3SIVA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, dimeric form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
molecule keywords NHP2-like protein 1
total genus 41
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3sivA00
1X7OA 3RA6A 1VQMF 2OHWA 3AGKA 3V7QA 1IPAA 3CMAF 3CCVF 4C4WC 3CCRF 4BW0B 1X7PA 3LWPC 3LWVC 3CC4F 3GYQA 1GZ0A 3NVKE 4LCKA 1YIJF 1KD1H 1VQ5F 3G71F 2OZBA 3LFOA 3OBYA 1CK2A 3O85A 4TZZA 3LWOC 1VQ4F 2HVYD 5DCVA 2QA4F 1NJIH 3NK6A 1W40A 1M90H 1M1KH 3LWRC 1H7MA 1N8RH 2FC3A 3N4YA 3CXCF 3NVIB 1RA4A 1W41A 3OBWA 1CN7A 3CMEF 3J7AR 3HAXD 1E7KA 4X3LA 1QVFF 1Q81H 3N4ZA 1Q82H 3SIVA 5A2QM 3CC7F 2QEXF 5IT9M 1Q86H 1T0KB 3E20B 3CPQA 3V7EA 1VQLF 3I55F 1QVGF 2JNBA 3J80M 2QI2A 1YJ9F 3CC2F 1VQNF 1VQKF 5G4UC 3NK7A 3CG6A 5GANK 3WXMB 4NUTA 1K73H 2ALEA 1GO1A 1NMUB 1KC8H 3OW2F 1DT9A 1W3EX 1K8AH 1GO0A 1KQSF 3RA5A 1SDSA 3PLAC 1XBIA 1JJ2F 3CPWF 3G4SF 2I6DA 5EO3A 1VQ8F 3IR9A 1YJWF 1YJNF 5FLXM 1W2BF 2CZWA 5G4VC 1VQ9F 3VMFB 3NMUC 3CCMF 3CCLF 3LWQC 2WALA 2AIFA 5GIPC 3JAMM 1ZWZA 1VQ7F 2BO1A 2OTJF 3HJWC 5GIOC 1YITF 2KTVA 4X3MA 1YI2F 3VI6A 3CCSF 3CD6F 2KTUA 1RLGA 3JCMM 3I56F 1X52A 3CCEF 3CCUF 3PAFA 5FJ4C 3J81M 3CCQF 2VGMA 3FFMA 3E1YA 4BY9D 2LBXA 1W42A 2OTLF 1VQOF 1Q7YH 3G6EF 5GAPK 3SIUA 3ON1A 5GINC 1S72F 1PXWA 1YHQF 2LBWA 5EWRA 1VQPF 3MCAB 1K9MH 2KG4A 3CCJF 1VQ6F 2VGNA
chains in the Genus database with same CATH superfamily
5GONB 1X7OA 4O2AA 2HP0B 3CCVF 2VAPA 1IPAA 3QTYA 3V7QA 5BMVA 3CCRF 1OFUA 3VTIC 1GZ0A 1VQ5F 4DRXA 4ZHWA 3IKFA 4BT3A 3ZP4A 3O85A 5MN6A 2UYPA 4O2AB 1H48A 5CB4A 3NK6A 4O4JB 4ZI7B 1DBFA 1KNJA 3KIZA 3LWRC 1H7MA 1N8RH 2FC3A 3NVIB 1RA4A 5IYZA 3C9UA 5C8YA 1UFYA 4B5CA 1JN1A 3HAXD 1QVFF 5EIBC 5HY1A 3N2KA 1QAHA 2N48A 4EI7A 3CC7F 2FGYA 3IMPA 1CLIA 4E6EA 3CPQA 1VHAA 3V7EA 3I55F 1PF5A 2NMUA 5HWEA 3J80M 3N2GB 2H8CA 2QI2A 3RYFA 4O2BB 4NUTA 3IKEA 2HX0A 1K73H 2Z1EA 2GLZA 1KC8H 5EYPA 1DT9A 1JFFA 3LDTA 3VYUC 3PLAC 2H8EA 2DYYA 3HKDB 2RHLA 3G4SF 3VOBA 5EO3A 4BT2A 2RHJA 3JALA 3VYTC 1RLUA 2KGWA 3OONA 4LNUA 3B6NA 5G4VC 3RYFB 1VQ9F 2IQQA 4ZHQA 3NMUC 2HRYA 3LWQC 2I6RA 4X1YA 3JAMM 3VIUA 1VQ7F 5LOVB 4RHAA 3RYCA 3Q8HA 4C8GA 2Q1XA 1RLGA 2RHOA 1X52A 1W59A 3C9SA 5EZYB 3CCUF 3HKDA 5FJ4C 4WBNA 2UYKA 3DC2A 3JASA 4I55A 1W42A 5LYJA 5EIBD 1Q7YH 5GAPK 1Z5WA 4G4XA 3ZOPA 1U40A 3VOAA 4B45A 4TV9A 2VGNA 2HS0A 2UZHA 1COMA 1FSZA 4KWEA 4I55B 5LYJB 5IJ0B 1VQMF 3CMAF 1X7PA 3UT5A 4YJ2B 3GYQA 3MDOA 1H47A 1YIJF 5LXTA 1KD1H 5HP7A 3G71F 1FNJA 2OZBA 3LFOA 5IJ9B 3V4DA 5J2UA 2Q1YA 3M4SA 3TD4A 5ITZA 4G4VA 1VQ4F 5DCVA 2HQSC 1ONIA 1M1KH 5KX5A 3CXCF 3WGKA 1W41A 3OBWA 3WPXA 3F0FA 1CN7A 4X3LA 3K14A 3V3TA 3UT5B 5C8YB 5ITZB 3SIVA 3BYQA 2LBTA 1U3PA 1GX1A 1T0KB 5J2UB 5IJ9A 1U43A 2LCAA 2H6LA 5JVDA 4BT5A 5HY2A 3S03A 1XV2A 2HS3A 3CC2F 5EB0A 1VQKF 2K1SA 1W5AA 3NK7A 3K12A 1QU9A 2HP3A 4IIJB 2ALEA 3C8LA 3HKEA 3M1XA 2CWJA 4XCQA 5LP6C 3RYCB 2Z1UA 2RHHA 5LA6B 3U0OA 1XBIA 1JJ2F 3VO8A 3CPWF 2L26A 1TUBB 5JH7A 1YJNF 5FLXM 3FD6A 4F6RB 2HS4A 5CA0A 5LP6A 2HP0A 1FFXA 5BMVB 3ZO8A 4LNUB 1ZWZA 2R751 2BO1A 3HKEB 1YITF 5JCOC 4I50A 4EB6A 4EI8A 4X3MA 3CCSF 1SA0A 3CD6F 3JCMM 3HTNA 5HP8A 3VCZA 1X25A 3E1YA 3K2XA 4BY9D 5EZYA 2OTLF 3JAWB 3LYBA 3QUWA 3G6EF 2Z01A 3ON1A 4X1KA 5GINC 1W5BA 4F6RA 1Z5VA 4X1IB 1YHQF 5EWRA 5IYZB 4BT7A 2KG4A 2IG8A 3HKCA 1VQ6F 4U3JA 4IHJB 4I50B 4EB6B 1RQ7A 4O4LA 2PHNA 4ZHYB 3AGKA 2UYNA 3F6MA 4BT6A 5EAZA 4BW0B 1W5FA 3LWPC 5IJ0A 2ZVYA 3IEQA 5J2TB 3N2GA 2R6R1 3JAKA 3NVKE 3RYIB 1KNKA 1FNKA 3OBYA 3I3FA 3F0EA 5JVDB 4TZZA 4ZK7A 2OTMA 2QA4F 1NJIH 3WJRA 4O4IA 2CHSA 3JARB 3N4YA 3C9RA 4IIJA 3D00A 3J7AR 4R40B 4G88A 1YQNA 1Q81H 4BVRA 3ELCA 3HKBA 5A2QM 5HXZA 3M84A 4YJ3A 3KE1A 4X20A 4C8EA 2QEXF 5IT9M 1Q86H 1IV1A 1VQLF 4X1YB 3RYHB 1U3LA 2DT4A 2ZF8A 3D01A 2YXZA 4O4IB 5G4UC 2CVLA 2P6YA 5CA1B 2AMTA 4C8IA 4ZHVA 3OW2F 4O2BA 1W3EX 4BT4A 1GO0A 3GHZA 4BVQA 2Z1TA 2V9YA 2GVIA 2IAFA 5EYPB 2F9ZC 3RA5A 1SDSA 2ZOVA 4X20B 3WJQA 4X1IA 1W57A 3K0TA 1JFFB 2VAMA 3JALB 5B8FA 5LA6A 3N2KB 4TV9B 5CA1A 1VQ8F 3IR9A 1TVKB 3S02A 4FFBB 2RB9A 1NQ3A 4IHJA 3S0HA 3EORA 3HWUA 1YJWF 1W2BF 4B46A 3FPIA 3KHNA 3RE3A 5HY0A 3CCLF 2WALA 3CYPB 1J7HA 2BTQB 2OTJF 2Z1FA 4ZHQB 3HJWC 3WPWA 4C81A 2EWCA 5GIOC 3P10A 3JATA 3VI6A 5JQGB 5LXTB 1XRGA 2KTUA 5MN4A 2UYNB 5LOVA 3WGMA 4BVTA 4C82A 2HRUA 1VH8A 3J81M 3CCQF 4G4YA 2VGMA 2CSLA 5J2TA 1SZQA 4I4TB 1VK3A 3TD3A 3RYIA 4HNAB 3JASB 3JARA 1IV3A 3JVHA 2LBWA 1VQPF 1VQVA 3MCAB 3ESJA 4ZOLB 2PMPA 4U39A 4NQ3A 4I4TA 2G9IA 1YGYA 3RA6A 2OHWA 4X1KB 4TV8A 3S0YA 4C4WC 3T80A 5CB4B 3GTZA 2BTOA 3DDNA 2ZODA 4O4LB 3F0GA 3LWVC 3CC4F 4RQOA 1W5EA 4LCKA 4O4HA 5EB1B 4YJ2A 4TUYA 2GZLA 3KJKA 4EI9A 3JAKB 1IV4A 1CK2A 5HXUA 3RYHA 5KMGA 2ZVZA 3P0ZA 3LWOC 2HVYD 1IV2A 3C9TA 3ZP7A 1W40A 4ZOLA 1M90H 3CB2A 2B33A 4TUYB 1OAPA 5KX5B 3CMEF 1E7KA 5JCOA 3R0PA 1TUBA 3N4ZA 2VXYA 5JH7B 1Q82H 3F0DA 3WGNA 4DRXB 3E20B 3HKBB 2VAWA 4G4ZA 4YJ3B 5FNVA 2W8BC 1QVGF 2JNBA 4FFBA 4DXDA 1YJ9F 1Q8RA 1VQNF 3MCQA 3JATB 5JQGA 5GANK 3CG6A 4BVSA 3WXMB 3E22A 3L7QA 1W581 1T0AA 1UI9A 1XHOA 1GO1A 1JY8A 1NMUB 3VYSC 4PWTA 5AVMA 4O4JA 2BTUA 4ZI7A 5FNVB 1K8AH 3JAWA 1KQSF 2UYJA 2ZAUA 4B62A 3E22B 3S0WA 2I6DA 3HKCB 1JD1A 1RQ2A 4U3JB 4M8IA 3ERNA 3WJPA 3WGLA 2CZWA 2YYEA 1TVKA 3VMFB 3CCMF 2MQEA 5GIPC 2AIFA 1QD9A 3TD5A 3MQWA 4G4WA 5CA0B 5LP6B 2AIZP 1FFXB 2KTVA 3WGJA 5HY4A 1YI2F 4WBNB 4TV8B 3I56F 3CYQA 3CCEF 3FBAA 3MBMA 3PAFA 1SA0B 3FD5A 3KJJA 3FFMA 3QHDA 2CW4A 2QTPA 5GONA 2LBXA 4O4HB 1ODEA 4NWOB 2CHTA 1VQOF 3SIUA 4ERHA 1R1MA 1S72F 1PXWA 3D54A 3P4EA 4HNAA 5KMGB 1K9MH 3CCJF 5MN5A 3IEWA 1W55A 3I7TA 3S06A 3LMEA
chains in the Genus database with same CATH topology
4NQ3A 1X7OA 3RA6A 1VQMF 2OHWA 3AGKA 3V7QA 1IPAA 3CMAF 3CCVF 4C4WC 3CCRF 4BW0B 1X7PA 3LWPC 3LWVC 3CC4F 3GYQA 1GZ0A 3NVKE 4LCKA 1YIJF 1KD1H 1VQ5F 3G71F 2OZBA 3LFOA 4EI9A 3OBYA 1CK2A 3O85A 5HXUA 4TZZA 3LWOC 1VQ4F 2HVYD 5DCVA 2QA4F 1NJIH 3NK6A 1W40A 1M90H 1M1KH 3LWRC 1H7MA 1N8RH 2FC3A 3N4YA 3CXCF 3NVIB 1RA4A 1W41A 3D00A 3OBWA 3CMEF 3J7AR 3HAXD 1E7KA 4X3LA 1CN7A 1QVFF 5HY1A 3V3TA 1Q81H 4BVRA 3N4ZA 1Q82H 3SIVA 4EI7A 5A2QM 5HXZA 3CC7F 2FGYA 2QEXF 5IT9M 1Q86H 1T0KB 3E20B 3CPQA 3V7EA 1VQLF 3I55F 5HWEA 1QVGF 2JNBA 5HY2A 3J80M 2QI2A 1YJ9F 3CC2F 1VQNF 1VQKF 5G4UC 3NK7A 3CG6A 4BVSA 5GANK 3WXMB 4NUTA 1K73H 2ALEA 1GO1A 1NMUB 2GLZA 3OW2F 1KC8H 1DT9A 1W3EX 4XCQA 1K8AH 1GO0A 4BVQA 1KQSF 3RA5A 1SDSA 2F9ZC 3PLAC 1XBIA 1JJ2F 3CPWF 3G4SF 2I6DA 5EO3A 1VQ8F 3IR9A 1YJWF 1YJNF 5FLXM 1W2BF 2CZWA 5G4VC 1VQ9F 3VMFB 3NMUC 3CCMF 5HY0A 3CCLF 2WALA 2AIFA 5GIPC 3JAMM 3LWQC 1ZWZA 1VQ7F 2BO1A 2OTJF 3HJWC 5GIOC 1YITF 2KTVA 5HY4A 4EI8A 4X3MA 1YI2F 3VI6A 3CCSF 3CD6F 2KTUA 1RLGA 3JCMM 3I56F 4BVTA 1X52A 3CCEF 3CCUF 3PAFA 5FJ4C 3J81M 3CCQF 2VGMA 3FFMA 3E1YA 4BY9D 2LBXA 1W42A 2OTLF 1VQOF 1Q7YH 3G6EF 5GAPK 3SIUA 3ON1A 5GINC 1S72F 1PXWA 1YHQF 2LBWA 5EWRA 1VQPF 3MCAB 1K9MH 2KG4A 3CCJF 1VQ6F 2VGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  3RA6 A;  1VQM F;  2OHW A;  3AGK A;  3V7Q A;  1IPA A;  3CMA F;  3CCV F;  4C4W C;  3CCR F;  4BW0 B;  1X7P A;  3LWP C;  3LWV C;  3CC4 F;  3GYQ A;  1GZ0 A;  3NVK E;  4LCK A;  1YIJ F;  1KD1 H;  1VQ5 F;  3G71 F;  2OZB A;  3LFO A;  3OBY A;  1CK2 A;  3O85 A;  4TZZ A;  3LWO C;  1VQ4 F;  2HVY D;  5DCV A;  2QA4 F;  1NJI H;  3NK6 A;  1W40 A;  1M90 H;  1M1K H;  3LWR C;  1H7M A;  1N8R H;  2FC3 A;  3N4Y A;  3CXC F;  3NVI B;  1RA4 A;  1W41 A;  3OBW A;  1CN7 A;  3CME F;  3J7A R;  3HAX D;  1E7K A;  4X3L A;  1QVF F;  1Q81 H;  3N4Z A;  1Q82 H;  3SIV A;  5A2Q M;  3CC7 F;  2QEX F;  5IT9 M;  1Q86 H;  1T0K B;  3E20 B;  3CPQ A;  3V7E A;  1VQL F;  3I55 F;  1QVG F;  2JNB A;  3J80 M;  2QI2 A;  1YJ9 F;  3CC2 F;  1VQN F;  1VQK F;  5G4U C;  3NK7 A;  3CG6 A;  5GAN K;  3WXM B;  4NUT A;  1K73 H;  2ALE A;  1GO1 A;  1NMU B;  1KC8 H;  3OW2 F;  1DT9 A;  1W3E X;  1K8A H;  1GO0 A;  1KQS F;  3RA5 A;  1SDS A;  3PLA C;  1XBI A;  1JJ2 F;  3CPW F;  3G4S F;  2I6D A;  5EO3 A;  1VQ8 F;  3IR9 A;  1YJW F;  1YJN F;  5FLX M;  1W2B F;  2CZW A;  5G4V C;  1VQ9 F;  3VMF B;  3NMU C;  3CCM F;  3CCL F;  3LWQ C;  2WAL A;  2AIF A;  5GIP C;  3JAM M;  1ZWZ A;  1VQ7 F;  2BO1 A;  2OTJ F;  3HJW C;  5GIO C;  1YIT F;  2KTV A;  4X3M A;  1YI2 F;  3VI6 A;  3CCS F;  3CD6 F;  2KTU A;  1RLG A;  3JCM M;  3I56 F;  1X52 A;  3CCE F;  3CCU F;  3PAF A;  5FJ4 C;  3J81 M;  3CCQ F;  2VGM A;  3FFM A;  3E1Y A;  4BY9 D;  2LBX A;  1W42 A;  2OTL F;  1VQO F;  1Q7Y H;  3G6E F;  5GAP K;  3SIU A;  3ON1 A;  5GIN C;  1S72 F;  1PXW A;  1YHQ F;  2LBW A;  5EWR A;  1VQP F;  3MCA B;  1K9M H;  2KG4 A;  3CCJ F;  1VQ6 F;  2VGN A; 
#chains in the Genus database with same CATH topology
 5GON B;  1X7O A;  4O2A A;  2HP0 B;  3CCV F;  2VAP A;  1IPA A;  3QTY A;  3V7Q A;  5BMV A;  3CCR F;  1OFU A;  3VTI C;  1GZ0 A;  1VQ5 F;  4DRX A;  4ZHW A;  3IKF A;  4BT3 A;  3ZP4 A;  3O85 A;  5MN6 A;  2UYP A;  4O2A B;  1H48 A;  5CB4 A;  3NK6 A;  4O4J B;  4ZI7 B;  1DBF A;  1KNJ A;  3KIZ A;  3LWR C;  1H7M A;  1N8R H;  2FC3 A;  3NVI B;  1RA4 A;  5IYZ A;  3C9U A;  5C8Y A;  1UFY A;  4B5C A;  1JN1 A;  3HAX D;  1QVF F;  5EIB C;  5HY1 A;  3N2K A;  1QAH A;  2N48 A;  4EI7 A;  3CC7 F;  2FGY A;  3IMP A;  1CLI A;  4E6E A;  3CPQ A;  1VHA A;  3V7E A;  3I55 F;  1PF5 A;  2NMU A;  5HWE A;  3J80 M;  3N2G B;  2H8C A;  2QI2 A;  3RYF A;  4O2B B;  4NUT A;  3IKE A;  2HX0 A;  1K73 H;  2Z1E A;  2GLZ A;  1KC8 H;  5EYP A;  1DT9 A;  1JFF A;  3LDT A;  3VYU C;  3PLA C;  2H8E A;  2DYY A;  3HKD B;  2RHL A;  3G4S F;  3VOB A;  5EO3 A;  4BT2 A;  2RHJ A;  3JAL A;  3VYT C;  1RLU A;  2KGW A;  3OON A;  4LNU A;  3B6N A;  5G4V C;  3RYF B;  1VQ9 F;  2IQQ A;  4ZHQ A;  3NMU C;  2HRY A;  3LWQ C;  2I6R A;  4X1Y A;  3JAM M;  3VIU A;  1VQ7 F;  5LOV B;  4RHA A;  3RYC A;  3Q8H A;  4C8G A;  2Q1X A;  1RLG A;  2RHO A;  1X52 A;  1W59 A;  3C9S A;  5EZY B;  3CCU F;  3HKD A;  5FJ4 C;  4WBN A;  2UYK A;  3DC2 A;  3JAS A;  4I55 A;  1W42 A;  5LYJ A;  5EIB D;  1Q7Y H;  5GAP K;  1Z5W A;  4G4X A;  3ZOP A;  1U40 A;  3VOA A;  4B45 A;  4TV9 A;  2VGN A;  2HS0 A;  2UZH A;  1COM A;  1FSZ A;  4KWE A;  4I55 B;  5LYJ B;  5IJ0 B;  1VQM F;  3CMA F;  1X7P A;  3UT5 A;  4YJ2 B;  3GYQ A;  3MDO A;  1H47 A;  1YIJ F;  5LXT A;  1KD1 H;  5HP7 A;  3G71 F;  1FNJ A;  2OZB A;  3LFO A;  5IJ9 B;  3V4D A;  5J2U A;  2Q1Y A;  3M4S A;  3TD4 A;  5ITZ A;  4G4V A;  1VQ4 F;  5DCV A;  2HQS C;  1ONI A;  1M1K H;  5KX5 A;  3CXC F;  3WGK A;  1W41 A;  3OBW A;  3WPX A;  3F0F A;  1CN7 A;  4X3L A;  3K14 A;  3V3T A;  3UT5 B;  5C8Y B;  5ITZ B;  3SIV A;  3BYQ A;  2LBT A;  1U3P A;  1GX1 A;  1T0K B;  5J2U B;  5IJ9 A;  1U43 A;  2LCA A;  2H6L A;  5JVD A;  4BT5 A;  5HY2 A;  3S03 A;  1XV2 A;  2HS3 A;  3CC2 F;  5EB0 A;  1VQK F;  2K1S A;  1W5A A;  3NK7 A;  3K12 A;  1QU9 A;  2HP3 A;  4IIJ B;  2ALE A;  3C8L A;  3HKE A;  3M1X A;  2CWJ A;  4XCQ A;  5LP6 C;  3RYC B;  2Z1U A;  2RHH A;  5LA6 B;  3U0O A;  1XBI A;  1JJ2 F;  3VO8 A;  3CPW F;  2L26 A;  1TUB B;  5JH7 A;  1YJN F;  5FLX M;  3FD6 A;  4F6R B;  2HS4 A;  5CA0 A;  5LP6 A;  2HP0 A;  1FFX A;  5BMV B;  3ZO8 A;  4LNU B;  1ZWZ A;  2R75 1;  2BO1 A;  3HKE B;  1YIT F;  5JCO C;  4I50 A;  4EB6 A;  4EI8 A;  4X3M A;  3CCS F;  1SA0 A;  3CD6 F;  3JCM M;  3HTN A;  5HP8 A;  3VCZ A;  1X25 A;  3E1Y A;  3K2X A;  4BY9 D;  5EZY A;  2OTL F;  3JAW B;  3LYB A;  3QUW A;  3G6E F;  2Z01 A;  3ON1 A;  4X1K A;  5GIN C;  1W5B A;  4F6R A;  1Z5V A;  4X1I B;  1YHQ F;  5EWR A;  5IYZ B;  4BT7 A;  2KG4 A;  2IG8 A;  3HKC A;  1VQ6 F;  4U3J A;  4IHJ B;  4I50 B;  4EB6 B;  1RQ7 A;  4O4L A;  2PHN A;  4ZHY B;  3AGK A;  2UYN A;  3F6M A;  4BT6 A;  5EAZ A;  4BW0 B;  1W5F A;  3LWP C;  5IJ0 A;  2ZVY A;  3IEQ A;  5J2T B;  3N2G A;  2R6R 1;  3JAK A;  3NVK E;  3RYI B;  1KNK A;  1FNK A;  3OBY A;  3I3F A;  3F0E A;  5JVD B;  4TZZ A;  4ZK7 A;  2OTM A;  2QA4 F;  1NJI H;  3WJR A;  4O4I A;  2CHS A;  3JAR B;  3N4Y A;  3C9R A;  4IIJ A;  3D00 A;  3J7A R;  4R40 B;  4G88 A;  1YQN A;  1Q81 H;  4BVR A;  3ELC A;  3HKB A;  5A2Q M;  5HXZ A;  3M84 A;  4YJ3 A;  3KE1 A;  4X20 A;  4C8E A;  2QEX F;  5IT9 M;  1Q86 H;  1IV1 A;  1VQL F;  4X1Y B;  3RYH B;  1U3L A;  2DT4 A;  2ZF8 A;  3D01 A;  2YXZ A;  4O4I B;  5G4U C;  2CVL A;  2P6Y A;  5CA1 B;  2AMT A;  4C8I A;  4ZHV A;  3OW2 F;  4O2B A;  1W3E X;  4BT4 A;  1GO0 A;  3GHZ A;  4BVQ A;  2Z1T A;  2V9Y A;  2GVI A;  2IAF A;  5EYP B;  2F9Z C;  3RA5 A;  1SDS A;  2ZOV A;  4X20 B;  3WJQ A;  4X1I A;  1W57 A;  3K0T A;  1JFF B;  2VAM A;  3JAL B;  5B8F A;  5LA6 A;  3N2K B;  4TV9 B;  5CA1 A;  1VQ8 F;  3IR9 A;  1TVK B;  3S02 A;  4FFB B;  2RB9 A;  1NQ3 A;  4IHJ A;  3S0H A;  3EOR A;  3HWU A;  1YJW F;  1W2B F;  4B46 A;  3FPI A;  3KHN A;  3RE3 A;  5HY0 A;  3CCL F;  2WAL A;  3CYP B;  1J7H A;  2BTQ B;  2OTJ F;  2Z1F A;  4ZHQ B;  3HJW C;  3WPW A;  4C81 A;  2EWC A;  5GIO C;  3P10 A;  3JAT A;  3VI6 A;  5JQG B;  5LXT B;  1XRG A;  2KTU A;  5MN4 A;  2UYN B;  5LOV A;  3WGM A;  4BVT A;  4C82 A;  2HRU A;  1VH8 A;  3J81 M;  3CCQ F;  4G4Y A;  2VGM A;  2CSL A;  5J2T A;  1SZQ A;  4I4T B;  1VK3 A;  3TD3 A;  3RYI A;  4HNA B;  3JAS B;  3JAR A;  1IV3 A;  3JVH A;  2LBW A;  1VQP F;  1VQV A;  3MCA B;  3ESJ A;  4ZOL B;  2PMP A;  4U39 A;  4NQ3 A;  4I4T A;  2G9I A;  1YGY A;  3RA6 A;  2OHW A;  4X1K B;  4TV8 A;  3S0Y A;  4C4W C;  3T80 A;  5CB4 B;  3GTZ A;  2BTO A;  3DDN A;  2ZOD A;  4O4L B;  3F0G A;  3LWV C;  3CC4 F;  4RQO A;  1W5E A;  4LCK A;  4O4H A;  5EB1 B;  4YJ2 A;  4TUY A;  2GZL A;  3KJK A;  4EI9 A;  3JAK B;  1IV4 A;  1CK2 A;  5HXU A;  3RYH A;  5KMG A;  2ZVZ A;  3P0Z A;  3LWO C;  2HVY D;  1IV2 A;  3C9T A;  3ZP7 A;  1W40 A;  4ZOL A;  1M90 H;  3CB2 A;  2B33 A;  4TUY B;  1OAP A;  5KX5 B;  3CME F;  1E7K A;  5JCO A;  3R0P A;  1TUB A;  3N4Z A;  2VXY A;  5JH7 B;  1Q82 H;  3F0D A;  3WGN A;  4DRX B;  3E20 B;  3HKB B;  2VAW A;  4G4Z A;  4YJ3 B;  5FNV A;  2W8B C;  1QVG F;  2JNB A;  4FFB A;  4DXD A;  1YJ9 F;  1Q8R A;  1VQN F;  3MCQ A;  3JAT B;  5JQG A;  5GAN K;  3CG6 A;  4BVS A;  3WXM B;  3E22 A;  3L7Q A;  1W58 1;  1T0A A;  1UI9 A;  1XHO A;  1GO1 A;  1JY8 A;  1NMU B;  3VYS C;  4PWT A;  5AVM A;  4O4J A;  2BTU A;  4ZI7 A;  5FNV B;  1K8A H;  3JAW A;  1KQS F;  2UYJ A;  2ZAU A;  4B62 A;  3E22 B;  3S0W A;  2I6D A;  3HKC B;  1JD1 A;  1RQ2 A;  4U3J B;  4M8I A;  3ERN A;  3WJP A;  3WGL A;  2CZW A;  2YYE A;  1TVK A;  3VMF B;  3CCM F;  2MQE A;  5GIP C;  2AIF A;  1QD9 A;  3TD5 A;  3MQW A;  4G4W A;  5CA0 B;  5LP6 B;  2AIZ P;  1FFX B;  2KTV A;  3WGJ A;  5HY4 A;  1YI2 F;  4WBN B;  4TV8 B;  3I56 F;  3CYQ A;  3CCE F;  3FBA A;  3MBM A;  3PAF A;  1SA0 B;  3FD5 A;  3KJJ A;  3FFM A;  3QHD A;  2CW4 A;  2QTP A;  5GON A;  2LBX A;  4O4H B;  1ODE A;  4NWO B;  2CHT A;  1VQO F;  3SIU A;  4ERH A;  1R1M A;  1S72 F;  1PXW A;  3D54 A;  3P4E A;  4HNA A;  5KMG B;  1K9M H;  3CCJ F;  5MN5 A;  3IEW A;  1W55 A;  3I7T A;  3S06 A;  3LME A; 
#chains in the Genus database with same CATH homology
 4NQ3 A;  1X7O A;  3RA6 A;  1VQM F;  2OHW A;  3AGK A;  3V7Q A;  1IPA A;  3CMA F;  3CCV F;  4C4W C;  3CCR F;  4BW0 B;  1X7P A;  3LWP C;  3LWV C;  3CC4 F;  3GYQ A;  1GZ0 A;  3NVK E;  4LCK A;  1YIJ F;  1KD1 H;  1VQ5 F;  3G71 F;  2OZB A;  3LFO A;  4EI9 A;  3OBY A;  1CK2 A;  3O85 A;  5HXU A;  4TZZ A;  3LWO C;  1VQ4 F;  2HVY D;  5DCV A;  2QA4 F;  1NJI H;  3NK6 A;  1W40 A;  1M90 H;  1M1K H;  3LWR C;  1H7M A;  1N8R H;  2FC3 A;  3N4Y A;  3CXC F;  3NVI B;  1RA4 A;  1W41 A;  3D00 A;  3OBW A;  3CME F;  3J7A R;  3HAX D;  1E7K A;  4X3L A;  1CN7 A;  1QVF F;  5HY1 A;  3V3T A;  1Q81 H;  4BVR A;  3N4Z A;  1Q82 H;  3SIV A;  4EI7 A;  5A2Q M;  5HXZ A;  3CC7 F;  2FGY A;  2QEX F;  5IT9 M;  1Q86 H;  1T0K B;  3E20 B;  3CPQ A;  3V7E A;  1VQL F;  3I55 F;  5HWE A;  1QVG F;  2JNB A;  5HY2 A;  3J80 M;  2QI2 A;  1YJ9 F;  3CC2 F;  1VQN F;  1VQK F;  5G4U C;  3NK7 A;  3CG6 A;  4BVS A;  5GAN K;  3WXM B;  4NUT A;  1K73 H;  2ALE A;  1GO1 A;  1NMU B;  2GLZ A;  3OW2 F;  1KC8 H;  1DT9 A;  1W3E X;  4XCQ A;  1K8A H;  1GO0 A;  4BVQ A;  1KQS F;  3RA5 A;  1SDS A;  2F9Z C;  3PLA C;  1XBI A;  1JJ2 F;  3CPW F;  3G4S F;  2I6D A;  5EO3 A;  1VQ8 F;  3IR9 A;  1YJW F;  1YJN F;  5FLX M;  1W2B F;  2CZW A;  5G4V C;  1VQ9 F;  3VMF B;  3NMU C;  3CCM F;  5HY0 A;  3CCL F;  2WAL A;  2AIF A;  5GIP C;  3JAM M;  3LWQ C;  1ZWZ A;  1VQ7 F;  2BO1 A;  2OTJ F;  3HJW C;  5GIO C;  1YIT F;  2KTV A;  5HY4 A;  4EI8 A;  4X3M A;  1YI2 F;  3VI6 A;  3CCS F;  3CD6 F;  2KTU A;  1RLG A;  3JCM M;  3I56 F;  4BVT A;  1X52 A;  3CCE F;  3CCU F;  3PAF A;  5FJ4 C;  3J81 M;  3CCQ F;  2VGM A;  3FFM A;  3E1Y A;  4BY9 D;  2LBX A;  1W42 A;  2OTL F;  1VQO F;  1Q7Y H;  3G6E F;  5GAP K;  3SIU A;  3ON1 A;  5GIN C;  1S72 F;  1PXW A;  1YHQ F;  2LBW A;  5EWR A;  1VQP F;  3MCA B;  1K9M H;  2KG4 A;  3CCJ F;  1VQ6 F;  2VGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...