4IIJB

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4iijB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4iijB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4iijB01
2RHHA 4B45A 4TUYB 3JATB 5JH7A 4DRXB 5BMVB 4YJ2A 3HKBA 1JFFA 2Q1XA 2XKAA 5IJ0B 4HNAA 4O4LA 5LXTB 4U3JA 4KWEA 1Z5VA 5CA1B 4EI7A 3HKCB 5LXTA 5M7EA 4X20B 4TV8A 5FNVB 4DRXA 4I50B 4I4TA 5JH7B 3RYCB 3VO8A 5KX5B 3VOAA 5CB4A 5JVDA 1TUBA 4I55A 5CA1A 4U3JB 3M8KA 3ZBPA 3WGNA 4ZOLA 4FFBB 3ZIDA 4LNUB 5FNVA 4X20A 3JARB 3JAWB 5MN6A 3WGLA 4ZHQA 2GVIA 3UT5B 3HKDB 3N2KB 5LP6C 5CB4B 5LOVB 2VAPA 3RYHB 2BTQA 4ZI7B 5IJ9A 1W59A 3N2KA 4YJ2B 5BMVA 4O4HA 4IHJB 5EZYB 4HNAB 5J2UA 3WGKA 3JAWA 2VAWA 1RQ7A 4O4HB 1W5EA 1OFUA 4TUYA 3RYHA 4ZI7A 5IJ9B 5LOVA 3M89A 3JASB 5CA0A 1JFFB 3HKBB 3VOBA 4B46A 4O2BA 1SA0B 3RYIB 2XKBA 4O4LB 3RYCA 5EIBD 5LA6A 4F6RA 1RLUA 3RYFA 4YJ3B 1W5AA 3HKEB 5JQGA 3N2GB 2RHLA 4ZOLB 1Z5WA 4IIJA 3V3TA 3N2GA 3WGJA 4O4IB 3JASA 5C8YB 5CA0B 5KX5A 4IIJB 5JCOC 5EIBC 1W5BA 4U39A 3E22B 3JARA 5LA6B 4F6RB 5KMGA 4E6EA 5MN4A 4O2AB 5EYPA 4YJ3A 2R6R1 3RYFB 3ZBQA 5JCOA 5LYJB 1W5FA 3JAKA 3RB8A 2BTQB 5IYZA 3VPAA 3CB2A 1TVKB 4O4JB 2VXYA 2BTOA 5IYZB 5ITZB 3WGMA 4DXDA 1FFXA 4I4TB 3UT5A 4O2AA 5EYPB 5LP6B 4O2BB 2R751 1TVKA 4O4JA 1W581 4WBNB 5LP6A 4X1IA 5IJ0A 4M8IA 5GONA 2Q1YA 1SA0A 3RYIA 4TV9B 4X1KB 4EB6A 3R4VA 3VO9A 3C8LA 4WBNA 4TV9A 4XCQA 5JVDB 4EI9A 5MN5A 3JAKB 4IHJA 5GONB 5EZYA 5J2UB 2RHOA 2VAMA 4I50A 4O4IA 5C8YA 4TV8B 3JALA 3E22A 5ITZA 5KMGB 5J2TA 4EI8A 4X1KA 4EB6B 1FSZA 5LYJA 4ZHQB 1TUBB 4I55B 1RQ2A 3JATA 3HKEA 5JQGB 4LNUA 4FFBA 4X1YA 1FFXB 5J2TB 4X1IB 2RHJA 3JALB 3HKCA 4X1YB 3HKDA
chains in the Genus database with same CATH superfamily
1JLMA 5FB3A 3H1LH 1K6MA 1T8UA 4RUEA 1A72A 1ZY2A 2V9ZA 4C7XA 2XB8A 1X52A 4HAZA 3SMQA 5FPRA 4KWCA 3JPYA 1V48A 1A7UA 4FUQA 2EZUA 1CUJA 1I33A 1EK0A 1L4HA 2JD2A 3MVEA 4J0QA 1W0CA 2YIDA 1W4ZA 4R9UC 5L3FA 3E86A 2Q9UA 5KWIA 5L7YA 2JNWA 2BE7A 3KUXA 1ZICA 1EGHA 2IXBA 3F5SA 1GMGA 4F06A 3V6MA 1OILA 3CR8A 2P1ZA 2R4QA 2P7HA 4Q1BA 3VM6A 2ZXUA 2O1EA 1E3JA 1YB7A 2X4GA 3GXOA 4EGAA 3L0SA 3R9WA 5E7JA 3KPJA 3JVDA 3OWXA 1VKJA 1KIMA 2FETA 1MV5A 2DHDA 2L82A 1AU9A 3A4YA 4KUHA 2CZWA 1AXRA 4QRDA 3ETHA 3PXXA 4RU1A 5J9FA 1I6LA 3TE7A 4NOLA 2AOWA 2JCSA 2VSFA 1OFUX 2NACA 3H04A 4JA0A 3WL3A 3SX0A 5EUQB 1A8QA 1GP2A 1U2QA 2VSYA 3DH0A 3UQZA 4AF8A 2A9PA 1PW7A 1WBDA 4OPMA 3X1YA 4BPBA 5JZMA 1JPJA 1PWZA 2MSDB 3PJGA 4DIUA 3C0KA 4ZO9A 5IZ4A 1XELA 1KA9H 2RC6A 1DCKA 2WG1A 3BJIC 2M7WA 2X0IA 1KFJB 3D4PA 3CXCF 1YDHA 1OXKB 2Q49A 3C3EA 3EPKA 2PHNA 3BEDA 4S2UA 2GPSA 4KUGA 3L0PA 3RAFC 2C1ZA 3BVOA 5JQGA 3K1ZA 3T54A 4ENSA 2YJZA 3E8FA 3MSXA 2NPOA 3BA1A 3MWFA 3S2GA 4ZMBA 2OZLA 2F2TA 2ZETA 5CA0B 5LWQA 3UT0A 5JJCA 1U99A 5IT9N 3QWIA 2CLKB 2GBCA 2WHXA 4HYYA 1P7YA 1B0PA 5MFZA 3R7FA 2IVZA 2ADPA 2Q6KA 1I7NA 1N8NA 4QLOA 5KYKA 4FFMA 4ZCIA 1ZCJA 4G85A 4WI1A 3UAWA 3K4PA 2PYDA 1ZMBA 3CCEF 1W3EX 2CZQA 2AQHA 3H0EA 4KVZA 4M7WA 4LJYA 5DT2A 5K3SA 4MDFA 3BIWA 4C7JA 4YRAA 2BKEA 3SSAA 2FPSA 2W4IA 3LSQA 3DDNA 1HETA 1LLDA 1WD7A 3R66A 5IJ0A 2A8YA 2C2WA 3MCVA 4GE3A 2ILVA 3KEOA 4ZREA 4E5UA 4Z4HA 1FLAA 3C3XA 5BT8A 3ZJVA 3MCQA 2QBYA 5TPZA 4MUBA 4PX5A 5E1MA 1IJEA 1HORA 4ATNA 2OZLB 1TPYA 2GARA 3M6XA 4XM0A 4EW1A 2NO1A 1WB9A 4IILA 4C4ZA 4QG3A 5CM2Z 5F23A 1NVPD 2Z1MA 2XGJA 1HH4A 3R3XA 4BQFA 2IJKA 3DSQA 3J81N 1G21A 2C59A 2HVJC 3AX6A 1CDZA 5EJ6A 3OQVA 2CXHA 3D2CA 4HT3B 3SC4A 3PVZA 1DSSG 4AULA 4I4TF 2X2OA 2X7HA 2NZVG 1ZD1A 3SI7A 2BIFA 3T5DA 5B66Z 5L3DA 5BOVA 3PE3A 4BU0A 5E7IA 3O8OB 2PKWA 4LI0A 1MRSA 1IZ3A 1XLTC 4IJ5A 2HQRA 4NHOA 3MLAA 2ZD9A 5IRCD 2DFNA 3I61A 3VZDA 5HKBA 1KKLA 3H2JA 1GGHA 2QVXX 3GX1A 2YWFA 1D2RA 4BNMA 1A9PA 3FVRA 1GPNA 5LMUO 1OQAA 1TKBA 4URHA 4LYFA 2FR8A 4R83A 4RK4A 4ND3A 2CBGA 2IVFA 3P9NA 1U43A 3FVTA 3O2JA 4URYR 1UDXA 5K03A 1TGOA 1TYEB 1XYVA 2V6MA 2WHYA 3NM5A 2IUUA 2VK2A 3ZZTA 4L02A 3CC7F 2BFEA 1F4MA 3DBRB 5TGZA 1BHJA 1N5OX 4BC0A 1P4SA 1H85A 2CV0A 3CSUA 2B92A 1O95D 1SXJC 2QRPA 1ELOA 4XTRA 4ZALA 3IR9A 4IV5A 1J8DA 1V9CA 3BGIA 2AEFA 3Q3EA 4PX9A 2AW9A 1FS6A 3ERNA 3I58A 5ALTA 3WADA 2ZRCA 2J3MA 1BL8A 4FS3A 2AG8A 4K2HA 3EEOA 2WM9B 5F5LA 2P9FA 4L22A 3UJ8A 5EMKA 1SG0A 1EFRA 1VJ0A 4XD7A 2TYSB 1J2EA 3L0ZA 3SBXA 2BEWB 2ZUEA 1CT9A 3FB4A 2Q0AA 2BZ1A 2PSEA 3ROTA 3ZYCA 3HCBA 4RXUA 1PW5A 1N3IA 3D31A 5HIIA 4E94A 3L4KA 4H18A 4UBMA 1U7TA 1F1JA 1TTQB 2ZT8A 3PHJA 5AFSA 1OYVA 1AQ6A 3TW8B 1T13A 3EIHA 1UPCA 5K2MA 5P21A 3SVTA 2WM8A 2IOQA 1BN6A 5T41A 4RV9A 1U7HA 3NPMA 4MVCA 4Y9RA 1G4UR 5AJWA 5J9PC 1KZGB 3H1HH 2IV2X 4LJ4A 1VBNA 2C0QA 5HOQA 3VJKA 2YWEA 4AS2A 2IBZH 1Z45A 2QROA 3SHWA 4CMBA 1PNRA 3UO2A 2FSSA 4MDEA 1C0IA 2BEUB 4MGZR 4Q3NA 4Y6RA 3QF7A 4QQ8A 3T5BA 2R5FA 3GGGA 5DBEX 5FOXA 4Z54A 4NEHB 1LDBA 3AR6A 1IOVA 2XUIA 4XQEA 4JOSA 3IEPA 3IL2A 1TD9A 3A0BZ 4W5RA 3RBZA 2I6GA 2PKRA 4BKRA 2FQ1A 4F91B 1Z2CA 5HKOA 3L93A 2QAIA 1S2DA 4GOLD 1L5LA 2COUA 2VQEB 3T3OA 1QCZA 2CLHB 3CEJA 3L7JA 3ND6A 3WB2A 2EKLA 2YRXA 4IR7A 1UCFA 4KXWA 2QTBA 1C8VB 2EZOA 3ZRSA 1U96A 4NABA 1OZ0A 3FAZA 4Y7CA 3IOBA 1K8RA 1U28C 2WTMA 1A4IA 3JYPA 3VZPA 3WHKA 5IKPA 1TEZA 1GL3A 3F9IA 2RCYA 3FTPA 4OOFA 4QXMA 4QASA 1IN4A 4RFVA 4CM8B 1WSAA 3SFTA 1V37A 3CLSD 2FPIB 4G8DA 1XPUA 5A62A 4MQMA 3GRRA 2VIIA 4RPLA 5FLKA 1CS0B 1ZL0A 2OK7A 5DP2A 3HRKA 3AKYA 4RJKA 5ALGA 2BCEA 1DAEA 3EXHB 1VHJA 1U5CA 3JU3A 4V0ME 3GUYA 5C3UA 3UH0A 4DQXA 2ZWAA 3OCXA 2HN9A 2PFKA 3A9WA 3B53X 4G4IA 2WVAA 2DOSA 1CB0A 2RHDA 3B2EA 4JH0A 3WYAA 1S77D 3PT9A 3HFJA 1H2XA 4V02A 4N5IX 3WWOA 6YASA 3VR6A 1Y8CA 3Q3CA 2R9RB 2J3QA 1N32O 2XWBF 1K7SN 1LF0A 4I5IA 3ZI4A 4E2FA 5FTMA 3DJFA 4FLEA 4MHTA 3E8SA 1HY3A 5AG2A 1SKBA 3RTBA 3B2NA 2OXIA 4DR2B 2GKOA 3DT8A 2W6JG 3MLEA 1OY1A 4PCVA 2GKGA 3BSSA 5DWDA 5EXTA 4NDZA 3TTSA 3D0KA 4PPQA 3BXXA 1EFPB 1A76A 1C7IA 4CUKA 2PV0A 4FE4A 5HNKA 1JU9A 4EELA 1J2UA 1F1BA 3NETA 3SPGA 1C9JA 2BHRA 3FLAA 4QRHA 3IBFA 3M1YA 3SC3A 1FX0B 4YDRA 4UTPA 3Q8LA 4U9IS 3I05A 4F2PA 4D8XA 2JFGA 2HPVA 3K4QA 2OHGA 4V0MA 2DBZA 3H7AA 4MICA 4M1MA 3WRXC 4JQSA 1U97A 3D7RA 2Z98A 3FBGA 1JJ2F 1W5SA 4K81B 5A05A 4D4LA 3C43A 1BD4A 5HRUA 5JH7B 4S12A 2AK2A 4KBGA 3SXUB 3KSBC 3VNBA 5F4BA 1IOLA 4R1MA 3TQTA 1UAAA 4HB4A 2JD1A 2RHGB 4KI0A 3SZGA 3NOXA 3BMXA 3ZW7A 3F3YA 4C43A 3WO1A 2I7TA 3KVYA 2HF8A 3E1SA 1A7AA 4K46A 5FWDA 1EFDN 1SB8A 4P6VF 2C84A 2H5JA 2RH4A 3HGTA 4Z4IA 4OAQA 2BZSA 2M1ZA 3IUMA 3HYNA 1SO8A 2P4EA 3VYUB 2A5LA 1YQNA 1E4YA 2H6EA 4GSYA 2ONJA 1G8AA 5K8TA 1FFDA 3ZIAA 2W48A 4DSAA 4GKJB 1CC1S 4INJA 5E4FA 3QPAA 4BECA 1KMHA 1WULS 2I2CA 4NBNA 3UKMA 5B1HA 1Q1BA 3KJFA 3AKEA 1EAMA 2AC2A 2O3TA 1P0FA 2DR2A 4FOPA 4W5QA 1BQ4A 1YUNA 1ZK4A 3C5WP 1JH9A 3GRPA 3OWOA 4DR4B 3UHPA 3OM3B 1COWA 4P3XA 5H5JA 4RTRA 1Z2NX 5FWYB 1TF7A 2HADA 1RXEA 3HVJA 5FBHA 3K6KA 2JH9A 5CT6A 3HQ4O 3W4KA 4DJAA 4R2KA 4WFGA 1YL6A 4HK4A 5JADA 5A0VA 3S03A 1WNSA 3TKAA 1LDEA 1E1CA 1NYQA 4ALNA 5L45A 3OQOA 1LC0A 1ZKDA 3GLFA 3MWEA 3ZBQA 5FTWA 3KB8A 5H81A 2ZAUA 5C81A 4GOND 4K7JA 1HSOA 5IJWA 3DP7A 5DTRA 2QMHA 3KB6A 1PDOA 3LW8A 3TAHA 2QZPA 5LD2B 5CRIA 1LLFA 4B2IA 2OZVA 3IV9A 3EIEA 3OTIA 3ANSA 3UXMA 2H48A 2Y1KA 4MJXA 1YK0A 5JHHB 3H6GA 4GNKA 1JQJC 3ICOA 1L5OA 2A92A 4FFVA 2PFGA 1JUDA 2YIAA 3CEAA 4G5GA 4YO7A 2PCJA 5GY7A 3RAPR 2ZBDA 1SF9A 4MS3A 2XDWA 4BFZA 1TUEA 1RXCA 2ZBFA 4Q48A 1PVVA 1NJ2A 3G6EF 1FLVA 5I4CA 1MSDA 1SUPA 4KDCA 4II2A 4JL6A 2NZJA 4MVWA 5GZ6A 1BQ3A 1UPAA 2QRNA 3BCCH 2WLSA 2C2ZA 4HSGA 3QIAA 2JCYA 2Q3FA 2WWIA 4CU5A 1SC1A 2IP4A 1GITA 2D8MA 2Q2QA 3R40A 4LK3A 1XNQB 1ADFA 3C5CA 3OLCX 1POXA 1RI1A 2KGWA 4MKHA 1Y3AA 5M2QA 4PO8A 4CS4A 1YI2F 5CJ2A 4NARA 2PKQP 3PITA 1N0WA 3G8DA 2V1DA 1XROA 3ZXSA 3E4CA 4F2HA 1OXBB 4XWAA 4ETNA 2C29D 4JAAA 2P0EA 5CVDA 2XB9A 1XCMA 3PNMA 3W7TA 2F7SA 4MUIA 5BSVA 5BV8A 4BV2A 2OCYC 1R73A 3GRYA 3CPEA 3LAWA 2WSYB 1Z5ZA 3EZNA 2DZDA 1JA1A 5FF9A 3C3DA 4TTVA 5EZ6B 1J09A 3OQBA 5CGZA 4UEKA 2PNFA 5AMXA 2H51A 1AI6A 1FDOA 3DMHA 2FWJA 2P8JA 1Y7HA 4MGKR 1OBHA 1QVRA 3H99A 4D3SA 5CFOA 1ZA1A 4ITUA 1H2MA 1YRLA 2G72A 1HMYA 2X42A 3M6MD 3QLUA 2RCVA 3CPWU 1E4EA 1D4AA 2ZWVA 4LQLA 1NMXA 4NDAA 1VF6A 3ONFA 4PN3A 1PHPA 1KERA 3T1VA 2D5BA 2R6CA 4TT3D 4FB5A 1BVYF 1K0FA 2X13A 4RVDA 2G9RA 1V16A 4XX1A 2EFEB 3K5IA 3WFIA 2AC7A 1UK9A 4J4TA 1PBTA 3SBOA 3GV0A 4HB2A 5BOSA 1MC8A 1EZZA 3QELB 4JYMA 5FFFA 3W8RA 5IABA 1KZHA 4R4JA 1YVWA 1Z56C 2QSJA 4BLOA 1PL4A 1GTL1 4HC4A 4ZQGA 4NUTA 1JPUA 4F6CA 1XO1A 4CLHA 4JXJA 4NXNB 4PSCA 2R48A 3LNCA 1CJTC 1KEPA 4OXYA 2DUWA 1DPGA 2GD1O 4ME6A 1DKOA 2XUOA 3IHKA 3JWPA 4FMDF 1GSIA 2IE8A 1VHWA 4UC0A 3S7TA 3WGQA 4B3SO 1AKTA 2UYOA 3A70A 4RHFA 4EB0A 3K2BA 4P0TA 4B43A 4GYJA 5AW3A 3HWRA 4DG8A 4C29A 4MVJM 4K9NA 4XYLA 1JQBA 1JSRA 1H38A 1RPZA 3E81A 4EHDA 4OHFA 2JBAA 1TIKA 3QXJA 3H42B 2C3YA 1II9A 4RJLA 3P4UA 3CS3A 3AZOA 3RT9A 7YASA 5C8YB 4F92B 4US1R 1JTFA 5EXSA 5LDHA 3F0FA 2HJSA 2UVPA 2QKCA 1E1DA 3AEYA 3IAEA 1IUKA 4X62O 2XPCA 1RLMA 3IVXA 4IIHA 3O4FA 4MGYR 5E2BA 1PR3A 5G3YA 1OT5A 3WK5A 3K0AB 4WCDA 4ZK6A 4B47A 5AUOB 1M2JA 1NATA 1YDGA 1ZSNA 3LFTA 3N28A 3CCMV 1QVAA 2B6HA 4Q1CA 4B32A 1HX7A 4XWOA 3SKVA 3QO8A 4NV3A 4PGGA 1O58A 5DNEA 1Z39A 4XWTA 3IPAA 1XMJA 3LY5A 2CXNA 1Q7CA 1JQ5A 1U63A 2H5IA 3NIDB 1U9JA 5KREA 2IPMA 5LB2A 5DHFA 2XSZA 3OQMA 3SQDA 4LDPA 2X6RA 3VAAA 3Q7EA 2WVHA 4B3DA 4KOEC 4DL9A 1E9EA 1G1MA 2H8PC 1MVNA 1YBMA 1JIJA 1G5QA 1TQDA 2B3TA 2HHCA 2OE2A 1GXSB 2W8ZA 1M8GA 2EV9A 1HDZA 2J0UB 4LF5B 4L16A 4R98A 3U49A 1CY7A 4C0KA 2IEIA 5BV0A 3HA3A 4IXWA 4BRWA 5H6RA 1D07A 1AR4A 4JI2B 4K9QA 1IN5A 1KZ6A 2GEFA 4L57A 3R6LA 3LTEA 4G2NA 1YCFA 3BFPA 3P4YA 5ERYA 4I8XA 3TFOA 5F9FA 3LKBA 1PJ8A 5AM1A 1NP6A 2CBXA 4L5AA 1FCJA 4O59O 2KTVA 5GZ1A 1CIJA 1IPAA 1KI6B 5K0FA 4IFTA 2PL9A 1X1AA 2G36A 2Z9BA 3P30A 1M1NB 1Q1EA 3OJWA 4EK9A 3R9XB 1N5JA 5KAIZ 1SVNA 4HAUA 4GC9A 4Y7DA 3WYFA 1VIYA 4OXIA 4DUYO 2WWRA 1LSUA 1HE5A 2HBRA 4G1VA 2DFLA 4HWOA 1P8JA 3MCUA 4I6JA 9GPBA 3CVVA 4BTLA 3SIVA 4CG0A 1C8LA 1FSSA 2YXDA 4O29A 2SICE 4BCDA 5I6DA 4JYCA 1N5DA 5CA1B 1D4FA 3ZCCA 3DLCA 1P1CA 3A0UA 3HNRA 3O2NA 3EBPA 3UUWA 4RLQA 4DIDA 1TADA 4N9WA 1VHTA 4ZGBA 3HR4A 2P79A 3AERA 2W6IG 4NYMQ 1K73H 3F71A 1AXEA 4JFRA 3B85A 3C16C 4ZU6X 4C6TA 3AR9A 1YB1A 4B8ZA 3P8ZA 1DBIA 1DUSA 4NEGA 1KARA 1W75A 1ISPA 2I66A 4FJ0A 4US0R 1G2IA 1Q83A 4DTIA 5CLLA 4CF7A 4GX1A 5AVJA 2W6JD 5D3ZA 3M34A 4MHSA 4N8SA 2UXBO 1L5NA 4KITB 3FKJA 1WVMA 4TVBA 1XC7A 2FK8A 2YC4C 3AEQB 3V8PA 3RPEA 5A1JA 1T9CA 1XV2A 5FPHA 5I9NA 3LMEA 1ZCZA 2PH7A 2ZVQX 3DBOB 2XE4A 3R0JA 5HDQA 3K92A 3ID6C 4RLHA 3RO7A 3ZU6A 1W4CA 4JEMA 1GNRA 1NBMG 4LBVA 2YV2A 3AI1A 3IE1A 2Q29A 3NG1A 4GL4A 1SQQH 1E2UA 1F20A 1J5EO 4FDLA 4HAIA 4HTFA 3K9BA 2YEVB 1COMA 1OBOA 1ZW6A 3L5OA 4TSRA 4UKDA 5ITVA 5JXWA 4P3YA 4G4XA 2OKGA 2XQVA 5TQVA 2KMLA 1ZPDA 3FPKA 2W98A 3RRNA 1KI9A 1R5NA 2WWFA 1NAIA 2QRVA 3NBAA 5IDVA 2EATA 3MWKA 3U4DA 4JZKA 4UQLA 2GD0A 2F9MA 4RELA 2Q3JA 4B34A 3E22B 4R8CA 1EN6A 2D0IA 4TROA 3ZVKA 2HYIC 4IDDA 1UJNA 1HDOA 1KOFA 1XRMA 3L1KA 1Q3KA 3FI0A 1EGQA 2P8SA 3I9FA 1R4NB 1EFKA 2A14A 4X91A 2Q7EA 1BKYA 4XJSA 2ODNA 4HEQA 1PQUA 1OIXA 4L4UA 5K51A 1NBEA 5B53A 2X0EA 4BVGA 2I6TA 1NFQA 3KR9A 2BMFA 4D81A 3U4MA 4KX3A 1XD2A 3NT4A 4MVRA 3P96A 4NTXA 4MLCA 1PEDA 1QG4A 5KTPA 3DV0A 3E9EA 1Z18A 2A9OA 2V45A 3PC4A 2W2QA 3J7TA 1LBEA 2PUSA 1VGQA 4NHEA 3VZQA 3ZE1B 2A0FA 3I2KA 3HJFA 3EISA 1USUA 4I08A 5A5DA 4JLOA 1DKUA 5AXBA 4C0JA 1KYYA 2O7VA 1PFWA 4K6HA 2J3JA 2VUHB 5C18A 1E3EA 3NHWA 3TQQA 3W6OA 3ZH9B 3MCWA 5BUSA 4GBJA 3P26A 1UDCA 2VQDA 1NBMD 4C7BA 3EY9A 4YCBA 2YFYA 1TM3E 2IPAB 2ICAA 3CC4V 3EVZA 3KVNA 4U0KA 5EP4A 1GM5A 2HHHB 1VIVA 1LKZA 1VP7A 1VPLA 2BBWA 4OHPA 5AW6A 4LYHA 2UZ1A 3R3UA 1L5ZA 4COOA 4E5NA 1N1GA 1E4OA 1KQFA 5CDGA 2AWNA 5DNUA 1P84F 1TK2A 1NN1A 3H19A 1OOEA 1JJOA 1EDZA 1IBRA 3GJYA 3PPWA 3QUSA 1SUFA 4HUQB 4DC1A 3ZWYA 5I8ZA 2FQWA 5JEEA 4GT1A 4J76A 4IQ0A 4FLTA 2E4XA 3AB3A 5FWXA 3T61A 4MS1B 4FYHA 1YZGA 1LDGA 4XQGA 3AM1A 2I7DA 3O93A 5LCXA 5SZIA 4DZRA 4RYDA 4FSHA 3CRMA 4DADA 1DOZA 1IHOA 5HJ2A 3OGCC 4BLTA 1XU9A 4I5GA 4JJEA 2H00A 2ERCA 2WG0A 1ZBQA 1K5PA 1MC4A 3MPUA 3O8OA 1HNXO 4M60A 1O9GA 1WB7A 3EBOA 3MTEA 1WB4A 3QEJA 5FPTA 1CS4C 1R3DA 1U65A 2IXDA 3FYDA 7REQA 5KNBH 4F9FA 1KYQA 3IBSA 4FMPA 1JEOA 1QHYA 3QOXA 1YBFA 4CEJA 1P2DA 2G5PA 3U4QB 1MH1A 4DA9A 2F55A 1GWNA 5DKFA 5I7WA 1YS1X 1D0IA 2EEZA 3ABLB 1G21E 3GR6A 2FW0A 3IXMA 1N9ZA 2I71A 4WN3A 3TH5A 5H9WA 4KPEC 3EQ2A 1P2VA 3HXKA 4AKIA 1JG1A 1GGVA 3RUAA 3T6KA 4RTPA 1G0OA 4XJVA 1NTKH 3AG3C 2YWBA 3DMTA 4GGPA 5ALZA 3CD6V 3FOEC 1GA6A 4TGLA 1Y6FA 4LAFA 3F2IA 5D3QA 4C03A 2CGEA 2VJKA 4R50A 3T1YB 3AHCA 4CN8A 2NSJA 4NMXB 5EWMB 3R4CA 2HQSC 3RIYA 3V4LA 4DJJA 4MB0A 5KC8A 4NCAA 1DHTA 1HNNA 2IBMA 5C53B 4JB0A 4LWOA 3U9TA 1ZITA 3RF6A 1JR4A 3V4VB 5JCPA 4RXMA 1XMPA 5G1PA 1Y5LA 5E6UA 1E1RD 3RLIA 5I3ZA 1X7GA 1IIRA 3C3WA 3MMXA 1SU6A 1ZUHA 2H92A 5LOVA 4AQ7A 1YIAA 2A1UB 2C03A 3G4SV 2CF5A 4UXJA 3KQWA 3Q3VA 1MH9A 1XZEA 4NENB 1AK2A 2I8LA 1GHTA 4MVQA 2H4WA 2VWPA 2Y9MB 4MX8A 4RW0A 1VC2A 1SBZA 4B6RA 3AOEC 2YBEA 4K87A 4QWWA 1EVJA 4TLLB 2AXNA 2QP4A 1EFTA 4KK4A 4DSOA 1CUAA 5CK4A 3WG9A 2WNHA 3EH1A 3M81A 4TTTS 3R1IA 4MAFA 4ZC1A 4EB8A 5DLEA 4QNHB 3RQSA 4RWZA 3Q7IA 4V38A 4D99A 4EPYA 1VKRA 3RYFB 1ESCA 4Y1EA 3TFWA 2EW1A 3UC9A 3DB1A 3ZI7A 4C6HA 1Y8ZA 4DA4A 4TYQA 4QBGB 3PC6A 3JRWA 5ALRA 2YYYA 5FP0A 2Y68A 3W77A 1XDSA 2ZRKA 3NHAA 4MVZA 1M10A 1XTJA 4I4TB 4NPHA 2VJAA 1RYMA 1KECA 1PGQA 1ZU4A 4JCOA 4V0KA 5B1YA 1M9NA 1OWNA 4EBBA 2F95B 1YQEA 1MP0A 2OXFA 4Q21A 1JNXX 2SHKA 1Z4LA 3U3MA 1CY4A 4V39A 1A27A 4LBEC 1J0AA 4R2LA 5BQ3A 1EVIA 1PR6A 2R7AA 1T9BA 3CIOA 5DTQA 1GTJ1 2WD9A 3RAGA 4NATA 4XPIA 4X1KB 1K89A 1YRYE 3OTOB 1FBTA 1VCMA 1FYVA 2MSWA 3BGSA 3L4BC 4MVJF 4CL0A 3AUAA 4NAUA 1LUAA 3CRAA 1N4DA 1RC0A 4LBZA 3I04A 3AG5A 1TC2A 3LT2A 3P9ZA 3N9IA 4RF4A 5T4BA 4WJZA 5EHQA 1KFKB 3W3AA 4ZCQA 2VL7A 1V1RB 3H87A 4AMZA 3VUFA 1WD5A 3KS9A 2GRAA 2HZBA 2B7LA 2Y71A 1T5EA 5ESWA 2B1RA 3OECA 1UZNA 3MMSA 3RUIA 3AESA 1N33B 4PNEA 1TO6A 4PC1A 3RJ5A 4XCVA 3KWLA 3BA8A 4GKAA 1CP3A 3SDBA 1WLEA 4UVBA 2D1RA 1K08A 2NV0A 4P3NA 1WU8A 3K8OE 1KYWA 1RHUA 2XF8A 4ZT3A 3F1LA 3JQBA 3VHXA 1XBTA 2UYHA 1Z2EA 3DMRA 4AG3A 2R8YA 3CPHA 4H6XA 1H4SA 4DV7O 4E5DA 4WN9A 1RM3A 4YRZA 2C5FA 1ICIA 3AJDA 4R1SA 1FMTA 5LNK6 3PHGA 5FI0B 1FIUA 1K8AH 3GJ4A 3MA0A 1SIBE 1UT5A 1WCIA 3DPSA 3IEMA 1U0FA 1XPRA 1W47A 1HNWO 1PO7A 2QHXA 2WFZA 2YOGA 4FR5A 4LGCA 2C9YA 4DDMA 3BWYA 2I1WA 4P32A 4J9VA 4A1FA 2R72A 3INTA 4AVYA 3VSBA 1G8GA 1NLFA 1W2WB 4BMCA 3DUWA 4LN1A 3VTZA 2PMDA 3LO5A 4UNNA 4UCUA 4N65A 1EDBA 4J4BA 5D3MA 4U2BA 4XVUA 4PSKA 1B0UA 5FNVA 1L4LA 4PCLA 3OX1A 3SBDA 4UULA 3OIWA 1BDMA 1EK1A 4Z86A 5DYTA 3UUEA 1MSWD 1X1DA 2OBNA 1VEWA 1OXVA 2QRLA 1U98A 3ICCA 3PPIA 4FS8A 4FDAA 1MQAA 4XDJA 4RJIA 5EWLB 3TIIA 4AMVA 5B7QA 4HDMB 1OXTA 1G8SA 2AMVA 2M2IA 2NU7B 3D4OA 3E1GA 3ZQ4A 1OYYA 3I0NA 1AUOA 2VG8A 3ZCRA 2B33A 1FS4A 4LFBO 2C5SA 4N5NA 1H2NA 1SDSA 1E1KA 1LRJA 2JASA 2XR1A 4GGOA 1XAGA 3KJNA 4EMBA 2VDWA 1QF9A 4O4LB 5B57C 5KX5F 3DD1A 3MJEA 3TETA 5CLHA 1ODTC 1PG0A 2QWNB 4FSXA 3N2GB 5CAEB 1T3TA 2B1IA 4N1AA 3ZXXA 1KK1A 3BWXA 2CUKA 3DKIA 3IRVA 5ENDA 3RSFA 5KYGA 4KR6A 1XKTA 2FJ0A 1IULA 4PVCA 5L3QA 1VQ6F 1F0NA 2BGJA 2ZWIA 4W5HA 3SN6A 1QK3A 2AI1A 4CV0A 4F8YA 3K70B 4ZCPA 2LKDA 2QP9X 1JPXA 2ZZMA 1YJQA 2Z5LA 1IN7A 4GLFA 1ZEJA 2ZT9B 4KB5A 4BNUA 2IIPA 4W1RA 3H84A 1FXKA 3TRKA 1FLNA 2CWDA 5JT1A 4ECEA 5JZVA 3L0YA 2ETVA 3SNKA 3BCSA 3UMSA 5IY5B 1W4BA 1LGYA 2F48A 1ZEMA 2GAAA 1BCRA 4YWHA 2XT9A 5ALJA 3T94A 3O95A 2ZCEA 3M4NA 4F8JA 4NU0A 2GCOB 4JBLA 3BWVA 2Q2NA 4AG6A 5BORA 2DWCA 5K8IA 3ZRWB 1OTHA 2QRJA 2TS1A 2A9VA 4P53A 3QVOA 4HH0A 1CERA 5DCLA 4NYIR 1MOPA 1IZ7A 1TKRA 4QYIB 7MDHA 5I9LA 4HSEA 1Z06A 3BEHA 2KHZA 2X1VA 2XRFA 3I09A 3QX7A 3WIOA 3S99A 4PDRA 1H0SA 1PT6A 2K7ZA 4L2IB 4CF4A 3BJZA 3C1UA 1M8JA 3A0HZ 4LF7O 3GJ7A 4M53A 4RA6A 2AHRA 4US2R 1AZTA 2BFNA 1PKEA 3M9XA 3GPBA 3VU3A 1AJPA 4D42A 1OLUB 3DDSA 4GZLA 3ZQUA 1CQJB 4P36A 1K2VN 4DQ0A 4DUGD 1ZJ4A 2O05A 2VTBB 1QGAA 3IQGX 3OPQA 4LNHA 2HJDA 5FJIA 3O91A 4WXEA 1PZEA 4A03A 3CC4F 3J81M 3FCSB 3GD5A 3U1VA 5CLGA 1IMJA 4TWZA 2WFLB 5DO9A 5A9TA 3RS8A 3STWA 3SS7X 3O4GA 5EIOA 4JLBA 3CY6A 5K9ZA 2OLJA 3OONA 2YRFA 2WJWA 2I4TA 3CW8X 3Q3GE 1QGOA 4M4SA 4JT2A 4MZXA 4MWDA 3A1WA 3A27A 5EKTA 2B82A 3JQQA 1VF7A 2LR0A 3FMVA 2P2LA 3DGEA 2RHHA 1T9GS 4G0MA 3DR5A 3JD4A 2X0NA 2F43G 2GA9A 1KZ7B 2MYUA 3RNOA 3K15A 5IKMA 2WKRA 4E14A 2IPNA 1PJTA 2QI9F 2W2KA 2XB2A 2KG4A 2QL7A 3NT5A 4H6WA 3RS5A 4NBUA 4S04A 5GINC 2OBLA 2XADA 1SC9A 2XTJA 3HR8A 3QTLA 4JUFA 5IJZA 5B5EZ 1RJGA 1AMNA 1PSWA 5GIOE 1QOZA 2GASA 5H3LA 5A4AA 2ZYUX 3OI7A 4GL2A 3WGZA 4KQJA 4DMUB 2VYND 2YWJA 3L01A 3OFVA 3CHXA 2PKEA 1JIQA 3PXCX 1P1BA 3KV1A 4GPD1 3K5OA 3GLRA 4FIDA 4EPRA 3L4JA 4ZOLA 2W8BA 2YW2A 3BJMA 3W7AA 1BMTA 1VLZA 3O1LA 1O57A 3CUVA 2P77A 2JZCA 1P9OA 1SPXA 1FXKB 4WESB 2GZRA 1G2OA 4K9SA 1D6MA 2ASEA 4IT5A 4I8DA 5K3FB 3NYIA 2QR4A 4GKKO 4RIHA 5LUBA 5JS2A 1R7RA 4N0PA 3SJCA 3ZWXA 2YDYA 2VNJA 3A31A 3AJAA 2C3MA 1ZVVA 3QFRA 1D2HA 1AP6A 1SBTA 1DC7A 1S2GA 1RLOA 2PXXA 3AKDA 3VSAA 3WLLA 2XZOA 3TXSA 3VQWA 4QYMA 4CEIA 4FGUA 4B7UA 2XAJA 2ODMA 1Z2GA 4MW6A 3BB4A 3T1CA 3ZV6A 4DMCA 3TSWA 3F6MA 2FEAA 2GM4A 4CLEA 3OE7D 4D4KA 4D9GA 3ZZ1A 2C4WA 5C5IA 3IQDB 4Y2SA 3A9UA 4G86A 4HP8A 4R8SA 1XUOA 4B3MB 3N39C 4RS3A 5P8WA 2B35A 3W1EA 2WMDA 3IAFA 4D4HA 1T4DA 4W9RA 3PWZA 1G7RA 4POOA 4ZK2A 3FSRA 1IXRC 3Q5GA 1PUIA 3W79A 5LSAA 4F6LA 3IQWA 4FOSA 1LC3A 1T8SA 4ZZ3A 4M1QA 1XLVA 2R86A 4M2LA 3F0TA 5EUCA 1G60A 4FGJA 4CDMA 1NI8A 4LRQA 2VLIA 4ZZ1A 4NQRA 3HN2A 2UUAB 3N7TA 1GG2A 4NJEB 1FDRA 1JIXA 2QQEA 4E12A 3L41A 1JR3D 5AW1A 3Q8KA 4WBNF 3KR1A 1OTYA 1YTLA 4E21A 3DUFB 3TXAA 5CFLA 3M82A 3ML1A 1W8DA 3GJSA 1QBKC 2Q7XA 4J29A 2HCRA 5I5GA 4H13B 3SOZA 4BR6A 4BAZA 1L7EA 1NUPA 5FI3A 1V43A 5C5DA 1WA8B 3T80A 2H7VA 3HY4A 4DSTA 1V8BA 2B4AA 1LU9A 4DCOA 1ORWA 4C78A 1D6JA 1PQWA 2CMGA 4R2XA 3W78A 4D1YA 5E95A 1ZM9A 4YH1A 1T8PA 1M56B 2D1QA 4YFYA 3G5AA 4F9TA 1YACA 5COBA 4KFMA 3TI9A 5HUHA 5LZ9A 2OPHA 2J45A 4NR1A 3NGMA 3ROXA 2ZXFA 2YN4A 3IIKA 5EERA 4JLUA 5ABPA 1HOXA 2CXTA 2QEQA 1S1CA 2RKWA 4G27B 2DUUA 2V7XA 1JEQB 1UBRS 2ZAGA 2ZQYA 3NHPA 4PO9A 4CZ2A 4JBIA 3NWJA 5BN4A 7ADHA 2XVYA 4D4JA 4RADA 3CYPB 4I1VA 1SIUA 4J16A 4EGJA 3U7IA 1YDXA 2HL6A 3IR7A 1NH2B 1SRYA 3BD9A 1OZFA 3FFWA 3HUUA 5KJFA 5EAIA 4W5TA 2EKZA 2DETA 2XXBA 2PBFA 5A04A 1J42A 3UWOA 3RVOA 1A2BA 3F2VA 3E2MA 4YP0A 3LC0A 1DIHA 1CLEA 4FOOA 1XK7A 1RBMA 4KDEA 1NOJA 3KJEA 4XGQA 2UUBO 1DFIA 1B1CA 1X1RA 3THWA 3RSHA 1KBHA 1S2OA 4PDVA 1ZNYA 3DL2A 4L4ZA 4X64B 4DMLA 3WU2Z 2OWEA 2ZQZA 1VE7A 3H18A 3PC8A 1ZIPA 1CIPA 1T2AA 2VP5A 4K88A 1IV4A 2IYFA 5DZSA 4YRSA 1L9XA 1U0EA 2JFWA 3ZX6A 3FPIA 1FDUA 2VJQA 5DLYA 5J1SB 1Y7TA 1YZVA 4PDLA 1VG0B 4LWZA 2GFQA 2C9CA 1PT8A 2C7GA 3LU1A 3ZMTA 1LBTA 3ETGA 4KRFA 4BUJA 4EZIA 4F4HA 4YHHB 1QMPA 4Y1GA 4HLUA 3NYQA 2IH3C 4AW9A 1JU3A 1EFRG 3PVCA 2GEJA 5F21A 3QIVA 2AQKA 5A2QM 1E0JA 1ZM2A 1ZMTA 5IP5A 2WIBA 3UT5B 4YXWA 1KI2A 4HDQB 3T52A 3I6ZA 4LF9B 4H77A 4LNAA 4MVXA 3NK7A 4PWZA 1H3NA 1KSHA 3A37A 4QA9A 3RTAA 3U6KA 2B5UA 2PHZA 2PRSA 5TB5A 5ER9A 1RZRD 4LX8A 3ZWQA 4RGVA 3HDQA 4JXKA 2VRZA 3EEFA 4LC1A 4IKEA 5IPFA 4RFSB 4NSNA 1F8FA 1XMQO 4IDGA 1XZAA 4GI5A 5IXYA 4KXRA 4A2QA 4B3FX 2QUAA 3DTYA 2RK6A 5DSXA 2VSNA 2ZYHA 3SOPA 3PGKA 1GPLA 4KIUA 1QZ3A 2CXXA 4K28A 1UBMS 4PQRA 5M04A 4Z4EA 1NVFA 2AL7A 3A9RA 3R0ZA 2GH1A 4BMZA 1IUNA 3WGJA 3DG9A 1JR9A 4GVXA 2GPNA 2YFQA 1WABA 1PZHA 3QVVA 1BE6A 4HWPA 4TQAA 2YJ3A 4H7HA 5IM5A 5I7EA 3EAFA 4FIZA 3KCXA 5EYPA 3PDIA 3ZHTA 1ZO8A 3JQ6A 3TXQA 4PZDA 3SJZA 8ADHA 1GN3A 2CHTA 2QJWA 2R00C 4WNIA 4DDVA 1OCRB 3S1AA 3SC2B 4PLPA 4OM8A 1V4NA 4XRRA 4MUYA 1UMDA 5KKCA 1LBHA 4QE9A 1FFXA 1XX6A 4UEOA 3CF4G 1AUQA 5HF9A 1K97A 3TM5A 3UUFA 3PNLA 3W4IA 3ED1A 1UQTA 1VQKV 4OQFA 2Z04A 2OAQ1 1IY2A 3HBLA 1YOVB 2FN3A 2I55A 3BGWA 3D2BA 2BUCA 3EXFB 4ZI2A 5SYAA 3SJBA 3TKYA 2CV2A 1I5OA 2YMMA 2OGUA 2HZ7A 3DBHA 3MXOA 4EA9A 1ZJJA 3W8DA 2AFIE 1W76A 1W25A 4B3CA 1P4RA 1F8GA 2XVMA 1XUQA 4Y3UA 3TX2A 1VQ5F 1RWXA 1NUHA 2FPGA 3G2KA 3Q0IA 5TVGA 3HUDA 3TIXB 5KJCA 2Z6UA 4CM6A 2G0NA 4FFRA 3PEYA 3ZBUA 2H1WA 2BM0A 2PT9A 1YVEI 2XCOA 3MT8A 1T9AA 5ARDA 3UFXB 2HRRA 3W7BA 4AUNA 4GO1A 4C76A 2EW2A 5B1BB 3PVSA 3GOQA 5CW2A 1K7EB 4LSMA 1ZD8A 5CPBA 2O8FB 3UCSC 1TFUA 3DDUA 3QKSA 4GMFA 4P4LA 3ESDA 3A8TA 4KQXA 2ESRA 5LOVF 1U1GA 2DBVO 3V4FA 5CYGA 3MQWA 4MWCA 3JD3A 4LJSA 4KIJA 3WTCA 4KXVA 1RW4A 1VQPV 5E0OA 5BVHB 3H0CA 4ESEA 5IDYA 4HXGA 2DU8A 2R6HA 4RZHA 1SJ9A 1XZBA 3HR7A 5EMMA 5FQOA 2XMRA 3LVFO 4Z99A 2ZRLA 3AYZB 4F45A 1SEVA 3LT0A 3P45A 1Y4DE 5EWRA 3T9AA 3D1JA 2LDBA 3F96A 3I12A 4G1CA 5FORA 3LXRA 5CM9C 5GTDA 2JCVA 5JYDA 1ATIA 4NYJQ 1JGTA 3U9LA 2A0UA 3URKA 4QM7A 1E8NA 1K8ZB 2VPXA 2FFQA 3WNCA 4QUKA 3LYAA 2G38A 4FLWA 1E9FA 4WLNA 3BRSA 4AZ0B 1RVDA 4J03A 1T35A 4G4VA 1KL7A 4BX2A 1MX3A 2PVPA 2NYRA 2H06A 3DZHA 4ALJA 3FDXA 4FGWA 2VJCA 5FBWB 4EECA 3ZY3A 4GMGA 3T7EA 1TMOA 2AG6A 2YVLA 4BNHA 4GBGA 1UXGA 3ITDA 1AQUA 1JSCA 4LDRA 3T3EA 3IHTA 3SP1A 1I5RA 3CLUC 2PYIA 1II8A 3VU1A 1QU3A 1NZFA 1RI5A 1C8KA 1YR9A 5TS3A 4JZGA 2PX0A 2VDPB 2H5EA 2ORYA 5TMEA 4FWIB 4BZXA 2CXPA 1JSXA 5I4BA 1IPEA 2DHCA 2XZPA 3FPHA 2IS2A 1JWBB 1HZJA 1R37A 4RKYA 2DERA 3CC2V 4Z7NB 2YEVA 3GCWA 1AGNA 1E5LA 1JFRA 3CVJA 5DRTA 1CU1A 1IONA 3V3TA 4BFLA 3ETDA 4KRGA 2OCXA 5DECA 1QKKA 2XUFA 2XT6A 1OWPA 3L4BA 4TMKA 2YL2A 3ROGA 3TSCA 4CLOB 5FX2A 1Y9EA 4BNNA 4AMYA 1UZUA 1HE8B 3G23A 1MPXA 1DLBA 4EEKA 1JQDA 2FAXA 2QE7G 1AZWA 1JZQA 2R6JA 1DNPA 2P1RA 1XEWX 3OKFA 1NRIA 3GWKC 3Q72A 5BSGA 2XCSB 1M2KA 1Y98A 2JHFA 4IIGA 1X8XA 2GN2A 4E4YA 1M6NA 3Q3HA 5BR7A 4B4UA 2OVFA 1VPWA 4CBVA 3NVKE 2QMUA 4OJYA 1BDHA 2PX8A 1ZSPA 5JJJB 4JIGA 2Y48A 4Q9DA 4LMRA 2G6BA 3BMQB 5H80A 3CJHB 2JAOA 2VP0A 3JYLA 2IM9A 2GUZB 3E15A 1FYWA 5UKDA 2NZ8A 1NJ1A 3B36A 4PZUA 5DHRA 1RRKA 5BXQC 1GM7A 2QLLA 1DBRA 3LZ6A 5FOSA 3TNJA 2B1GA 4AWXA 5FRDA 5EJAA 3LK7A 5M29A 4OAPA 3ZWMA 3FHTA 4O0MA 3AUTA 4TV9A 1XNGA 2EYQA 3PG5A 4BBZA 1SZXA 3S8YA 3PGJA 3ZWWA 4X65B 1IWOA 1JDPA 1Z4JA 4RAOA 4WKCA 3U17A 4R71A 1RAFA 3TGPA 1RQPA 5LQRA 2PL5A 3SYTA 5FPYA 2HP0A 4E3ZA 1Q50A 1SQXH 1T6ZA 2BSKB 2VZLA 2X5XA 4RNCA 2P1DA 5DK4A 2YZ7A 3SDSA 1G8JA 2R68A 2XVZA 3L9WA 3ZD9A 1N5MA 5JEDA 1MBZA 3BL6A 5EWMA 3CVUA 1T9ZA 3AILA 2R8EA 2WD8A 1J0EA 2A6PA 3IEIA 2ZJ8A 4HDRB 3TW0A 1EMDA 4DEYA 4E2ZA 1S3GA 1XYGA 1PL6A 2V7WA 4FC7A 1WNTA 2GBIA 5MFPA 4HX9A 4RY0A 2ZVPX 4L4XA 1DAHA 4MCIA 4QPNA 4TMFA 1DJMA 1NMQA 4TLCA 4EG1A 4GI2A 1BXGB 2R2AA 2YN0A 1X1EA 2AF3C 2JIPA 2QUIA 5F1PA 2VGNA 1XHLA 5BMVB 1YFZA 3CIFA 3WSTA 4OLBA 3BH0A 3CUSA 2HCFA 3STXA 1WEHA 2BEVA 3IQXA 8LDHA 3WB1A 1KMIY 1R0ZA 4BT4A 2V7GA 1NW8A 2WE8A 3BVPA 3RUFA 5HP4A 2Q0OC 2VUIB 3D3QA 4DC0A 1I0HA 1E77A 1IVNA 2MSNA 4C82A 2NZ2A 4BQNA 3REQB 5E1BA 3D8HA 1Y4MA 4B09A 4I4TA 1GYPA 3NDRA 2QU8A 3HP7A 1EVQA 3ZTTA 4HQ6A 4BJHB 3BIOA 1WOYA 3K30A 1SCIA 1TZKA 3FHJA 4QDTA 5JVDA 3VBEA 5KCZA 5IVHA 4MROA 1QRTA 4ZCMA 4INAA 3EASA 2PX5A 3I0ZA 4I6GA 3U5ZB 3I9LA 3HPQA 1KJWA 4QPPA 1BE0A 3REFA 3UJ3X 3VVMA 2VTBA 2IGBA 1NY5A 2PZJA 3O2SB 3G6EV 3P32A 3CR3C 1GPDG 3AR7A 1MJGA 5LB4A 1KORA 4WEQA 2FWMX 3SXUA 4URVR 1QNLA 2G6TA 3AQIA 1K7DA 2HKOA 3E9YA 4RA6B 3CCSF 5IJ9A 3ZZUA 1CXZA 2RHRA 5FTJA 2VDRB 3VHQA 3EXG1 4GE0A 4BV8A 4ZGGA 4ZO7A 2ZBPA 3ZDEA 4YRBA 4BE7B 3JY6A 5D5PA 1GY8A 1V96A 3IX7A 3CF4A 4TT3G 3OTGA 1J70A 5BV2P 1JMYA 5HJ5A 1T2DA 2ZR3A 4LJ9A 5K3FA 1TZBA 4EFNA 4WQMA 4BO4A 1QZTA 3Q41A 2HLHA 3M6WA 4XDYA 5TQJA 1JI0A 5EHIA 4HDNA 2XIJA 3OBIA 1W5AA 1FLDA 2XGSA 5CBHA 2WPDG 3ADOA 4IGKA 3USCS 2MINA 2JC3A 4JT4A 1NW7A 1GZ4A 1S72F 4KAFA 4ENTA 4YRKA 4S1VA 3TX6A 2WMOB 3WRVA 4CM9A 1UKEA 3RVRA 2E21A 1F0YA 1E3SA 1U6IA 4U8GA 1XQ8A 1AUXA 2WUEA 3TQHA 4FHFA 4F72A 4RE5A 5B2EA 1I7DA 4LOJA 3VR2A 3PR3A 3NOVA 5JR3A 2PUDA 2OLKA 3IVAA 3NBXX 4F3NA 1NVPB 1SZTA 1JHYA 3KJQA 1E9DA 4IEIA 3K1AA 3F49S 1UFVA 4UMDA 3RFTA 5BQXA 4NCIA 1J0BA 3U3JA 4LISA 4MDYA 3A06A 3ZIDA 5KQGA 1ZXXA 1TVKA 2C95A 1YVUA 1J8YF 1VE3A 2VCHA 3H5NA 5T3YA 2J0QA 2AFVA 3H1BA 5AVQA 4YAGA 1ENZA 821PA 3LT5A 1X92A 1NI4A 4ZQBA 4RENA 3U7RA 4GP7A 2EJ7A 1W57A 1F4PA 1L5FA 3FOAA 5D87A 3V7UA 1H0RA 5H5NA 1ZH0A 4JLJA 2BM1A 4UTXA 3U61B 3NMUC 3G2HA 2RDCA 4ZT7A 1ECCA 2R2GA 1T15A 4Z1VA 3CX3A 1K3TA 5IH3A 1ZH2A 3L9DA 1UJBA 1P2BA 2PGXA 1DAOA 2ZKLA 3DYIA 3L1UA 5A7GA 3V5NA 3IT1A 4QECA 2PUCA 3O94A 1U0BB 3D8NA 1P2FA 4OHYA 1QPZA 1BSMA 4WKNA 2G0TA 3HZZA 2ZTHA 5CNJA 1TUBB 2YV5A 1BE1A 4YBZA 1JWLA 1DO2A 3TK1A 1RJ9A 2ZJOA 2UYGA 2V1XA 3BT7A 4F71A 4JVLA 1ZN2A 3KT6A 4LJ6A 3N3BC 4Q03A 4JYYA 3BRWA 4DIMA 2C7PA 5C4IA 1ZFNA 4JCCA 3D7NA 3V4ZA 3L18A 2XNCA 5CB6A 3C3KA 3ASOC 3IULA 4HH4A 1BJKA 4CQMB 2FPWA 4YV2A 1KJYA 1KRXA 3VYVA 1HV8A 5B3JC 3BB3A 3ZTYA 1OWMA 2C7OA 1A04A 1E79D 4WN9B 2A3RA 1Y1SA 2VWQA 2Q7DA 5DGXA 4BPRA 3SEFA 1TFRA 1KOLA 4Q9IA 4HNGA 1UPTA 4MA5A 2ZI4A 4WA7A 4BN5A 1ZKMA 4CF3A 1ESZA 3HHPA 1LX6A 2HO5A 5EG5A 2VYCA 5DHSA 1UFIA 2WJJA 1J8QA 2QR2A 4GWGA 1IWBB 2YMLA 3P0EA 3BA6A 4U3JB 1GM9A 1P2GA 3DL4A 3ZWNA 2B9ZA 3QK7A 2EWWA 2HYDA 2PKCA 2XUJA 5CHEA 2XBMA 2GZLA 3M5CA 2IHKA 2WIFA 3D3WA 3IRUA 4GZ6A 2NSLA 3BE5A 1YVPA 1KKUA 4OH7A 4MTCA 1I5YA 5KI6A 4KQIA 3SZOA 4LWSB 3ZOZA 2I2AA 3ZX4A 4EY4A 4LMPA 4U7JA 2D1TA 1XJWA 3G79A 5ADVA 5JD5A 4ZHVA 2JLXA 3HDYA 1N0HA 3SQWA 3OF5A 1E2EA 1Z0KA 3TFQA 3STZC 3AW9A 4H7KA 1OBFO 2GS9A 1E2NA 3IKVA 3K9WA 2JG3A 4BATA 5H3CA 3T95A 3KEGA 2LW7A 1ZXBA 2F9ZC 2G1KA 4LH7A 2A78A 1VKHA 3GT0A 3HCFA 1FNDA 5GQSA 2NVWA 5HMMA 5HJEA 5IBCA 4KLCA 4B85A 1OH8A 3UWPA 4F3KA 4PBTA 1MG1A 1C41A 1FRNA 4GZ5A 1CEEA 5DYGA 3CCUF 4M9QA 3SQNA 3K6JA 2LQTA 1ZIYA 2YHBA 3ZWBA 4ZDWA 2ZTUA 2ZBGA 2QKSA 5A71A 1EG2A 1BKSB 1JG7A 1GR0A 1WDMA 3MZ0A 5ELLA 3JARA 3W3AH 1GRCA 4LY6A 1IY0A 2NZYA 1WR8A 3RTDA 3PEUA 4AUMA 1YJ8A 4D6TH 1O5OA 1L8OA 5DH9A 4B4OA 2BVNA 1OU4A 2VN8A 4AKSA 2ODPA 2NYVA 2OG2A 3RGBA 3OOWA 5TY0A 3SXPA 2I1LA 3H9UA 1BEUB 1T3ZA 1UKVY 2G9QA 2I8CA 2JI9A 2PGLA 2ZTVA 2WU0A 4H16A 4LE1A 2DSNA 2UVPB 4YAWA 5JSKA 3VKFA 3QNMA 1B3BA 3VH1A 4BQSA 3ELWA 1XD9A 1P1RA 3I5XA 4N47A 3RD5A 1LPAB 3E23A 4OJMX 4LX0A 5NULA 4AP5A 1FRVA 2X9NA 2BEVB 3G67A 1WWKA 5E6UB 2O07A 3KKOA 2HJRA 3G8AA 3U31A 3I2FA 2ZUDA 3C4JA 1IY1A 2Q1YA 1ODFA 4YONB 3PXEA 4TKUA 3NAZA 1YFLA 3OM9A 2LGJA 4DLKA 1CP9A 3WV4A 4PG5A 2R1VA 4RVSA 2EKPA 1PNLA 2Q3LA 3B3QA 4WCFC 4GUDA 3WB0A 2PN1A 1TM4E 2VAMA 1ZESA 4P7FA 3RBAA 3P52A 3GEEA 5IWAB 1Y8AA 1YI1A 3L02A 4D9FA 1KZ9A 4JI0B 2LE0A 2X9QA 1NASA 2GAJA 3JYHA 3H9EO 2QWQB 3ILHA 2AN5A 2Y1GA 3CR7A 4GU5A 2FTKE 4YJFA 5K20A 2VXCA 3VVCA 5TIIA 2ODEA 3EQ7A 3TCNA 2PY5A 4LYDA 2CNDA 2A3NA 5IHXA 5JQGB 1Y9ZA 3CN9A 3CN7A 5L95A 4MTFA 4Y98A 4QTYA 3DCIA 3EDMA 2QI2A 1GG5A 3FSGD 3GHYA 2DY0A 1GO1A 1M5TA 3RA5A 2FQYA 3AY6A 1J22A 1YQ9A 4Z1OA 1J95A 1OA0A 2AEMA 2YZGA 2JBWA 4FWTA 1LUWA 4A5UB 4JI4B 3L77A 2FP3A 4JLVA 4ZCSA 4UCOA 4DE5A 5HF6A 3T3MB 5JCJD 4D9BA 1FSPA 4X00A 3DW1X 3U26A 1JFFA 4BNXA 1VJDA 1JLHA 4JKOA 4RVGA 3GZNA 5A4DA 3H2KA 4GLOA 2PR7A 2P6JA 3QEMB 2EZPA 3RT7A 5HYVA 1EWTA 3SEZA 3UH1A 3OC6A 3HO8A 4HDAA 1R9MA 4Q01A 1HL3A 3S8MA 2BM9A 4TVSA 1E2QA 4AU1A 1JHDA 4QNNA 4OX9B 1PYDA 1TUBA 4UUNA 3I56F 4IW3B 1EJ2A 3FPJA 3G0CA 5KZMB 1O94D 5TT1A 2J33A 1KK2A 2IUYA 4PFKA 1UKZA 4A8JA 4TLDA 3I7TA 5KA6A 3U0OA 3KZNA 1V7CA 1HDRA 4UE2A 4Y1RA 4F5WA 3OWHA 5EFZA 1N5KA 2GEBA 1QS0A 2UU9B 2OUIA 2GN8A 3TLXA 1DCFA 4M0MA 1GCOA 3Q85A 4R6ZA 4JLKA 5LZ4A 2O19A 5DHPA 2CE2X 4INZA 3HV0A 1DC3A 2E74B 1JQLB 2H4FA 3DLAA 4L28A 1N32B 1BX1A 5CIYA 1ODEA 2J7PA 1I7SB 5KA5A 2HSDA 3D9QX 3PDJA 4Q1EA 5I9BA 4ARBA 2PUJA 4K5QA 5H82A 4C0AC 1T0KB 1VL1A 1TCBA 1LSOA 4DV0B 4IJKA 4JP8A 1NZJA 3I2HA 1Y82A 4G56A 1BO6A 1DF4A 1EEXB 3DFUA 3S27A 1NE2A 1C0LA 1X19A 2FRDC 2QNBA 3AMVA 5K3DA 3L6RA 4CKBB 4FLZA 5KYXA 4M87A 2Q3CA 3C7CB 4MQUA 1VQLF 1PWEA 3COWA 4BMYA 1E2BA 2V0CA 2JFVA 4GDMA 5LNK1 1EK6A 1K68A 3KXLA 1VB5A 2GM9A 1Z6YA 4X8MA 2W42A 1Y6ZA 5E9QA 1TAGA 2QX8A 4FFPA 4EHBA 2WZCA 3FROA 4KKVA 1Z29A 1BMQA 2J09A 4Q18A 2P22C 3V42A 1KVRA 2VWGA 3P2EA 3BWMA 4JZYA 1GRRA 3EVDA 2I6QA 1W2HA 1A2KC 3V4SA 3AK2A 4IJQA 1RFGE 1E2GA 2R1ZA 1GDHA 4BGUA 5EYPB 2R7MA 4HDCA 2HI0A 4KQWA 4AJHA 4B62A 4ASUD 3BX1A 3MTIA 1TM1E 2K87A 1C14A 2R1UA 3FLEA 3ET5A 4QGAA 5CITA 1YEWA 5HIKA 2E76B 3HJRA 3V7WA 3EDRA 1QP4A 2WFAA 1FZTA 4IEEA 5KVVA 4XWYA 5LQJA 3CZCA 3W7VA 2I4OA 1BX3A 3QSYA 5KOJB 4LGVA 1IRXA 3MN1A 2QLFA 2PGOA 4YP7A 2ARKA 2WT8A 5ALKA 1GYRA 1CKEA 4ML3A 4EYOA 1FUYB 1TJ3A 2ID9A 3CUUA 4UDNA 2PGNA 4ZTUB 4TM7A 1YKGA 3ZWCA 3RRXA 4EFDA 2PRZA 2ZJ0A 2IDJA 4MNTA 4M0KA 4UD6A 1BFKA 2HBYA 1GQYA 4EKWA 3FX7A 2YS7A 3QVTA 3T5CA 5AK5A 3B8HA 3DT9A 3DXYA 3IVGA 3GLTA 6CHYA 1P73A 1VPEA 2H57A 2H7YA 4RSHA 5A1TA 4DLRA 1X7WA 1V55B 1NBIA 1IQ0A 2FG5A 1T34A 1F48A 3EFHA 4OXKA 1RBZA 2V0NA 1NY6A 2NO9A 3S0HA 3OIFA 1Z28A 6REQA 2ZIAA 3LFHA 2FMIA 2HP3A 3AXTA 2X5JO 2B94A 4L5IA 4IBOA 3UJ7A 1R3KC 2QUHA 1RZVA 2GM3A 2FEXA 4IDFA 1ZH8A 4OGQB 1VCNA 2FPPB 4LQ4A 3S40A 3RC8A 3IBYA 1ZTEA 1E8MA 4WTOA 2ZULA 1S8NA 1T9HA 2GR9A 2PIAA 1UDAA 3FVVA 1WAZA 5IWAO 1W88A 1Y48E 3K7EA 4LF6O 3WBJA 3JVVA 5JTTA 4EMUA 3UICA 3OBWA 4B3TO 2FLKA 3ABSB 1KFBB 3IVMA 3NP7A 3NHMA 1GO2A 1U0TA 3LBIA 3HDGA 3TNLA 3NEJA 3M7IA 3SMVA 1L1RA 3FJOA 1E9VA 4QM6A 2HP0B 4BJ3A 4DCUA 2GK7A 4NXMO 1R6TA 3SIRA 1VE5A 1YF2A 2QM0A 1LQ2A 4AF6A 2BGIA 5TX7A 1IM5A 1SBCA 5HP8A 3FWNA 3RVSA 3SICE 4EAQA 1JR3E 4ZI7B 1Y8RA 1Z22A 1Z7EA 5F64A 3RVKA 5B1EA 3MFQA 5IT9M 2IEDA 3LA8A 3O9OA 2AUNA 4TS4A 5GVSA 1KMMA 3G2JA 3LLUA 2QD3A 2HWXA 4FKBA 3T7AA 5BN5B 3W5DA 3PE6A 1GKLA 1D2NA 3JTMA 1DP4A 4A8HA 4K8ZA 1GQQA 3ZPXA 1VGRA 2P30A 3E48A 3HO6A 1Z08A 1P72A 4RFSA 1QUFA 3CJHA 3B9PA 3GDHA 4R9RA 1R5JA 4R9VA 2J30A 5BWNA 2O2EA 2N42A 3AEKA 5KQMA 5AIBA 5JS1A 3D2AA 2VP6A 2QPLA 1ECBA 2ZPUA 3IS3A 1OFIA 3MCTA 3Q2IA 1MO4A 3S44A 2OC9A 3D7MA 4YAIA 4CMEC 1U8YA 1Y3BE 1EKXA 1NVKA 4UV8A 2QYHA 4L4RA 3HJBA 1WSWA 3KKPA 2IFTA 1M93A 1D2AA 3DA8A 3V55A 2BR4A 3B2EE 4KYUA 5HUJA 1TMKA 3GYQA 3OW2F 1XKQA 2FSVC 1A7JA 1DIGA 2FZKA 4L50A 2F3PA 3AETB 3IR5A 4O4JB 2TMKA 1BXKA 3T3PB 3F7NA 3S02A 1PJRA 1U11A 1YQWA 3B2QA 4U5XA 4YNBA 1AOXA 3BS4A 2AYXA 2X9GA 3PGLA 3DKKA 3OEYA 1UMBA 1XEWY 4HDKB 5JFOA 3QUBA 4NLLA 3VPXA 3W2TA 1L8AA 3D3KA 4F4CA 4J43A 4NBVA 5L40A 1XPJA 1E7QA 3GFBA 1QHSA 3FFQA 1B2RA 2WU3A 3ICWA 3R3VA 3UBMA 1DAPA 2HM7A 4EPVA 5B36A 3J7AU 1TF2A 2H52A 2WP8J 4KRXA 3T41A 5FBVB 1ONSA 1E8DA 5FL7A 2CUTA 4DV1O 1ZJWA 5EWJA 3ANLA 4TQUS 4EHFA 4JZ2A 4P3PA 4QTZA 4PDMA 3CCSV 3RUPA 3H5WA 4AY2A 4OU5A 1V1MB 2IGTA 2JJ1D 3EN0A 4KJZA 3T5PA 2P2DA 3PDIB 1LV8A 1ETUA 2J5KA 4LQCA 3RG8A 5GJBA 1Y6JA 5KNLA 1F5SA 3SIUA 1Q12A 3GP5A 3CS5A 1MV8A 3FPCA 3HDJA 2NU9B 1HTBA 3KU4A 2GJKA 2R1TA 4FFNA 3W7XA 2EIKB 4IIUA 3WYNA 1QG0A 2FHPA 2X6CA 1YDEA 3D6JA 4QPZA 3AVWA 3MDSA 1T1EA 1XZGA 1O9HA 3NHSA 4UE6A 1V8ZA 2D7JA 4BN4A 1S2MA 1U81A 2Z58A 3B1VA 4Z0NA 4MH0R 1EU1A 3DO5A 1M8KA 4E5YA 2XD9A 3EHDA 2YMPA 4H1TA 3VTFA 1JV2B 3MOSA 2O2DA 3GNTA 2ZSEA 3NBKA 4KSBA 4QXOA 5CVCA 4BIMA 3MTGA 5EP1A 4PSUA 5HY1A 3EW9A 1UUFA 2ZIVB 3GT7A 1K9VF 1OH5A 5HM8A 3C7KA 2PM8A 2XDQA 1LJ8A 4D9EA 5IN4A 1MB9A 2RARA 1M0TA 3OF2A 2ITDC 3LSUA 1IV2A 3LFUA 4ZAVA 3AG1C 3TO5A 5LLDA 4JDUA 2Q6TA 1YJAA 2PQ6A 3ZKWA 4X66O 1D1SA 2L19A 2UUCO 1USVA 3BF8A 3JQGA 3NB0A 2PZ8A 3LPDA 3HC7A 4HF7A 5IF9A 4OX9Y 2IU6A 4NPAA 3VQTA 2G9VA 1SCQA 1QFSA 2RKOA 3NH6A 2EFHB 4TQDA 2CNWD 3D43A 1XL6A 4DV0O 3T3GA 3WBKA 4KE8A 1ZX3A 3KLBA 4LNUB 5CTJA 5IAGA 4B3IA 1ZA2A 3HDHA 3QBDA 5IJAA 5A03A 4L78A 1AN9A 2PUVA 2WYVA 3N6VA 4WA8A 3TJRA 1DAMA 3ZW9A 2H1LA 2JGRA 5IK2D 2BTQA 3PNOA 4YCSA 3A2MA 5CYFA 2G0AA 4IO1A 4O5AA 2G63A 2WWVD 3VISA 2OV1A 1XE3A 2YCBA 4LJKA 3KBBA 3P27A 1OAOC 1YB4A 5HCUA 3NHZA 3DBHB 5LQSA 1XZ8A 1YR8A 3YASA 5H68A 3ZDAA 3QMMA 5DBHX 2GVDC 3A3OA 1JILA 5SZHB 4CMEA 2PUAA 4NMLA 5KTNA 3LPLA 4BB6A 3IUNA 5FOUA 2MSLA 3V8RA 4Z53A 2JGDA 4OX9O 4QTXA 3BXEA 4Y0AA 1FNMA 2B8EA 2GZ2A 2IYTA 3N8HA 4C0WA 4E1BA 5BWOA 5LN1A 3U09A 1JNYA 4ZQHA 1H2EA 3WJ1A 4H3SA 2EFYA 1X3SA 2H1VA 4ZAGA 4DR1B 2VJMA 1FW6A 2A35A 3EZGA 2FKNA 1K6EA 1KVUA 2FLVA 2P4HX 1JEJA 4C04A 1P74A 1TLLA 1G9SA 2VP9A 4PX2A 2UXBB 4QO7A 5BRJA 1S02A 4BVLA 4M7RA 4B7XA 2BFCA 1ZQ9A 3FGOA 4PLWA 2WAAA 4D74A 1O6GA 1NONA 1OI3A 3WNDA 2O8VA 5LIRA 3WGMA 1EM1A 1PG2A 3L8HA 2O6LA 3B7WA 3BJRA 1BG6A 4HXFB 4IRXA 2O7SA 4KCGA 4U0JA 1T36A 2HQ1A 3BGOS 3GEDA 3MAJA 4AY5A 4UMFA 3TOVA 3DO8A 4DS3A 2EERA 4RF3A 4XPIB 1T29A 1W48A 4KH1A 3B6EA 2DT4A 4JNKA 3NAGA 3JD1A 5BVGB 1E1QD 1AK9A 2FZVA 2MTBA 2D2CB 2GHIA 3GVXA 3UCXA 4UASA 3QX3A 1N78A 1G1AA 1XN1A 2P4SA 3D2LA 4WADA 1SH7A 5DX0A 3ELUA 2Q28A 3HBJA 3LIPA 4RVOA 4EG3A 2HLDD 4PYNA 1Z73A 2CNOA 2PS3A 3PLRA 1LXCA 4B87A 3EOAI 5JMWA 1OIWA 4C05A 5CW1A 1DX6A 5IYCO 4X3MA 1DB3A 2VYVD 3QEMA 1MA3A 3ZCSA 3JQAA 1YCHA 5ICEA 2PH3A 5B6JA 4GKKB 4C6RA 1Z2DA 2ZIEA 1VL2A 3DOHA 2R79A 3FZEA 2C94A 2QK4A 3LIIA 4RH1A 3I4LA 3WLSA 3ZDQA 4G01B 2KG7B 2ARHA 1F9EA 2C2GA 2ZOSA 4XB6B 1BOOA 4YRJA 5LGTA 5TARA 2AJTA 1XPOA 3UPTA 2DKFA 4LRXA 1DG9A 3IH5A 3TBFA 2XHZA 3DE1X 4PLVA 3ZEDA 4IICA 3KUCA 4HI0E 4X1YA 2FCRA 2OSBA 1PD1A 4WBXC 4CMIB 2A1IA 4RDIA 2PRIA 5HPYB 1RYNA 3ND7A 5ALQA 3AY3A 4U5QA 3HU3A 4R1OA 1CNEA 3DC2A 3ETLA 1ORIA 3F7MA 3H1TA 4GOKA 4X97A 4YJFB 2RMKB 2OWOA 4J3NA 3STVA 1DG3A 4XWWA 5EQDA 4P4SA 3C6MA 1R88A 5HMLA 3HKBA 2OGZA 2ZREA 3L0OA 5IJ0B 1G8FA 1N2JA 4KDRA 4K9KA 4EA8A 5FEMA 2X86A 2HHJA 1GKUB 1IB0A 5K1XA 3J80N 2WLNA 3HFSA 3U0BA 3P9XA 1BQEA 1KKMA 4UAUA 4UTOA 3ASZA 4EYEA 2QVZX 4PG6A 4TKUB 3LP8A 5ETJA 1ISSA 2HFJA 1Z9BA 3DZKA 1R8JA 1GH6A 3ZHXA 1JP7A 4RHEA 5EKUA 2VJMB 4D5EA 1IQRA 2E55A 3LQFA 3M8KA 2DWOA 4INOA 3CNEA 4H27A 5K8VA 1AKNA 1B3QA 2X7RB 3BGDA 3GBVA 1W2BF 3OPXA 3FXAA 4K40A 5FR1A 4Z2YA 3WLTA 3ZCTA 1VLHA 3DZCA 3O8BA 2NU8A 3CF0A 3GG9A 4GSLA 2E5WA 3EZ2A 4LOAA 4W8GA 1PNMA 5DDIP 5U4QA 2OY0A 3B1KA 1F3OA 2O2ZA 3EBLA 3FHCB 1QHEA 1ZAKA 2W2KB 4ZCTA 3DM5A 2GYVA 2C8KA 1LB1B 5AOCA 4Z0PA 1T1IA 4FHGA 3SIWA 1YONA 4MTLA 5HWSA 1WZNA 1YAJA 3IGAC 2HA4A 2JI7A 2M6LA 2P9HA 3M3HA 2ZTSA 1AB3A 3OJLA 4L72A 4B6OA 4OREX 5KNBA 3VNQA 5DN9A 4G3XA 2FX3A 5K4HA 3W6ZA 3FBWA 1F60A 4M99A 4X85A 1B7GO 1V26A 2QQ5A 2IEGA 4TN1A 2H1OA 4R8LA 4KREA 1RAGA 5BW8A 4DHWA 5A2QN 3QHQA 2IRWA 4PR0A 3T99A 4J2OA 3IDZA 5JCOC 3A1CA 4IHQA 1U2GA 2NXWA 1YZFA 1NF3A 2DFVA 4RFLA 5ELMA 3CMEF 5I5EA 1OR8A 1Q7RA 1QONA 2ZUWA 4NONA 3ON1A 2JFNA 2PXCA 1HYHA 3LHKA 5JC8A 3LYLA 4TLBA 4I14A 3EPHA 3R0XA 5C1IA 1RJDA 1STOA 1YASA 2BTOA 1NYTA 2Y1LA 5H16A 2PZKA 3GEIA 4DXDA 5EQJB 2N74A 2ZRFA 3QPBA 2X1LA 3UMJA 2AJCA 5EIWA 1F8UA 4FC6A 1ORVA 4KNWA 1E3IA 1XYYA 1ZBDA 2A84A 3MD9A 3K79A 2I8AA 4QXQA 4R16A 1DQSA 1X38A 2YJ5A 3ETCA 2QTMA 4WT7A 4BNKA 4CODB 3U1TA 1CE8B 1SELA 2Y9PB 4Z7OB 2FZCA 4I4IA 2UUBB 2R6AA 2YWRA 5IDWA 2DT5A 3B8EA 4J1SA 1EI9A 421PA 4OQQA 4DILA 1M73E 1ZCFA 1RQXA 2W90A 1D0SA 2O6HA 4FFKA 4ZBMA 4MW8A 4EB6A 3D36C 2QA4V 1MB2A 1UBSB 4HGZA 5DK6A 3N8DA 5DI9A 3VO9A 4C14A 5JY1A 4RTOA 1Q6HA 1QVGF 1BE8A 4HS9A 3F5TA 2I6FA 1CB7A 2AKEA 1CNFA 3NNNA 3WK6A 3ABRB 3PDWA 2NUPB 2Z4TA 3L73H 3UTCA 2XASA 5B4VA 3E35A 3I5UA 1LEHA 2K2WA 1VK3A 5FWNA 1Q7EA 1OGJA 5KMGB 1OLSA 4K3AA 1L5VA 4O4LF 5L51A 3VR5D 3VH4A 1UFQA 3P5BA 5I8PA 4DW1A 3UKOA 1I7QB 1WXGA 4R8KA 4NIMA 3ZVRA 2IYPA 4WINA 3HKEA 4G63A 1QSGA 1TU3A 4GM1A 3RKUA 3TD6A 3ZV3A 3ZE9A 2XSZD 4YAJA 1THZA 3LNNA 2WWYA 1FQWA 1K27A 1QE0A 1N57A 1O7JA 1RZUA 3ANYB 5IBPA 4R1QA 4D26A 5FBLB 2VJNA 3H5IA 4IQFA 4YUWA 1Z17A 1W1IA 4Z0HO 5ARBA 3FZGA 4RUKA 3EDYA 3QE3A 4LZWA 4Q4AB 3QE0A 2AN3A 1PPJH 4DW0A 3BYZA 4OM7A 2J3KA 3QHDA 2NQTA 3H4TA 2DR0A 3KTOA 2QLJA 3PF8A 3VYRB 3IT0A 1UIRA 5AICA 5AM3A 2Y6VA 1HFEL 4N9QA 1YQTA 5ARCA 1QO7A 3P3PA 4L87A 4E5KA 4UNQA 1OB2A 3EMDA 3CGGA 1TE2A 1XRNA 3QKRB 1E5QA 4EI2A 3VNRA 5LZ8A 2C4NA 4RPCA 2BHSA 4F5EA 1QQTA 5DMXA 1BZKA 2CFOA 1FDWA 5MHTA 4HN9A 4IDHA 4YIKA 2A9RA 2DYSC 3ABKB 3GRKA 2PT6A 4K1LA 4WW0A 3EXIB 2WDZA 4PS0A 3T7TA 3TEFA 5IX8A 1ZHOA 1JDSA 1R8XA 2XDYA 5AR1A 4RVHA 4HNAB 3PNBA 1QP7A 4RETA 1T91A 4LJ8A 4H15A 1P9WA 3FH0A 1W5TA 2A1UA 4L73A 4LHSA 4Z1MG 2NUAB 3OICA 1UXOA 2DPMA 4K6OA 1IXBA 2J85A 3OHMA 4PZCA 3EDQA 1L5GB 1GFIA 4G5FA 2FP4A 4M6WB 1SVKA 1DJOA 1T2VA 1IURA 3MELA 4EGFA 1CQZA 1PZXA 2YYSA 1ZL2A 4H1WA 2G1PA 2AOVA 1GAWA 1L4GA 3B3JA 1KYIA 1DTSA 2AF4C 4UBNA 1NSTA 5HKLA 5HF5A 4AFNA 5K0JA 2NO6A 1QG6A 4C08A 5C8XA 1TPZA 1QZZA 3AP2A 1KZ1A 3RANA 3AXSA 3CISA 4J7XA 3IPYA 3RSZA 1KI8A 6ABPA 3GUVA 2O2HA 4JBGA 3RRYA 3HTXA 5E8JA 1QPGA 1YZNA 1HWYA 3CX8A 3OT4A 4JAVC 3IUQA 2P4VA 3HBFA 4MTOA 4LY3A 2C5HA 4QQRA 2Q5EA 2JGKA 1Y33E 4MP6A 5D85A 3RNLA 1SXJA 4OGGA 2I4IA 3PSAA 3TMKA 4CI9A 2JLWA 1QIIA 1RWKA 1SBHA 2A59A 3GFTA 3H9CA 1G63A 3CKMA 5DN6A 4PD4F 4GCZA 4GR5A 1UPFA 4M89A 2PWAA 2GHRA 1MIOB 1W34A 1PNQA 3JSNA 4A5OA 4AZVA 2Q3MA 1XZHA 2ZBQA 3PTLA 4KE6A 4BVHA 1U4SA 2JGLA 2D2IA 4WXYB 1I80A 1SCNE 3VC1A 1MAAA 3N0VA 3BMQA 5JAIA 2QT9A 4L74A 3AIIA 5FLXM 2UZAA 3HJCA 3K9HA 3K06A 2B0CA 4PQFA 1T9GR 2K9PA 4MR9A 3IEVA 1AB5A 1A77A 1CVRA 4R6WA 3K5MA 1UBHS 1NT4A 2C7RA 2QWOB 4HAVA 1SUBA 4X90A 1XQ9A 4JTCB 3VNUA 2DMXA 5K0SA 2YY6A 5FHRA 4CU2A 1KB9F 4FZ0A 2IHZA 4J0IA 4MVJE 4PCUA 4RD2A 2FWAA 5E4YA 5AHOA 1R3IC 3TTYA 2X41A 3FSEA 3WR5A 3WLEA 2GLTA 4HNUA 1YTUA 2QN7A 1SXJE 1AY0A 1J1ZA 3CWQA 3SVZA 1W9HA 1ECJA 3I5AA 4D44A 1KY4A 1ECLA 3MFYA 5BW4A 3S68A 3MPOA 5DJ5A 4BO0A 5FPPA 1ZAUA 1Y3IA 5DGHA 3JCMM 1VDZA 1NJIW 4ZIRB 2C92A 2XTNA 4KOAA 4YA6A 1EX1A 2BEKA 3CMEV 2RBKA 2W6MA 3E2PA 4ND6A 1GEEA 3IERA 4E5PA 4ZOQI 1NL3A 1Z0AA 2G9ZA 2YYAA 4W7HA 1UJMA 2V6IA 4FYXA 2FU5C 3E8XA 2ZYGA 3F1KA 1H1LA 4UHKA 3UENA 3IA2A 3KUUA 2PLAA 4O3MA 4IOJA 4N0QA 2HLDG 1UJCA 3KOXA 4OXXA 4ARZA 4D4MA 5CP8A 1J5XA 3WSVA 1EWVA 4QOEA 3GNLA 5GP1A 4UOEA 5GONF 4RNDB 4YQEA 3CW2A 1K88A 4ZOLF 4YCAA 3DE3X 1M1NA 2I29A 3DDHA 1GUDA 2GBFA 3DWFA 3PD1A 4J6FA 3HGQA 4EW6A 1OI7A 1E7KA 1X7ZA 1L7MA 4HRAA 3KIZA 4E3WA 4M9ZA 2G7MC 1FDTA 2CKDA 2Y3IA 4N0MA 2O4UX 1VQ8V 2OFFA 1HLDA 4AHCA 4YHBA 4RO2A 3ZO8A 2HF9A 1U04A 3FVQA 3UK6A 1CUDA 3P9QA 7REQB 1QR9A 1ISIA 3ED5A 2QM4A 2UXCO 3DMFA 1J7KA 2YJNA 5HFAA 5I4KA 2WE7A 3BK7A 3KD2A 5PGMA 1UMBB 4Y2QA 1S4MA 2Q8VA 2PYJA 2E0IA 2WUDA 1VE9A 3ABOB 3LG2A 1GTSA 3TIVA 3SWWA 1SU4A 2OBMA 2QNIA 2Q3EA 2D4HA 4WZAB 1Z6AA 3OGIB 3RYCA 4ETWA 1GV1A 5E2IA 3ASUA 2B8NA 3CX7A 4QPDA 3PQ6A 1J07A 4IIJA 1U8AA 3PPVA 1DJNA 4PXAA 2L42A 5ESDA 4JKIA 4BQOA 1JEDA 3AUXA 2C8VA 2XWQA 4X45A 2RJZA 3O2QB 1VPVA 1A8SA 1CBUA 3VTKA 5LQCA 1KK3A 3U7EB 1INLA 5C5CA 1EEHA 3LCMA 3L7MA 3E2IA 1TIBA 4IZ6A 4JBHA 5B1SA 5IEBA 3OCUA 5DEDA 3TRDA 3PD7A 1NKVA 3KCYA 3MUOA 2IY8A 4NBRA 5J58A 4UNPA 1E3TA 4O2AA 1CLIA 1Y74A 1P6UA 3C9SA 1QK5A 1YE3A 2O3JA 3OEEG 1YMQA 2JA2A 2O50A 3M1LA 2GZDA 4NC9A 1Y1QA 1JHAA 1OLXB 4JOBA 4NU5A 5EFOA 1Q20A 1TMYA 2TMYA 5I7FA 2XCQA 2VKQA 2AUMA 1AT1A 4J9UE 4L3OA 5IVDA 5B4UA 1XDWA 3RHTA 3ONDA 2IELA 1WMFA 4BP1A 4KACA 3GJ3A 3VOUA 1N2HA 3EZFA 4KMMA 3K1AB 5EHXA 3HEBA 1KUQA 2H85A 1P44A 1XZKA 2GSMB 3OZVA 1ZHFA 2JFHA 4PNHA 3F5FA 1UXKA 3JQ8A 3QF4B 1Q0QA 3GRAA 3TDNA 5AUNB 2WLKA 2J08A 4P81A 4PAOA 4O6VA 4CCYB 2O8CA 4XCQA 4AMBA 2CW4A 5DNYB 4YP5A 1QVFU 1XEXA 4RKRA 1IQUA 3PHHA 1J24A 4J4HA 3RROA 4EZEA 4LMBA 5KTYA 3S8EA 3DGEC 2LCQA 1YRQA 1VHAA 1Q7YW 3GRFA 4OJQA 5F3WB 3NDBB 3ZHOA 1SVLA 4RE6A 4W5JA 4ZIRA 1M72A 1ZRNA 4K0KB 2GCEA 1ZU5A 2PD3A 1QFYA 3I2YX 4RKFA 2OFWA 3ZZNA 4LNUA 2CLIB 3ES9A 1IL0A 1CR2A 1VBMA 2EULA 1Z8FA 2XCIA 5ENZA 4KUEA 3UUGA 1KAEA 3SF0A 4N6OA 2CTRA 4NXMB 1VQ8F 4IG4A 2EHJA 3FB6C 3T0GA 2KG7A 1EZJA 1PV2A 2E85A 2LWIA 3FUXA 1I2CA 2IXGA 5LGNA 3LX8A 5IBQA 3SKYA 3PYXA 2WJZB 2VF7A 1NQAO 4FZVA 1W0JD 3RVBA 3GGCA 1XZLA 3KG2A 1C3OA 1S6YA 1ZNXA 2QE7A 3WPXA 2P3LA 3UT6A 5J5AA 1ZLZA 3X1ZA 4BMSA 3IEUA 4I3GA 4MYRA 4UXNA 2PGGA 2Z5UA 2AC4A 3K0FB 2YOHA 3QY0A 2YNMC 3ODPA 1NIJA 5MF6A 5CFPA 1UZMA 4FR0A 1LDYA 4GBMA 3QRWA 4JI5B 3HLYA 3V97A 4QG7A 5I7VA 3A7EA 1XZIA 1GFWA 1QHGA 3OSZA 2EFJA 2YR0A 3T7IA 2W2LD 1AA9A 4ECAA 5BN5A 3MGCA 3WGLA 2PO7A 3OZIA 4I46A 3UB4A 4MULA 2G88A 4UPVA 3WNQA 5LOVB 1QD9A 2EW8A 1N5RA 5JAOA 2AG5A 5FBKA 4YRCA 4RUFA 1OJHA 5BMVA 1DHRA 2ID8A 2EBUA 5IKOA 4RTMA 3BMNB 4JGIA 3IIIA 3WYCA 4Z9XA 2OP1A 5FA6A 1B23P 3RTEA 1JH8A 4LWSA 3BXOA 1E18A 2AUTA 4RF2A 1E59A 4G0QA 4EY7A 4F9GA 2I54A 3EW7A 4OFWA 5EZSA 3IC9A 3K1YA 1J0DA 1NX6A 4ZU1X 2O52A 5EE0A 2XQIA 4YAFA 4QBKA 4LF8O 3I01A 3QPDA 3G0OA 1NSFA 2BPOA 5J4LA 2I91A 5JJEB 2BRUA 2DHQA 3CKKA 1MOFA 3T1QA 1H8HD 1RYHA 1J2RA 4RHYA 4TWIA 3E8BA 2O8BA 4CR8A 1U2SA 4MYHA 3NHJA 4WGFA 1T0IA 4UCVA 2HDNB 4Q1FA 5AVKA 1XDDA 2G4VA 2P9BA 4LFCO 3FD6A 1I30A 3SEAA 1VQNF 1U1CA 2HDWA 3FYTA 4FCCA 1Q0RA 4G07A 3DVRX 5HFNA 3UT5A 2IYSA 4MRSA 1EA7A 3BQMB 3DVLA 4OP3A 4ZANA 1PRYA 3R5FA 2LCAA 4GM0A 3GPCA 3MAGA 4TKVB 3EXHA 1Q3HA 2IPOA 2XWJI 4HX2A 1N3YA 4YHHO 2HH9A 3HUEA 1N2GA 2NUTB 3LWBA 4LXIA 4MS4B 2PXHA 2QPTA 3IUBA 3Q5DA 1K92A 1HNXB 4P5PA 5CM8B 3WLKX 1DCTA 1P61B 3E58A 1PF7E 3EC2A 2AKAB 1U7XA 3QLVA 1RP7A 1QNMA 1NLUA 4HFJA 4ZDKA 4DR3B 1UWKA 4IKPA 4ITVA 3WLIA 2ZCJA 1NUAA 4XLTA 3ZKWB 4DLWA 2YHIB 3GQBB 1X39A 3QA9A 4ALKA 2BF7A 1GLNA 2ZB4A 4K1XA <