA 3H2IA 2QWQB 3KSRA 4PZCA 4RKRA 3UMYA 1LK0A 2XAGA 1M6VA 3QPAA 1Q0QA 1BO6A 1CYEA 1ZWLA 3F7YC 4YY3O 1KZ9A 1QU3A 1ABFA 3QWFA 3PV0A 5FWXA 3DDUA 2CXQA 5JJ5A 4CCYB 4BX0A 1RVV1 4C6TB 2LBWA 3TM5A 4LF9B 1QONA 2RSLA 5CG2A 1EQUA 2GNAA 1HI9A 3DZFA 3MWEA 1Y76A 1IDOA 1UM9B 3RBVA 4WT7A 1WMDA 1X1BA 3WE7A 5EKDA 1QIFA 4OPMA 5EE1A 3ZWQA 2ZZNA 4I4TA 5BN5B 4EA6A 4AIIA 4UDNA 2W70A 3ABUA 3NRCA 4HEJA 4TQAA 4GOLD 4M7PA 3EULA 4NP6A 4Z4GA 1PQYA 1I6WA 3WJQA 1RQNA 1CTQA 1GSOA 3C97A 2XB2A 2D0PB 3SNKA 4G0UA 1ZISA 1A9TA 1YASA 4Y0VA 4F8YA 1BDIA 1I6KA 2HHAA 3FMFA 4WW0A 5CGQB 3RU7A 1BQ0A 2COUA 2Z3ZA 2GUGA 3GDGA 3NHFA 4G65A 4WBNF 2RBEA 4RF2A 3GLVA 3ZWKA 2Z3YA 3AG1C 2WJIA 4K46A 2JBWA 4BJHB 4CODB 5GVSA 2IYYA 3G71V 1TFRA 3DHNA 1UXGA 1YS9A 3FPHA 1XZEA 2Q50A 3UMCA 2C03A 2A06H 1HM5A 5F35A 1N6OA 1OJ7A 2H59A 1KUQA 5AH0A 3H2YA 3KQQA 3RSHA 4XSHA 4ENSA 1AKUA 3IB3A 2NLOA 1M2GA 1TT5B 1Z2PX 2F1IA 2XAAA 5EXSA 5EMKA 4KN9S 4QZVA 1I4WA 5JTTA 2G9UA 2GEVA 2ETNA 1OX4A 1HX7A 4LMRA 4MV7A 4MVJA 1UJNA 1IHDA 3EODA 3GNTA 5D3ZA 4ZVQA 4ZVSA 4BWYA 4D25A 5D86A 3GEIA 4R1UA 1B8OA 3ZXSA 3RUHA 2NUAA 1FJGO 1ZH4A 4CIBA 5CB6A 2HBZA 5EHXA 1FUIA 4YIPA 5F2EA 4PN3A 5AJVB 2CNLA 4ALNA 4JI3O 3BA9A 1E5VA 1L7MA 1X1QA 1CY2A 1DG9A 3G23A 1ZJYA 3W8NA 4GEGA 5HK9A 1JDNA 1KARA 2CXUA 4PAWA 5JCZA 1OFGA 2HHLA 2IJIA 4LH6A 1JEOA 5LQRA 3PLNA 1C7RA 2YZ2A 1M10A 2ZAMA 3CNHA 3FKSD 2KGWA 4RTQA 4MHTA 3V3TA 4LXTA 1PTKA 2GNPA 2I6TA 3WAKA 4EMUA 1PHPA 1QORA 1XJWA 3N75A 4YRKA 4M0EA 2XQKA 2Q3EA 3I0ZA 4MQEA 1UKZA 5HFMA 3C98A 1ESMA 3X2QB 3C3DA 4R0MA 4TMZA 1Z45A 4D0SA 3SE7A 5K2OA 2W2TA 4J2OA 3R9WA 5AKLA 2D3WA 4QU5A 2DY1A 2P2LA 3PNSA 4FLYA 4A6DA 4AUMA 4X64O 1RPOA 2GPSA 3LE8A 4KE9A 2QVLA 2CTPA 1Z8NA 5BY1A 2GEBA 2HJDA 5K8IA 2FR8C 1N2XA 3MILA 4AJKA 1DJOA 1WD5A 1YA4A 2H5LA 2A5FA 2AZ4A 1OB2A 1ZRNA 2XNDA 3SFVA 1Y66A 3AEYA 1IRXA 2VHJA 3HJTA 3W6NA 2FZ4A 2GX6A 5YASA 2WALA 3LT5A 4F45A 1LQ2A 4F9EA 1U3PA 5K3SA 3GLHA 2RMKA 3M7MX 4KK3A 1YITF 3ZBUA 5CA0F 2AG0A 3FUTA 4L07A 1JVNA 2PD6A 1OWPA 3CCCA 4OXQA 4D6TH 2Y4TA 4BPRA 1JIXA 3HA3A 1SZQA 3ZKWB 5IFKA 3E4DA 4CKBB 3HM2A 2ZUBA 5K8CA 1HQDA 1ZU5A 1FMCA 2SBTA 3G8AA 3GMSA 5EZ5A 4PFJA 3HJCA 2DFTA 2FW9A 4WPGA 5JYEA 3UWMA 2C5LA 4IILA 3ZMTA 4Q7LA 4KOEC 2PZMA 3WLHA 5CR9A 2ARKA 4BVLA 4QYIB 3RIMA 1SC1A 4QOGA 1GSIA 4MV9A 5G0VA 3DPIA 4TKLA 1ECBA 4GX0A 2BM0A 3AF4A 5FLXM 1JFTA 2P91A 3B2EA 1LJLA 3IIEA 3DMHA 4MVJE 3FD5A 2XDQA 2CE2X 4U7GA 4UMFA 1M56B 4YAWA 3E8GA 3NHKA 3RSQA 3ZY2A 2JI8A 5B3AA 3P2IA 3OURA 4LOKA 3NB0A 3QKWA 4NV3A 2W2VA 1GGEA 3LG2A 3ELCA 4EZBA 5LNK6 1ZZEA 1SCIA 1IX9A 2G1KA 5C51B 2HA4A 1Y33E 3BMNB 1CNMA 1Q16A 2E37A 3CE9A 3GJ0A 4J91A 4RJJA 3T99A 3UMSA 3AUTA 4Q1VA 3GFQA 1GPLA 1P49A 4IL6Z 4BRWA 2BMWA 2A9VA 2BRUA 2V97A 3AF5A 3BRSA 3OKCA 4AILC 3I55V 4WHMA 3UJ9A 1A0OA 2IKQA 4IHJF 4LV8B 4S12A 4LG1A 4CL0A 4BMVA 1EUZA 2JH9A 4QTUB 3BFPA 5EAIA 4UTPA 3NMUF 1JDTA 4NQRA 5KMGB 1L7RA 1UMDA 1VMKA 1TO1E 5C4IA 1YE5A 4KE8A 3R7WB 1T1IA 2VAXA 3RSFA 3ICVA 1YQXA 4QXAA 3FGPA 1DO2A 5B7QA 5AJWA 5KNBD 3FD9A 1V1RB 4ZHQB 2O1WA 1DRKA 1NSYA 3HJAA 2PGAA 5THXA 3WLAA 3T5TA 2GYYA 4YPOA 2REOA 3NTVA 2X13A 3QV1A 2NVBA 1GFZA 1ODLA 1TU3A 2JHAA 3B9BA 2DUJA 2HJ9A 5T8KA 4KL8S 1NVKA 3M81A 3RVNA 3SDBA 5ADUS 1GEGA 4JKYA 1D0SA 3KV3O 1JQAA 5REQA 4K87A 4EECA 1BN6A 2Z1MA 5EJ7A 1EX7A 1Z2OX 4M1WA 1UJCA 3MK31 5I9IA 2GBFA 1NI4A 3IMCA 1XMQB 4QGHA 2JEZA 3NHBA 5FADA 5TQ2A 2DG2A 2ZJ8A 1O96B 2CGOA 3CC2F 1A2BA 1GUFA 1K7YA 3IIKA 4CF6A 1T3TA 3TFWA 3BHJA 3U26A 4WCEV 4KN8A 3ZU4A 2C5FA 3PQ6A 3O90A 2QTVA 1U0SY 5CD9A 3IELA 4KVGA 2FC3A 4M46A 2F3TA 2IZOA 4XQCA 1X1TA 5FUYA 1BXZA 4IX1A 4B3IA 3QI2A 1HFEL 1RRFA 4I5EA 3I01M 4NZNA 5A4IS 5EKTA 4RQEA 3PUJA 1YQTA 3THWB 3G8YA 2CXOA 2EWWA 4KPEC 1YWGO 2FN8A 2UZ1A 2GDSA 1B8UA 3ONWA 3RODA 3T5DA 3P4EA 3DTYA 4DE5A 3HL4A 1F1JA 1A8UA 1X3LA 2HOQA 3AM3A 1UPGA 3QX7A 3H42B 4BNGA 4IH9A 4F1JA 5G0WA 1XEQA 2PXXA 1H23A 1U2PA 4H7KA 4JHXA 3KNZA 4KDEA 2IGBA 2CLIB 4JI3B 2BJHA 3CCUF 2VZLA 3F67A 3H87A 4KI0A 1P1RA 5BRAA 5IZCA 3CF4A 1RI3A 2C2GA 3EVNA 5HMMA 1OLXB 1ZQ1A 3LXXA 2FFBA 1WSWA 5AMXA 1JG7A 5KNCA 2F8LA 1IBCA 4LHYA 2ZWPA 1U3UA 1QGDA 3A3OA 4ITVA 1AKEA 3B1XA 1XVTA 1I6MA 3DKVA 2AHYA 2MSKA 3TD6A 1OXTA 5EJ2A 4N41A 3LYHA 3A05A 5JXWA 1C41A 1DZIA 3N8IA 4JBIA 1U0LA 4R69A 4RL6A 4XR4A 1P1HA 3QITA 1JR9A 4Q3KA 4A91A 2Y3IA 3OQVA 3FAZA 3UAOA 2LDBA 3KKLA 4PGMA 3PI7A 2BJWA 3FFTA 1F20A 3PJEA 4WF9V 3SOPA 2WAYA 1ZXBA 2YY5A 3Q12A 3RRMA 4JA2A 4MTXA 1A8QA 1T0HB 1CIPA 4X54A 2Y0EA 2HMAA 1JE0A 1ZNZA 2F3UA 5GZ6A 1GAJA 3HXOA 1U4OA 4NIMA 2WDPA 4CW7A 3PGA1 1BE8A 1AMNA 1O9HA 1XZHA 1DKRA 3CLKA 3ENNA 4HRAA 4RHXA 2SCUA 4RLSA 1DL5A 4Z7QB 2VSFA 2PRYA 3ZD6A 1QF6A 3QX9A 5BMVB 3I05A 1KI1A 1N5LA 4NBSA 4II2A 3LX8A 4YR7A 1NC1A 1YE8A 4C0SA 3RAJA 2YW2A 4RY2A 4K9KA 3RFCA 5BSTA 2CJWB 3VYVA 3CIOA 4BE9A 4BIMA 3BAAA 3UOAB 4UAJA 1D4OA 3QUWA 2OMKA 1GTG1 4GRDA 2KKWA 3AFGA 3KB1A 5T4FA 4MMYB 4YT4A 4X7MA 3MJRA 3SQLA 1ONNA 2ONYA 2ORWA 1BHO1 1SBIA 2V6GA 3NR7A 4OM8A 4P4SA 4OP3A 5IRCD 2BLLA 2QRVB 3FETA 2BR4A 3LNTA 3UM7A 2XE7A 3ZEIA 1RWOA 2OTCA 3FYSA 4CGZA 4B2LA 1X2BA 3HGMA 1KEKA 1JAIA 1VI5A 4TYNA 2ZVJA 1EVYA 2C2ZA 3N70A 4FMBB 3A9TA 4DNOA 1ZAYA 2W2LD 1OJHA 1OCRB 1R00A 1LUWA 1CUHA 1JLSA 4Q16A 1NRXA 3AYZB 1GARA 3JPWA 2H92A 1RPNA 2O7RA 2NWQA 3RWOA 1FZQA 1ISMA 2FQXA 3F0TA 3QPVA 2QX6A 2X4DA 3D8UA 4IDGA 4WY5A 4XR9A 5GY7A 1H8EA 2W93A 1EWQA 4BLUA 3OR6C 1FK8A 4RELA 1J42A 3D7SA 1RZ3A 4REMA 5KOIA 3VO8A 1KDPA 2X14A 3DMGA 3RYCA 1UDRA 1G59A 2F1MA 3R7FA 1UKYA 4R5MA 3M5DA 3FZYA 2HA7A 1MA0A 4V0MA 4CUKA 1DUVG 2PX5A 3J81k 3BJEA 1T8YA 3N2ZB 3C3KA 5EPEA 1Q95A 3AU9A 5TPWA 1WJGA 3TD4A 4P30A 1NMYA 1NOJA 3BILA 3KSUA 3NEPX 3OU6A 1JT9A 3AERA 1ZVJA 3AYXB 1XL1A 2INGX 1LQUA 3FWKA 4KOAA 4O25A 5CVVA 2VLBA 4BMCA 1E4YA 2NU9A 2HWXA 2OQRA 1LPNA 2MYPA 4MI1A 1CK4A 3RNOA 4P54A 1U1DA 2LW1A 2QM3A 2RCNA 3ES9A 3OBWA 3I1IA 4BNZA 4MUKA 1J2RA 4D9CA 2J3IA 1VPLA 3D6JA 4BX3A 3STWA 2HSGA 5JNLA 5H83A 1USIA 3SEQA 4WMLA 4DV2O 1KH3A 3AEQB 3GYGA 4UTXA 4RSMA 4UCFA 4ZCSA 3RH0A 3ZV3A 5LIPA 1SRQA 1CQIA 4KQJA 4Z4HA 1KK3A 1GADO 3JR7A 5FBZA 4D4MA 3DEFA 3S1LA 1Q82H 4B8YA 2Q0OC 4WKPA 1NMXA 2WM3A 4WXHA 5K9ZA 3ZHYA 3LW8A 3TETA 1SXJB 2ZE6A 1B15A 1HL7A 2IUEA 3JY6A 5ALJA 2EATA 1WLEA 4YXWG 1EZ1A 3LA6A 1UJBA 2Z30A 1KH1A 1E1QG 1M6HA 3PNKA 3MW8A 3R6DA 4RS3A 1T5TA 3C3JA 4NBLA 5DHAA 1EUDA 5LA6F 1FDUA 1ESEA 3OTOO 5JSHA 3UJ6A 3DBHB 3E8HA 2JVDA 1R6XA 3ZLUA 4UM9D 4DK1A 4B7UA 4TX1A 5JROA 5KTOA 4AYXA 1HFKA 1VJDA 2R65A 5A0VA 1ENYA 2YWGA 1N57A 3O4GA 5CT8A 1SG9A 3DSRA 1VA4A 4KQWA 3PEYA 5C80A 1HLDA 3OMAB 4CDNA 1DBRA 1UJ4A 2QP3A 3WRXA 1GA4A 1NV9A 2FZWA 1ZJ6A 1JPUA 4FB5A 4XSVA 4DCPA 2V9PA 5GAJA 4BCDA 3DZDA 1C8KA 4QHSA 2JLUA 2G9QA 1FUYB 3IULA 4BY9D 1I3LA 2ZCJA 2Y1EA 4JI8B 3CF0A 3GCDA 4XE5A 2VJNA 2VRWA 1JTVA 1YJNF 4RFLA 2YEVA 2BFEA 3V1NA 2Q07A 3LPLA 1U0BB 3IJRA 1PBTA 5JY6A 1G3RA 4MI9A 2IHNA 1MGPA 3GZJA 4GDMA 1H2SB 4IDHA 3CYOA 4U5XA 1RRMA 4GI5A 2PTGA 4PHHA 3A1DA 1B8NA 1WBJB 2GKSA 2RAPA 5KAFZ 2NNUA 2DQ4A 4QGBA 4RDCA 3PZBA 2WD7A 4FGUA 2VHWA 3REQB 3V4DA 2VDVE 4J0IA 1AN0A 3D01A 4TL6A 4L7VA 2JIBA 3AY3A 2W2PA 3DVSX 5E6RA 4DMRA 4MVJI 5TIIA 2H1CA 4IZHA 4CZ2A 3VPAA 1ZK1A 3GCZA 3G1WA 3AF0A 3QE4A 3GAZA 4CM4A 4M60A 1SHJA 1SUCA 3PEFA 4B3BA 3Q8HA 5BMVF 4OMDA 5G40A 5BR8B 2J9FB 2OO5C 1I33A 3CMAF 1E1RG 1PWHA 3LIIA 4W1RA 3THXB 1HZZA 1QHHB 2VTDA 3DKRA 5A5EA 4KR6A 2O2SA 2VYNA 1BJRE 1SBCA 1T34A 3FBAA 2G09A 3WMXA 5LL6P 2DZDA 1CXZA 3JD2A 2G9ZA 1H22A 1KVRA 3ZBQA 2VSQA 1SBNE 3T7EA 1R3DA 5AKYA 3H6GA 4S35A 1Y7IA 3VC1A 4JN6B 5BXZA 1GZ7A 4WOPA 3WYFA 5DYNA 1EZVH 2PE5A 1GTSA 1NZJA 2FPSA 3OGCC 3P2MA 1PJRA 2G40A 2AFIB 4EB6B 1P1BA 1L9XA 2GHTA 1JOYA 1NBMA 3LDAA 3FHLA 1U2QA 5LWQA 3FBTA 1RM0A 3O95A 2C29D 1A9SA 2HHHO 3IP3A 6PFKA 3FPIA 1KKDA 3F5WC 2CHSA 1E1MA 1L7AA 1WXQA 1DJNA 2KWIA 3EMKA 4XDGA 5IAJA 4P2ZA 1Q7YH 5MN4A 4G5SA 5H8WA 1U7DA 1XF9A 3RSLA 4IUDS 5AUNB 2P6PA 2IH4A 1ODEA 5IUKC 2AL7A 2H65A 5JEEA 2ZB3A 1G21B 3QTBA 3AKCA 1MORA 4B3SB 1ZO8A 1V1JA 4BFLA 3WNCA 4JI2B 3T94A 1I3OA 4UVEA 1ZA1A 5CDHA 3OGIB 1BQZA 3DHEA 4ZKIA 1ZNWA 2FSUA 3GP5A 5DW0A 1E2MA 1FQOA 4DN6A 4IXMA 1H2FA 4CEJB 1L5YA 2XF8A 5CVEA 5IYDO 1E3IA 3K04A 1M8FA 3DZBA 1J0XO 3CD6F 4B2PA 4O4HA 3ORQA 4UUBA 4ICIA 4B6QA 5HQJA 4L8JA 3BTUA 5DHTA 1W48A 1WUYA 3IEUA 3L7BA 5E1BA 1A71A 1UBFA 2BKXA 4JMPA 2WIKA 2EG9A 1TGVA 5BQFA 3DCNA <