3SIVA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, dimeric form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
total genus 41
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3sivA00
1DT9A 3E20B 3J80M 1X52A 1S72F 3CCQF 3I55F 1VQ8F 1VQ4F 2ALEA 2JNBA 3FFMA 1NJIH 1K8AH 1KC8H 3LFOA 3CPWF 1Q7YH 3V7QA 4BY9D 1YIJF 3CCUF 1KD1H 2I6DA 1RLGA 2KG4A 3CC4F 1N8RH 1H7MA 5GINC 1VQOF 1JJ2F 1QVGF 2VGMA 1CK2A 3MCAB 1M1KH 3PAFA 1VQ7F 4BW0B 4X3MA 1YITF 3HJWC 1W41A 3CD6F 5GAPK 2WALA 1KQSF 2QI2A 3HAXD 2KTUA 1YI2F 1X7PA 2KTVA 1YJWF 3N4YA 5A2QM 1CN7A 1T0KB 3NVKE 1ZWZA 3CG6A 5FLXM 1VQ6F 1GZ0A 3CCEF 3CCMF 1K9MH 1VQMF 3ON1A 3CCRF 1E7KA 3CCSF 1Q86H 3CMEF 3CCLF 3CC2F 3J7AR 2OHWA 4C4WC 5GANK 3V7EA 1RA4A 3G4SF 2QEXF 1YJNF 3OW2F 1XBIA 3CCVF 1VQNF 1VQPF 1VQ9F 3CXCF 3NMUC 2CZWA 1VQLF 3JCMM 1YJ9F 1W42A 2BO1A 2HVYD 2LBXA 5G4VC 3LWVC 3CPQA 3RA5A 2OTJF 3OBWA 2FC3A 3LWQC 4LCKA 2VGNA 1SDSA 3RA6A 5G4UC 3WXMB 2OZBA 5FJ4C 1IPAA 3CCJF 5GIOC 3LWRC 3NVIB 2LBWA 1K73H 3VI6A 3I56F 3G71F 3AGKA 3N4ZA 3VMFB 3E1YA 3SIVA 1GO1A 3GYQA 3IR9A 3SIUA 1M90H 1VQKF 1YHQF 3O85A 4NUTA 3G6EF 3NK6A 1W40A 3J81M 1VQ5F 4TZZA 2AIFA 1Q81H 2QA4F 1QVFF 2OTLF 3CC7F 3JAMM 1PXWA 1W3EX 1X7OA 1W2BF 3LWOC 3PLAC 5EWRA 3LWPC 5EO3A 1Q82H 5IT9M 5DCVA 1GO0A 3NK7A 5GIPC 4X3LA 3CMAF 1NMUB 3OBYA
chains in the Genus database with same CATH superfamily
5CB4A 1DT9A 4BT7A 3J80M 1W59A 2DYYA 2JNBA 3HKEA 1KC8H 1DBFA 5IYZA 3LFOA 2HRUA 4BVRA 2NMUA 3CCUF 4O4HB 1H47A 3WPXA 1RLGA 4WBNA 3KJJA 3CC4F 1N8RH 1JJ2F 1VQOF 5J2TB 2H8EA 5LP6A 3VTIC 4ZHQB 3MCAB 5AVMA 5MN5A 1M1KH 1T0AA 2ZVZA 1J7HA 3N2GB 3MDOA 4X3MA 5C8YB 3JAWB 1W41A 4BT5A 4O4HA 5EB1B 2QI2A 2HQSC 2KTUA 4I55A 1UI9A 3VYSC 3ZO8A 5J2TA 5JQGB 1TUBB 1CN7A 4HNAB 3E22B 4RQOA 5LP6C 5HY1A 1W57A 1U3PA 2F9ZC 2UYPA 5FLXM 3N2GA 5C8YA 1GZ0A 3JAWA 5HY0A 4C81A 3ON1A 2UYKA 3QHDA 1Q86H 3CMEF 2Z1TA 2PHNA 5GANK 1RLUA 1RA4A 4B5CA 1YJNF 3HTNA 1TUBA 3OW2F 4HNAA 3E22A 1VQNF 1TVKB 2BTOA 3CXCF 2CZWA 1VQLF 1YJ9F 2LBTA 3ZOPA 3P4EA 2RHHA 5EIBC 1KNKA 2B33A 2OTJF 3GTZA 4RHAA 3VOBA 1SA0B 1TVKA 2VGNA 3LDTA 3WXMB 2HRYA 1IV1A 2GZLA 2RB9A 2ZODA 3P0ZA 4TV8B 3CCJF 5GIOC 1U43A 2HS0A 3WJRA 2V9YA 3I56F 3G71F 4ZHWA 3AGKA 3V3TA 4TV8A 3SIUA 3DC2A 1M90H 1YHQF 3QTYA 4NQ3A 4NUTA 2UYNB 2AIFA 1W5BA 2QA4F 3RYHA 4ZHYB 1QVFF 5EAZA 1W5FA 4BT6A 4O4JA 4F6RB 1W2BF 3VIUA 3JATB 4EB6B 3LWPC 3WPWA 4C8EA 3RE3A 1QU9A 3ESJA 1NMUB 3RYFB 1S72F 4LNUB 3QUWA 2ALEA 3FFMA 4F6RA 1Q7YH 3D00A 3JATA 3V7QA 4EB6A 5MN4A 4BY9D 4YJ2B 2CWJA 3VO8A 1KD1H 2FGYA 5JCOA 4C8IA 5HP7A 5GINC 4U3JB 3RYFA 1JY8A 2VGMA 1CK2A 4LNUA 3FPIA 4YJ3A 3M4SA 2Z1EA 4BW0B 5LA6A 4I50B 4BVTA 5JH7B 4YJ2A 3CD6F 3HJWC 4XCQA 2GVIA 2H6LA 2AIZP 1X7PA 2AMTA 5JCOC 5LP6B 5A2QM 4U3JA 3K12A 1T0KB 4EI9A 1YGYA 3KHNA 5HXZA 4G4ZA 2Z1FA 4I50A 1VQ6F 5HP8A 5JH7A 3CCMF 1Q8RA 4I55B 3CCSF 1YQNA 2LCAA 3FBAA 4O4IB 3CCLF 3J7AR 1QD9A 1SZQA 3V7EA 1W581 3RYCA 1JN1A 1VQPF 3HKDB 2QTPA 3CYPB 3HKBA 2HP0B 3S02A 1Z5VA 3B6NA 4TUYB 3ZP7A 3WGMA 2HVYD 2LBXA 3S0YA 2HS3A 3LWVC 3IEWA 3CPQA 4O4IA 5JVDB 1RQ2A 1XRGA 3LWQC 3LYBA 1ODEA 4LCKA 3C8LA 3F0FA 3JARB 2VAWA 3HKDA 5G4UC 1H48A 2OZBA 1IV3A 2HP0A 1IPAA 4TUYA 3LWRC 3NVIB 3FD6A 4C82A 5JVDA 3JVHA 1K73H 4M8IA 2Q1YA 3K0TA 5LOVA 4X20B 3M84A 3JARA 3BYQA 2OTMA 4X1IA 2IAFA 3E1YA 4DRXA 2EWCA 2R6R1 3IR9A 4I4TA 4BT2A 2CHSA 1NQ3A 3HKCB 3M1XA 4TZZA 3F0EA 1Q81H 3TD3A 2OTLF 3CC7F 4X20A 4BVSA 1PXWA 3CYQA 4O4LB 2PMPA 3RYIB 1VH8A 2I6RA 5EWRA 3PLAC 3JAKB 1OFUA 5DCVA 3C9TA 3NK7A 3HKCA 1U40A 3WGNA 3RYHB 3OBYA 3E20B 1X52A 4O4JB 5EZYA 3CCQF 1VQ8F 5EB0A 1VQ4F 2Z1UA 1NJIH 4O4LA 1K8AH 3CPWF 3RYIA 3WGJA 5BMVB 5IJ9B 3JAKA 1FFXB 2R751 4R40B 4ERHA 1H7MA 2CW4A 1QVGF 1FNJA 2ZF8A 2KGWA 2UYJA 3D54A 4U39A 1VQ7F 5BMVA 5IJ9A 4G88A 2RHJA 1YITF 1FFXA 1KQSF 3OONA 1YI2F 1YJWF 3N4YA 4YJ3B 3V4DA 4ZHVA 5HWEA 3F6MA 1X25A 5J2UB 5LA6B 3TD5A 4B46A 5GONA 2CHTA 1ZWZA 1IV4A 4NWOB 3WGKA 3CCEF 1VQMF 3CCRF 1E7KA 4X1KB 3WJQA 3EORA 2OHWA 4C4WC 3S03A 3G4SF 3S0HA 4G4VA 1XBIA 3CCVF 4BVQA 2G9IA 5LYJA 5J2UA 1ONIA 3NMUC 1W42A 2BO1A 2Z01A 4X1KA 3P10A 2GLZA 3I7TA 3VCZA 4G4WA 3RA5A 2HP3A 2P6YA 3RYCB 3GHZA 5HY2A 1SDSA 3RA6A 4FFBB 3HKBB 5FJ4C 3LMEA 4EI8A 3ELCA 3R0PA 2LBWA 3CB2A 1XHOA 3HWUA 4O2BB 4X1YB 5MN6A 4ZI7B 3N2KB 4KWEA 3L7QA 2IG8A 4FFBA 3K14A 3N4ZA 4IIJB 1JFFA 3MQWA 3VYTC 4B62A 3S06A 2CSLA 3O85A 3G6EF 2CVLA 3NK6A 1OAPA 4PWTA 5LOVB 4O2BA 2RHOA 4X1YA 3JALB 5IJ0B 3JAMM 2BTUA 2BTQB 4X1IB 4ZI7A 3N2KA 3WJPA 2VAMA 5EYPB 3I3FA 1PF5A 3IKFA 1X7OA 4DRXB 3FD5A 4EI7A 1FSZA 1KNJA 1RQ7A 4IIJA 3LWOC 3KE1A 4I4TB 5EO3A 2HS4A 1JD1A 5B8FA 3D01A 1UFYA 4X3LA 3CMAF 3VOAA 3JALA 5IJ0A 5CA1B 3I55F 1FNKA 5EYPA 4E6EA 2H8CA 4ZHQA 2ZOVA 3WGLA 4G4XA 2YXZA 1YIJF 1CLIA 1Z5WA 3C9RA 4ZK7A 2I6DA 5CA0B 2KG4A 3DDNA 4O2AB 5EZYB 1VHAA 5CA1A 4IHJB 5JQGA 1QAHA 1COMA 3PAFA 3JASB 2HX0A 3UT5B 1IV2A 5GAPK 2WALA 5LXTB 3HAXD 2KTVA 3ERNA 5CA0A 4O2AA 5KMGB 3IEQA 2UZHA 3U0OA 4DXDA 4BT3A 5KX5B 4IHJA 1W55A 4G4YA 3NVKE 3CG6A 4B45A 3JASA 3UT5A 3K2XA 3IKEA 1K9MH 5LXTA 3IMPA 3CC2F 2MQEA 5KMGA 4TV9B 2QEXF 5HY4A 5KX5A 5GONB 3T80A 1VQ9F 1SA0A 1W5EA 3JCMM 2YYEA 2DT4A 3MCQA 2VXYA 5G4VC 4ZOLB 4BT4A 2K1SA 1VK3A 4TV9A 3OBWA 2FC3A 5LYJB 1VQVA 2RHLA 2ZAUA 2IQQA 4ZOLA 1R1MA 2UYNA 3VI6A 3VYUC 4C8GA 2N48A 5EIBD 3VMFB 1W5AA 3KJKA 3SIVA 1GO1A 3GYQA 3C9SA 2Q1XA 2W8BC 1VQKF 5FNVB 5HXUA 1U3LA 1W40A 3J81M 5ITZB 1VQ5F 5CB4B 2L26A 3MBMA 3ZP4A 3HKEB 3Q8HA 1GX1A 3C9UA 1JFFB 1W3EX 3F0DA 5IYZB 3S0WA 1XV2A 2VAPA 3F0GA 5IT9M 1Q82H 3TD4A 5FNVA 1GO0A 5GIPC 4WBNB 2ZVYA 5ITZA 3KIZA
chains in the Genus database with same CATH topology
1DT9A 3E20B 3J80M 1X52A 1S72F 3CCQF 3I55F 1VQ8F 1VQ4F 2ALEA 2JNBA 3FFMA 1NJIH 1K8AH 1KC8H 3LFOA 3CPWF 1Q7YH 3D00A 4BVRA 3V7QA 4BY9D 1YIJF 3CCUF 1KD1H 2FGYA 2I6DA 1RLGA 2KG4A 3CC4F 1N8RH 1H7MA 5GINC 1VQOF 1JJ2F 1QVGF 2VGMA 1CK2A 3MCAB 1M1KH 3PAFA 1VQ7F 4BW0B 4X3MA 1YITF 4BVTA 3HJWC 1W41A 3CD6F 5GAPK 4XCQA 2WALA 1KQSF 2QI2A 3HAXD 2KTUA 1YI2F 1X7PA 2KTVA 1YJWF 3N4YA 5A2QM 1CN7A 5HWEA 1T0KB 4EI9A 5HY1A 2F9ZC 3NVKE 1ZWZA 3CG6A 5FLXM 5HXZA 1VQ6F 1GZ0A 3CCEF 5HY0A 3CCMF 1K9MH 1VQMF 3ON1A 3CCRF 1E7KA 3CCSF 1Q86H 3CMEF 3CCLF 3CC2F 3J7AR 2OHWA 4C4WC 5GANK 3V7EA 1RA4A 3G4SF 2QEXF 1YJNF 3OW2F 1XBIA 5HY4A 3CCVF 1VQNF 4BVQA 1VQPF 1VQ9F 3CXCF 3NMUC 2CZWA 1VQLF 3JCMM 1YJ9F 1W42A 2BO1A 2HVYD 2LBXA 5G4VC 3LWVC 2GLZA 3CPQA 3RA5A 2OTJF 3OBWA 2FC3A 3LWQC 5HY2A 2VGNA 1SDSA 4LCKA 3RA6A 5G4UC 3WXMB 2OZBA 5FJ4C 1IPAA 3CCJF 5GIOC 3LWRC 4EI8A 3NVIB 2LBWA 1K73H 3VI6A 3I56F 3G71F 3AGKA 3N4ZA 3VMFB 3E1YA 3SIVA 1GO1A 3GYQA 3V3TA 3IR9A 3SIUA 1M90H 1VQKF 1YHQF 4NQ3A 3O85A 4NUTA 5HXUA 3G6EF 3NK6A 1W40A 3J81M 1VQ5F 4TZZA 2AIFA 1Q81H 2QA4F 1QVFF 2OTLF 3CC7F 3JAMM 4BVSA 1PXWA 1W3EX 1X7OA 4EI7A 1W2BF 3LWOC 3PLAC 5EWRA 3LWPC 5EO3A 1Q82H 5IT9M 5DCVA 1GO0A 3NK7A 5GIPC 4X3LA 3CMAF 1NMUB 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT9 A;  3E20 B;  3J80 M;  1X52 A;  1S72 F;  3CCQ F;  3I55 F;  1VQ8 F;  1VQ4 F;  2ALE A;  2JNB A;  3FFM A;  1NJI H;  1K8A H;  1KC8 H;  3LFO A;  3CPW F;  1Q7Y H;  3V7Q A;  4BY9 D;  1YIJ F;  3CCU F;  1KD1 H;  2I6D A;  1RLG A;  2KG4 A;  3CC4 F;  1N8R H;  1H7M A;  5GIN C;  1VQO F;  1JJ2 F;  1QVG F;  2VGM A;  1CK2 A;  3MCA B;  1M1K H;  3PAF A;  1VQ7 F;  4BW0 B;  4X3M A;  1YIT F;  3HJW C;  1W41 A;  3CD6 F;  5GAP K;  2WAL A;  1KQS F;  2QI2 A;  3HAX D;  2KTU A;  1YI2 F;  1X7P A;  2KTV A;  1YJW F;  3N4Y A;  5A2Q M;  1CN7 A;  1T0K B;  3NVK E;  1ZWZ A;  3CG6 A;  5FLX M;  1VQ6 F;  1GZ0 A;  3CCE F;  3CCM F;  1K9M H;  1VQM F;  3ON1 A;  3CCR F;  1E7K A;  3CCS F;  1Q86 H;  3CME F;  3CCL F;  3CC2 F;  3J7A R;  2OHW A;  4C4W C;  5GAN K;  3V7E A;  1RA4 A;  3G4S F;  2QEX F;  1YJN F;  3OW2 F;  1XBI A;  3CCV F;  1VQN F;  1VQP F;  1VQ9 F;  3CXC F;  3NMU C;  2CZW A;  1VQL F;  3JCM M;  1YJ9 F;  1W42 A;  2BO1 A;  2HVY D;  2LBX A;  5G4V C;  3LWV C;  3CPQ A;  3RA5 A;  2OTJ F;  3OBW A;  2FC3 A;  3LWQ C;  4LCK A;  2VGN A;  1SDS A;  3RA6 A;  5G4U C;  3WXM B;  2OZB A;  5FJ4 C;  1IPA A;  3CCJ F;  5GIO C;  3LWR C;  3NVI B;  2LBW A;  1K73 H;  3VI6 A;  3I56 F;  3G71 F;  3AGK A;  3N4Z A;  3VMF B;  3E1Y A;  3SIV A;  1GO1 A;  3GYQ A;  3IR9 A;  3SIU A;  1M90 H;  1VQK F;  1YHQ F;  3O85 A;  4NUT A;  3G6E F;  3NK6 A;  1W40 A;  3J81 M;  1VQ5 F;  4TZZ A;  2AIF A;  1Q81 H;  2QA4 F;  1QVF F;  2OTL F;  3CC7 F;  3JAM M;  1PXW A;  1W3E X;  1X7O A;  1W2B F;  3LWO C;  3PLA C;  5EWR A;  3LWP C;  5EO3 A;  1Q82 H;  5IT9 M;  5DCV A;  1GO0 A;  3NK7 A;  5GIP C;  4X3L A;  3CMA F;  1NMU B;  3OBY A; 
#chains in the Genus database with same CATH topology
 5CB4 A;  1DT9 A;  4BT7 A;  3J80 M;  1W59 A;  2DYY A;  2JNB A;  3HKE A;  1KC8 H;  1DBF A;  5IYZ A;  3LFO A;  2HRU A;  4BVR A;  2NMU A;  3CCU F;  4O4H B;  1H47 A;  3WPX A;  1RLG A;  4WBN A;  3KJJ A;  3CC4 F;  1N8R H;  1JJ2 F;  1VQO F;  5J2T B;  2H8E A;  5LP6 A;  3VTI C;  4ZHQ B;  3MCA B;  5AVM A;  5MN5 A;  1M1K H;  1T0A A;  2ZVZ A;  1J7H A;  3N2G B;  3MDO A;  4X3M A;  5C8Y B;  3JAW B;  1W41 A;  4BT5 A;  4O4H A;  5EB1 B;  2QI2 A;  2HQS C;  2KTU A;  4I55 A;  1UI9 A;  3VYS C;  3ZO8 A;  5J2T A;  5JQG B;  1TUB B;  1CN7 A;  4HNA B;  3E22 B;  4RQO A;  5LP6 C;  5HY1 A;  1W57 A;  1U3P A;  2F9Z C;  2UYP A;  5FLX M;  3N2G A;  5C8Y A;  1GZ0 A;  3JAW A;  5HY0 A;  4C81 A;  3ON1 A;  2UYK A;  3QHD A;  1Q86 H;  3CME F;  2Z1T A;  2PHN A;  5GAN K;  1RLU A;  1RA4 A;  4B5C A;  1YJN F;  3HTN A;  1TUB A;  3OW2 F;  4HNA A;  3E22 A;  1VQN F;  1TVK B;  2BTO A;  3CXC F;  2CZW A;  1VQL F;  1YJ9 F;  2LBT A;  3ZOP A;  3P4E A;  2RHH A;  5EIB C;  1KNK A;  2B33 A;  2OTJ F;  3GTZ A;  4RHA A;  3VOB A;  1SA0 B;  1TVK A;  2VGN A;  3LDT A;  3WXM B;  2HRY A;  1IV1 A;  2GZL A;  2RB9 A;  2ZOD A;  3P0Z A;  4TV8 B;  3CCJ F;  5GIO C;  1U43 A;  2HS0 A;  3WJR A;  2V9Y A;  3I56 F;  3G71 F;  4ZHW A;  3AGK A;  3V3T A;  4TV8 A;  3SIU A;  3DC2 A;  1M90 H;  1YHQ F;  3QTY A;  4NQ3 A;  4NUT A;  2UYN B;  2AIF A;  1W5B A;  2QA4 F;  3RYH A;  4ZHY B;  1QVF F;  5EAZ A;  1W5F A;  4BT6 A;  4O4J A;  4F6R B;  1W2B F;  3VIU A;  3JAT B;  4EB6 B;  3LWP C;  3WPW A;  4C8E A;  3RE3 A;  1QU9 A;  3ESJ A;  1NMU B;  3RYF B;  1S72 F;  4LNU B;  3QUW A;  2ALE A;  3FFM A;  4F6R A;  1Q7Y H;  3D00 A;  3JAT A;  3V7Q A;  4EB6 A;  5MN4 A;  4BY9 D;  4YJ2 B;  2CWJ A;  3VO8 A;  1KD1 H;  2FGY A;  5JCO A;  4C8I A;  5HP7 A;  5GIN C;  4U3J B;  3RYF A;  1JY8 A;  2VGM A;  1CK2 A;  4LNU A;  3FPI A;  4YJ3 A;  3M4S A;  2Z1E A;  4BW0 B;  5LA6 A;  4I50 B;  4BVT A;  5JH7 B;  4YJ2 A;  3CD6 F;  3HJW C;  4XCQ A;  2GVI A;  2H6L A;  2AIZ P;  1X7P A;  2AMT A;  5JCO C;  5LP6 B;  5A2Q M;  4U3J A;  3K12 A;  1T0K B;  4EI9 A;  1YGY A;  3KHN A;  5HXZ A;  4G4Z A;  2Z1F A;  4I50 A;  1VQ6 F;  5HP8 A;  5JH7 A;  3CCM F;  1Q8R A;  4I55 B;  3CCS F;  1YQN A;  2LCA A;  3FBA A;  4O4I B;  3CCL F;  3J7A R;  1QD9 A;  1SZQ A;  3V7E A;  1W58 1;  3RYC A;  1JN1 A;  1VQP F;  3HKD B;  2QTP A;  3CYP B;  3HKB A;  2HP0 B;  3S02 A;  1Z5V A;  3B6N A;  4TUY B;  3ZP7 A;  3WGM A;  2HVY D;  2LBX A;  3S0Y A;  2HS3 A;  3LWV C;  3IEW A;  3CPQ A;  4O4I A;  5JVD B;  1RQ2 A;  1XRG A;  3LWQ C;  3LYB A;  1ODE A;  4LCK A;  3C8L A;  3F0F A;  3JAR B;  2VAW A;  3HKD A;  5G4U C;  1H48 A;  2OZB A;  1IV3 A;  2HP0 A;  1IPA A;  4TUY A;  3LWR C;  3NVI B;  3FD6 A;  4C82 A;  5JVD A;  3JVH A;  1K73 H;  4M8I A;  2Q1Y A;  3K0T A;  5LOV A;  4X20 B;  3M84 A;  3JAR A;  3BYQ A;  2OTM A;  4X1I A;  2IAF A;  3E1Y A;  4DRX A;  2EWC A;  2R6R 1;  3IR9 A;  4I4T A;  4BT2 A;  2CHS A;  1NQ3 A;  3HKC B;  3M1X A;  4TZZ A;  3F0E A;  1Q81 H;  3TD3 A;  2OTL F;  3CC7 F;  4X20 A;  4BVS A;  1PXW A;  3CYQ A;  4O4L B;  2PMP A;  3RYI B;  1VH8 A;  2I6R A;  5EWR A;  3PLA C;  3JAK B;  1OFU A;  5DCV A;  3C9T A;  3NK7 A;  3HKC A;  1U40 A;  3WGN A;  3RYH B;  3OBY A;  3E20 B;  1X52 A;  4O4J B;  5EZY A;  3CCQ F;  1VQ8 F;  5EB0 A;  1VQ4 F;  2Z1U A;  1NJI H;  4O4L A;  1K8A H;  3CPW F;  3RYI A;  3WGJ A;  5BMV B;  5IJ9 B;  3JAK A;  1FFX B;  2R75 1;  4R40 B;  4ERH A;  1H7M A;  2CW4 A;  1QVG F;  1FNJ A;  2ZF8 A;  2KGW A;  2UYJ A;  3D54 A;  4U39 A;  1VQ7 F;  5BMV A;  5IJ9 A;  4G88 A;  2RHJ A;  1YIT F;  1FFX A;  1KQS F;  3OON A;  1YI2 F;  1YJW F;  3N4Y A;  4YJ3 B;  3V4D A;  4ZHV A;  5HWE A;  3F6M A;  1X25 A;  5J2U B;  5LA6 B;  3TD5 A;  4B46 A;  5GON A;  2CHT A;  1ZWZ A;  1IV4 A;  4NWO B;  3WGK A;  3CCE F;  1VQM F;  3CCR F;  1E7K A;  4X1K B;  3WJQ A;  3EOR A;  2OHW A;  4C4W C;  3S03 A;  3G4S F;  3S0H A;  4G4V A;  1XBI A;  3CCV F;  4BVQ A;  2G9I A;  5LYJ A;  5J2U A;  1ONI A;  3NMU C;  1W42 A;  2BO1 A;  2Z01 A;  4X1K A;  3P10 A;  2GLZ A;  3I7T A;  3VCZ A;  4G4W A;  3RA5 A;  2HP3 A;  2P6Y A;  3RYC B;  3GHZ A;  5HY2 A;  1SDS A;  3RA6 A;  4FFB B;  3HKB B;  5FJ4 C;  3LME A;  4EI8 A;  3ELC A;  3R0P A;  2LBW A;  3CB2 A;  1XHO A;  3HWU A;  4O2B B;  4X1Y B;  5MN6 A;  4ZI7 B;  3N2K B;  4KWE A;  3L7Q A;  2IG8 A;  4FFB A;  3K14 A;  3N4Z A;  4IIJ B;  1JFF A;  3MQW A;  3VYT C;  4B62 A;  3S06 A;  2CSL A;  3O85 A;  3G6E F;  2CVL A;  3NK6 A;  1OAP A;  4PWT A;  5LOV B;  4O2B A;  2RHO A;  4X1Y A;  3JAL B;  5IJ0 B;  3JAM M;  2BTU A;  2BTQ B;  4X1I B;  4ZI7 A;  3N2K A;  3WJP A;  2VAM A;  5EYP B;  3I3F A;  1PF5 A;  3IKF A;  1X7O A;  4DRX B;  3FD5 A;  4EI7 A;  1FSZ A;  1KNJ A;  1RQ7 A;  4IIJ A;  3LWO C;  3KE1 A;  4I4T B;  5EO3 A;  2HS4 A;  1JD1 A;  5B8F A;  3D01 A;  1UFY A;  4X3L A;  3CMA F;  3VOA A;  3JAL A;  5IJ0 A;  5CA1 B;  3I55 F;  1FNK A;  5EYP A;  4E6E A;  2H8C A;  4ZHQ A;  2ZOV A;  3WGL A;  4G4X A;  2YXZ A;  1YIJ F;  1CLI A;  1Z5W A;  3C9R A;  4ZK7 A;  2I6D A;  5CA0 B;  2KG4 A;  3DDN A;  4O2A B;  5EZY B;  1VHA A;  5CA1 A;  4IHJ B;  5JQG A;  1QAH A;  1COM A;  3PAF A;  3JAS B;  2HX0 A;  3UT5 B;  1IV2 A;  5GAP K;  2WAL A;  5LXT B;  3HAX D;  2KTV A;  3ERN A;  5CA0 A;  4O2A A;  5KMG B;  3IEQ A;  2UZH A;  3U0O A;  4DXD A;  4BT3 A;  5KX5 B;  4IHJ A;  1W55 A;  4G4Y A;  3NVK E;  3CG6 A;  4B45 A;  3JAS A;  3UT5 A;  3K2X A;  3IKE A;  1K9M H;  5LXT A;  3IMP A;  3CC2 F;  2MQE A;  5KMG A;  4TV9 B;  2QEX F;  5HY4 A;  5KX5 A;  5GON B;  3T80 A;  1VQ9 F;  1SA0 A;  1W5E A;  3JCM M;  2YYE A;  2DT4 A;  3MCQ A;  2VXY A;  5G4V C;  4ZOL B;  4BT4 A;  2K1S A;  1VK3 A;  4TV9 A;  3OBW A;  2FC3 A;  5LYJ B;  1VQV A;  2RHL A;  2ZAU A;  2IQQ A;  4ZOL A;  1R1M A;  2UYN A;  3VI6 A;  3VYU C;  4C8G A;  2N48 A;  5EIB D;  3VMF B;  1W5A A;  3KJK A;  3SIV A;  1GO1 A;  3GYQ A;  3C9S A;  2Q1X A;  2W8B C;  1VQK F;  5FNV B;  5HXU A;  1U3L A;  1W40 A;  3J81 M;  5ITZ B;  1VQ5 F;  5CB4 B;  2L26 A;  3MBM A;  3ZP4 A;  3HKE B;  3Q8H A;  1GX1 A;  3C9U A;  1JFF B;  1W3E X;  3F0D A;  5IYZ B;  3S0W A;  1XV2 A;  2VAP A;  3F0G A;  5IT9 M;  1Q82 H;  3TD4 A;  5FNV A;  1GO0 A;  5GIP C;  4WBN B;  2ZVY A;  5ITZ A;  3KIZ A; 
#chains in the Genus database with same CATH homology
 1DT9 A;  3E20 B;  3J80 M;  1X52 A;  1S72 F;  3CCQ F;  3I55 F;  1VQ8 F;  1VQ4 F;  2ALE A;  2JNB A;  3FFM A;  1NJI H;  1K8A H;  1KC8 H;  3LFO A;  3CPW F;  1Q7Y H;  3D00 A;  4BVR A;  3V7Q A;  4BY9 D;  1YIJ F;  3CCU F;  1KD1 H;  2FGY A;  2I6D A;  1RLG A;  2KG4 A;  3CC4 F;  1N8R H;  1H7M A;  5GIN C;  1VQO F;  1JJ2 F;  1QVG F;  2VGM A;  1CK2 A;  3MCA B;  1M1K H;  3PAF A;  1VQ7 F;  4BW0 B;  4X3M A;  1YIT F;  4BVT A;  3HJW C;  1W41 A;  3CD6 F;  5GAP K;  4XCQ A;  2WAL A;  1KQS F;  2QI2 A;  3HAX D;  2KTU A;  1YI2 F;  1X7P A;  2KTV A;  1YJW F;  3N4Y A;  5A2Q M;  1CN7 A;  5HWE A;  1T0K B;  4EI9 A;  5HY1 A;  2F9Z C;  3NVK E;  1ZWZ A;  3CG6 A;  5FLX M;  5HXZ A;  1VQ6 F;  1GZ0 A;  3CCE F;  5HY0 A;  3CCM F;  1K9M H;  1VQM F;  3ON1 A;  3CCR F;  1E7K A;  3CCS F;  1Q86 H;  3CME F;  3CCL F;  3CC2 F;  3J7A R;  2OHW A;  4C4W C;  5GAN K;  3V7E A;  1RA4 A;  3G4S F;  2QEX F;  1YJN F;  3OW2 F;  1XBI A;  5HY4 A;  3CCV F;  1VQN F;  4BVQ A;  1VQP F;  1VQ9 F;  3CXC F;  3NMU C;  2CZW A;  1VQL F;  3JCM M;  1YJ9 F;  1W42 A;  2BO1 A;  2HVY D;  2LBX A;  5G4V C;  3LWV C;  2GLZ A;  3CPQ A;  3RA5 A;  2OTJ F;  3OBW A;  2FC3 A;  3LWQ C;  5HY2 A;  2VGN A;  1SDS A;  4LCK A;  3RA6 A;  5G4U C;  3WXM B;  2OZB A;  5FJ4 C;  1IPA A;  3CCJ F;  5GIO C;  3LWR C;  4EI8 A;  3NVI B;  2LBW A;  1K73 H;  3VI6 A;  3I56 F;  3G71 F;  3AGK A;  3N4Z A;  3VMF B;  3E1Y A;  3SIV A;  1GO1 A;  3GYQ A;  3V3T A;  3IR9 A;  3SIU A;  1M90 H;  1VQK F;  1YHQ F;  4NQ3 A;  3O85 A;  4NUT A;  5HXU A;  3G6E F;  3NK6 A;  1W40 A;  3J81 M;  1VQ5 F;  4TZZ A;  2AIF A;  1Q81 H;  2QA4 F;  1QVF F;  2OTL F;  3CC7 F;  3JAM M;  4BVS A;  1PXW A;  1W3E X;  1X7O A;  4EI7 A;  1W2B F;  3LWO C;  3PLA C;  5EWR A;  3LWP C;  5EO3 A;  1Q82 H;  5IT9 M;  5DCV A;  1GO0 A;  3NK7 A;  5GIP C;  4X3L A;  3CMA F;  1NMU B;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...