3SIVA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, dimeric form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing/rna
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3sivA00
1GO1A 2VGMA 3SIVA 3G4SF 1NJIH 3VI6A 1VQ8F 1VQOF 3N4ZA 1QVFF 4NUTA 1YITF 2VGNA 1KC8H 2HVYD 2AIFA 2QI2A 3HJWC 1YJNF 2I6DA 3NK6A 3J81M 3NVIB 3CD6F 3CG6A 1M1KH 3OW2F 5DCVA 2OHWA 1K8AH 1H7MA 3CCJF 3CCQF 1W41A 5FJ4C 1M90H 3CCRF 1KD1H 3LWVC 3RA6A 1CN7A 2CZWA 1VQKF 1NMUB 3CXCF 2QEXF 2WALA 3ON1A 1X7OA 3CCMF 5G4VC 3CCEF 1W40A 1RA4A 3CMEF 3JCMM 3V7EA 3NVKE 3J80M 3G71F 5GAPK 5GANK 1GZ0A 1PXWA 2ALEA 1VQ7F 4BY9D 4LCKA 3J7AR 1K73H 3OBWA 1ZWZA 5GIPC 3RA5A 5GINC 3IR9A 1Q86H 5G4UC 3E20B 2KTUA 4TZZA 2JNBA 1YI2F 4C4WC 1DT9A 3LFOA 1XBIA 3GYQA 4BW0B 1X52A 1JJ2F 3CMAF 3V7QA 3CC7F 3CCSF 3NMUC 3HAXD 2KG4A 1N8RH 3I55F 2LBXA 3N4YA 2LBWA 1Q82H 3E1YA 3OBYA 3LWOC 3CCVF 3LWPC 1YJ9F 3LWQC 3CCLF 1GO0A 1VQ4F 3G6EF 2OZBA 3SIUA 1VQLF 3JAMM 2BO1A 1VQ9F 3AGKA 5IT9M 3I56F 1W3EX 5GIOC 3CC4F 3VMFB 3O85A 1E7KA 3FFMA 1VQMF 1YHQF 2OTLF 1RLGA 3CPWF 1YJWF 4X3LA 3WXMB 1T0KB 2KTVA 4X3MA 3LWRC 3NK7A 3CCUF 3MCAB 1SDSA 2FC3A 1VQPF 1VQ5F 5FLXM 3PLAC 1S72F 5A2QM 3PAFA 2OTJF 1W42A 5EWRA 3CC2F 1YIJF 1W2BF 1VQNF 5EO3A 1IPAA 1CK2A 1X7PA 1QVGF 2QA4F 1Q81H 1VQ6F 1KQSF 3CPQA 1Q7YH 1K9MH
chains in the Genus database with same CATH superfamily
1W5BA 2R751 4O4LA 5CA0A 3R0PA 3G4SF 1NJIH 3RYIB 2CW4A 2Q1XA 4G4WA 5C8YA 2HVYD 3U0OA 2AIFA 3B6NA 2V9YA 4O2AB 3J81M 3MDOA 4C8IA 3CD6F 5ITZB 5FNVB 2HRYA 2MQEA 3VTIC 4KWEA 1FNKA 2RHJA 3TD3A 4B46A 3FPIA 3LDTA 1OFUA 3CCJF 3IEWA 2ZODA 3HWUA 4G4VA 2VAWA 4G88A 1KD1H 4O4IB 1NMUB 3DDNA 2H8EA 5LP6B 5KMGA 3CXCF 2QEXF 3N2GB 2WALA 2RB9A 3CB2A 2IQQA 4BVTA 3CCEF 3FBAA 1W40A 3UT5A 4DRXB 4ZHWA 4G4XA 1KNJA 1YGYA 2VAMA 3NVKE 3QTYA 2Z1TA 4ERHA 5LP6C 5GANK 1GZ0A 3FD6A 5GAPK 1VQ7F 2HX0A 4BY9D 4LNUA 5IJ0A 3JALB 3Q8HA 4I50B 3TD5A 1RLUA 2RHOA 3D54A 4O4JB 4DXDA 5JVDA 5CB4B 2KTUA 4ZHVA 5LXTA 4YJ2A 4TZZA 3F0DA 4BT2A 5AVMA 3WGNA 1XBIA 4BW0B 4X1YB 1JJ2F 3CC7F 4IIJA 3CYPB 3IEQA 3JAWA 4R40B 1VHAA 2KG4A 1N8RH 3NMUC 4E6EA 1TUBA 5GONA 1QD9A 2LBWA 2CHTA 3E1YA 4F6RA 1UFYA 4TV8B 3LWPC 1YJ9F 1VQ4F 3DC2A 1OAPA 3SIUA 2BTQB 1ONIA 3K2XA 1IV1A 2HP0B 3ESJA 3AGKA 5IT9M 5JQGA 2Z1UA 3K12A 3I56F 1JFFB 1W3EX 2GZLA 1E7KA 3S03A 2YXZA 2ZVYA 3MBMA 2OTLF 1RQ7A 5HP7A 3T80A 5LYJA 1U40A 2PMPA 1H48A 3KIZA 4O4HA 2KTVA 2KGWA 2GVIA 3NK7A 2NMUA 3MCAB 1SDSA 3M84A 1SA0A 1VQPF 2CWJA 3ZO8A 3IMPA 2Q1YA 5LOVB 3N2KA 2CHSA 4X20B 4I4TA 1IPAA 3CYQA 4FFBB 3I3FA 5KX5B 1T0AA 5LYJB 3M4SA 1Q7YH 4HNAA 3VOAA 1QAHA 4X1KA 2HS0A 3RYHB 3GTZA 3FD5A 1NQ3A 5HWEA 1QVFF 4ZOLA 3WJQA 2QTPA 4U3JB 5JH7B 5BMVB 5IYZB 4BT5A 3HJWC 3MCQA 1W57A 1W59A 1YJNF 3C9UA 3JARB 5HY0A 4PWTA 3RYIA 4C81A 4WBNB 4M8IA 3M1XA 2OHWA 3CCQF 2G9IA 4O2AA 1M90H 2ZVZA 5J2UB 3CCRF 5FNVA 3LWVC 1CN7A 1JY8A 2CZWA 3WGLA 5IJ9B 3ON1A 5MN4A 1XRGA 4G4YA 3JAKB 2UYJA 4O4IA 4RQOA 5LP6A 2ALEA 2UZHA 3N2GA 1YQNA 5HY1A 3OBWA 1ZWZA 1U3PA 4DRXA 1KNKA 5MN6A 5GIPC 4NQ3A 1ODEA 3KJJA 2UYNB 3IR9A 2F9ZC 3E20B 3V4DA 2JNBA 4TV9B 3ZP7A 1W5FA 2IG8A 3JALA 3JASB 3QUWA 4I50A 4ZI7B 2BTOA 4O4JA 3VYTC 3V7QA 5CB4A 2DYYA 3C9SA 4C82A 2OTMA 3N4YA 1Q82H 2CSLA 4ZHQB 3S0HA 5J2TA 4X1YA 3LWQC 3CCLF 3ZOPA 2OZBA 3BYQA 3D01A 1VQ9F 4TV8A 2ZOVA 3O85A 2H8CA 5EYPB 3RYCB 1VQMF 5CA1B 3VIUA 2HP0A 1TVKB 5J2TB 2LBTA 1IV4A 1U43A 4C8GA 1JFFA 1VQVA 3CPWF 1YJWF 4BT4A 3P10A 1VQ5F 3IKEA 3JATA 1FSZA 1S72F 5HY4A 5A2QM 4I55B 3PAFA 4BT3A 3CC2F 2OTJF 1YIJF 1VQNF 1VK3A 1X7PA 1CK2A 2R6R1 5EIBC 3WPWA 2QA4F 3P0ZA 1W55A 2K1SA 5EZYB 1VQ6F 1R1MA 5HP8A 5LOVA 4X20A 1GO1A 4B62A 3K14A 4FFBA 1VQ8F 1VQOF 5KX5A 3N4ZA 3JATB 4BVSA 1YITF 5JCOA 2VGNA 1KC8H 1UI9A 3RYHA 2AMTA 1JN1A 2I6DA 3TD4A 1CLIA 4YJ3B 3KHNA 4G4ZA 4ZHYB 4U3JA 5DCVA 3F0FA 3WGKA 2B33A 1Z5WA 3HKBB 1H7MA 5JH7A 2DT4A 4U39A 5BMVA 5IYZA 1W41A 5FJ4C 3JARA 3D00A 3VYSC 4WBNA 1VQKF 1IV2A 2P6YA 3F0GA 5HY2A 5EIBD 3CCMF 1FFXB 2UYPA 1RA4A 5J2UA 2CVLA 5JCOC 3JVHA 3J80M 5LA6B 3G71F 2H6LA 2I6RA 1PXWA 5IJ9A 3S0YA 1VH8A 2HS4A 3LYBA 3J7AR 2IAFA 1K73H 3WPXA 3JAKA 2HRUA 3I7TA 4X1IB 2Z1FA 1Q86H 3ERNA 2HP3A 4EB6B 3HKEB 1YI2F 4C4WC 1DT9A 4EI9A 3GYQA 3EORA 3HTNA 1H47A 2UYNA 4EI7A 3CMAF 3QHDA 3RYFB 3C8LA 4TV9A 1XHOA 3HKCB 4O2BB 5HXUA 3JASA 2LBXA 4IHJB 3K0TA 1COMA 1W581 4ZI7A 2AIZP 3OBYA 3LWOC 1GX1A 3CCVF 1GO0A 1SZQA 3G6EF 2Z01A 3JAMM 2BO1A 4ZHQA 3E22B 4RHAA 5GIOC 3S06A 2N48A 4BT6A 3HKDB 3S0WA 2RHLA 1YHQF 4TUYB 3VO8A 1QU9A 2HS3A 1RLGA 3KJKA 5EYPA 3WXMB 3RYCA 1T0KB 3IKFA 3LWRC 1DBFA 5CA1A 2FC3A 5EB1B 1TVKA 1W5AA 3F6MA 3OONA 4O4LB 5CA0B 2RHHA 1W42A 1W2BF 2BTUA 1U3LA 4B5CA 5MN5A 4B45A 2GLZA 3CPQA 1K9MH 5C8YB 4I55A 3GHZA 2VGMA 3SIVA 4EI8A 2PHNA 3P4EA 4NWOB 3VI6A 5EZYA 4NUTA 2L26A 4C8EA 2QI2A 3C9TA 3V3TA 3NK6A 3NVIB 3CG6A 1M1KH 4XCQA 3OW2F 5KMGB 1K8AH 2HQSC 2Z1EA 3UT5B 3WJRA 4YJ3A 3RA6A 3VCZA 1Q8RA 3WJPA 3HKBA 1X7OA 4LNUB 5IJ0B 3MQWA 5G4VC 2ZAUA 1FNJA 3L7QA 5B8FA 3CMEF 3JCMM 3V7EA 5EB0A 2W8BC 5JVDB 2LCAA 3ELCA 3WGJA 4YJ2B 5LXTB 4LCKA 3VOBA 1FFXA 3RA5A 1J7HA 5GINC 5G4UC 4IIJB 5LA6A 3JAWB 4BVQA 1TUBB 5GONB 3LFOA 3VYUC 4F6RB 3C9RA 1X52A 4BT7A 4X1IA 3F0EA 3CCSF 4EB6A 3HKEA 3HAXD 3I55F 1Z5VA 5EAZA 5JQGB 3WGMA 3RYFA 1RQ2A 3ZP4A 4O2BA 3HKCA 1VQLF 1IV3A 4IHJA 3KE1A 3CC4F 3VMFB 1JD1A 1XV2A 4O4HB 3RE3A 1X25A 3FFMA 2VAPA 2VXYA 1SA0B 4ZK7A 5HXZA 3E22A 3N2KB 2FGYA 2ZF8A 2UYKA 4X3LA 3LMEA 4I4TB 4X3MA 3HKDA 2YYEA 3CCUF 4TUYA 5FLXM 3PLAC 4HNAB 5EWRA 4X1KB 5EO3A 4BVRA 1QVGF 1W5EA 1Q81H 1PF5A 3S02A 1KQSF 4ZOLB 5ITZA 2EWCA
chains in the Genus database with same CATH topology
1GO1A 2VGMA 3SIVA 3G4SF 1NJIH 4EI8A 3VI6A 1VQ8F 1VQOF 3N4ZA 5HWEA 4BVSA 1QVFF 4NUTA 1YITF 2VGNA 1KC8H 2HVYD 2AIFA 2QI2A 3V3TA 3HJWC 1YJNF 2I6DA 3NK6A 3J81M 3NVIB 3CD6F 3CG6A 5HY0A 1M1KH 4XCQA 3OW2F 5DCVA 2OHWA 1K8AH 1H7MA 3CCJF 3CCQF 1W41A 5FJ4C 1M90H 3CCRF 1KD1H 3D00A 3LWVC 3RA6A 1CN7A 2CZWA 1VQKF 1NMUB 5HY2A 3CXCF 2QEXF 2WALA 3ON1A 1X7OA 4BVTA 5G4VC 3CCEF 3CCMF 1W40A 1RA4A 3CMEF 3JCMM 3V7EA 3NVKE 3J80M 3G71F 5GAPK 5GANK 1GZ0A 1PXWA 2ALEA 1VQ7F 4BY9D 4LCKA 5HY1A 3J7AR 1K73H 3OBWA 1ZWZA 5GIPC 3RA5A 4NQ3A 5GINC 3IR9A 2F9ZC 1Q86H 5G4UC 3E20B 2KTUA 4TZZA 4BVQA 2JNBA 1YI2F 4C4WC 1DT9A 4EI9A 3LFOA 1XBIA 3GYQA 4BW0B 1X52A 4EI7A 1JJ2F 3CMAF 3V7QA 3CC7F 3CCSF 3NMUC 3HAXD 2KG4A 1N8RH 3I55F 5HXUA 2LBXA 3N4YA 2LBWA 1Q82H 3E1YA 3OBYA 3LWOC 3CCVF 3LWPC 1YJ9F 3LWQC 3CCLF 1GO0A 1VQ4F 3G6EF 2OZBA 3SIUA 1VQLF 3JAMM 2BO1A 1VQ9F 3AGKA 5IT9M 3I56F 1W3EX 5GIOC 3CC4F 3VMFB 3O85A 1E7KA 3FFMA 1VQMF 1YHQF 2OTLF 5HXZA 1RLGA 2FGYA 3CPWF 1YJWF 4X3LA 3WXMB 1T0KB 2KTVA 4X3MA 3LWRC 3NK7A 3CCUF 3MCAB 1SDSA 2FC3A 1VQPF 1VQ5F 5FLXM 3PLAC 1S72F 5HY4A 5A2QM 3PAFA 2OTJF 1W42A 5EWRA 3CC2F 1YIJF 1W2BF 1VQNF 5EO3A 1IPAA 1CK2A 1X7PA 4BVRA 2QA4F 1QVGF 1Q81H 2GLZA 1VQ6F 1KQSF 3CPQA 1Q7YH 1K9MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO1 A;  2VGM A;  3SIV A;  3G4S F;  1NJI H;  3VI6 A;  1VQ8 F;  1VQO F;  3N4Z A;  1QVF F;  4NUT A;  1YIT F;  2VGN A;  1KC8 H;  2HVY D;  2AIF A;  2QI2 A;  3HJW C;  1YJN F;  2I6D A;  3NK6 A;  3J81 M;  3NVI B;  3CD6 F;  3CG6 A;  1M1K H;  3OW2 F;  5DCV A;  2OHW A;  1K8A H;  1H7M A;  3CCJ F;  3CCQ F;  1W41 A;  5FJ4 C;  1M90 H;  3CCR F;  1KD1 H;  3LWV C;  3RA6 A;  1CN7 A;  2CZW A;  1VQK F;  1NMU B;  3CXC F;  2QEX F;  2WAL A;  3ON1 A;  1X7O A;  3CCM F;  5G4V C;  3CCE F;  1W40 A;  1RA4 A;  3CME F;  3JCM M;  3V7E A;  3NVK E;  3J80 M;  3G71 F;  5GAP K;  5GAN K;  1GZ0 A;  1PXW A;  2ALE A;  1VQ7 F;  4BY9 D;  4LCK A;  3J7A R;  1K73 H;  3OBW A;  1ZWZ A;  5GIP C;  3RA5 A;  5GIN C;  3IR9 A;  1Q86 H;  5G4U C;  3E20 B;  2KTU A;  4TZZ A;  2JNB A;  1YI2 F;  4C4W C;  1DT9 A;  3LFO A;  1XBI A;  3GYQ A;  4BW0 B;  1X52 A;  1JJ2 F;  3CMA F;  3V7Q A;  3CC7 F;  3CCS F;  3NMU C;  3HAX D;  2KG4 A;  1N8R H;  3I55 F;  2LBX A;  3N4Y A;  2LBW A;  1Q82 H;  3E1Y A;  3OBY A;  3LWO C;  3CCV F;  3LWP C;  1YJ9 F;  3LWQ C;  3CCL F;  1GO0 A;  1VQ4 F;  3G6E F;  2OZB A;  3SIU A;  1VQL F;  3JAM M;  2BO1 A;  1VQ9 F;  3AGK A;  5IT9 M;  3I56 F;  1W3E X;  5GIO C;  3CC4 F;  3VMF B;  3O85 A;  1E7K A;  3FFM A;  1VQM F;  1YHQ F;  2OTL F;  1RLG A;  3CPW F;  1YJW F;  4X3L A;  3WXM B;  1T0K B;  2KTV A;  4X3M A;  3LWR C;  3NK7 A;  3CCU F;  3MCA B;  1SDS A;  2FC3 A;  1VQP F;  1VQ5 F;  5FLX M;  3PLA C;  1S72 F;  5A2Q M;  3PAF A;  2OTJ F;  1W42 A;  5EWR A;  3CC2 F;  1YIJ F;  1W2B F;  1VQN F;  5EO3 A;  1IPA A;  1CK2 A;  1X7P A;  1QVG F;  2QA4 F;  1Q81 H;  1VQ6 F;  1KQS F;  3CPQ A;  1Q7Y H;  1K9M H; 
#chains in the Genus database with same CATH topology
 1W5B A;  2R75 1;  4O4L A;  5CA0 A;  3R0P A;  3G4S F;  1NJI H;  3RYI B;  2CW4 A;  2Q1X A;  4G4W A;  5C8Y A;  2HVY D;  3U0O A;  2AIF A;  3B6N A;  2V9Y A;  4O2A B;  3J81 M;  3MDO A;  4C8I A;  3CD6 F;  5ITZ B;  5FNV B;  2HRY A;  2MQE A;  3VTI C;  4KWE A;  1FNK A;  2RHJ A;  3TD3 A;  4B46 A;  3FPI A;  3LDT A;  1OFU A;  3CCJ F;  3IEW A;  2ZOD A;  3HWU A;  4G4V A;  2VAW A;  4G88 A;  1KD1 H;  4O4I B;  1NMU B;  3DDN A;  2H8E A;  5LP6 B;  5KMG A;  3CXC F;  2QEX F;  3N2G B;  2WAL A;  2RB9 A;  3CB2 A;  2IQQ A;  4BVT A;  3CCE F;  3FBA A;  1W40 A;  3UT5 A;  4DRX B;  4ZHW A;  4G4X A;  1KNJ A;  1YGY A;  2VAM A;  3NVK E;  3QTY A;  2Z1T A;  4ERH A;  5LP6 C;  5GAN K;  1GZ0 A;  3FD6 A;  5GAP K;  1VQ7 F;  2HX0 A;  4BY9 D;  4LNU A;  5IJ0 A;  3JAL B;  3Q8H A;  4I50 B;  3TD5 A;  1RLU A;  2RHO A;  3D54 A;  4O4J B;  4DXD A;  5JVD A;  5CB4 B;  2KTU A;  4ZHV A;  5LXT A;  4YJ2 A;  4TZZ A;  3F0D A;  4BT2 A;  5AVM A;  3WGN A;  1XBI A;  4BW0 B;  4X1Y B;  1JJ2 F;  3CC7 F;  4IIJ A;  3CYP B;  3IEQ A;  3JAW A;  4R40 B;  1VHA A;  2KG4 A;  1N8R H;  3NMU C;  4E6E A;  1TUB A;  5GON A;  1QD9 A;  2LBW A;  2CHT A;  3E1Y A;  4F6R A;  1UFY A;  4TV8 B;  3LWP C;  1YJ9 F;  1VQ4 F;  3DC2 A;  1OAP A;  3SIU A;  2BTQ B;  1ONI A;  3K2X A;  1IV1 A;  2HP0 B;  3ESJ A;  3AGK A;  5IT9 M;  5JQG A;  2Z1U A;  3K12 A;  3I56 F;  1JFF B;  1W3E X;  2GZL A;  1E7K A;  3S03 A;  2YXZ A;  2ZVY A;  3MBM A;  2OTL F;  1RQ7 A;  5HP7 A;  3T80 A;  5LYJ A;  1U40 A;  2PMP A;  1H48 A;  3KIZ A;  4O4H A;  2KTV A;  2KGW A;  2GVI A;  3NK7 A;  2NMU A;  3MCA B;  1SDS A;  3M84 A;  1SA0 A;  1VQP F;  2CWJ A;  3ZO8 A;  3IMP A;  2Q1Y A;  5LOV B;  3N2K A;  2CHS A;  4X20 B;  4I4T A;  1IPA A;  3CYQ A;  4FFB B;  3I3F A;  5KX5 B;  1T0A A;  5LYJ B;  3M4S A;  1Q7Y H;  4HNA A;  3VOA A;  1QAH A;  4X1K A;  2HS0 A;  3RYH B;  3GTZ A;  3FD5 A;  1NQ3 A;  5HWE A;  1QVF F;  4ZOL A;  3WJQ A;  2QTP A;  4U3J B;  5JH7 B;  5BMV B;  5IYZ B;  4BT5 A;  3HJW C;  3MCQ A;  1W57 A;  1W59 A;  1YJN F;  3C9U A;  3JAR B;  5HY0 A;  4PWT A;  3RYI A;  4C81 A;  4WBN B;  4M8I A;  3M1X A;  2OHW A;  3CCQ F;  2G9I A;  4O2A A;  1M90 H;  2ZVZ A;  5J2U B;  3CCR F;  5FNV A;  3LWV C;  1CN7 A;  1JY8 A;  2CZW A;  3WGL A;  5IJ9 B;  3ON1 A;  5MN4 A;  1XRG A;  4G4Y A;  3JAK B;  2UYJ A;  4O4I A;  4RQO A;  5LP6 A;  2ALE A;  2UZH A;  3N2G A;  1YQN A;  5HY1 A;  3OBW A;  1ZWZ A;  1U3P A;  4DRX A;  1KNK A;  5MN6 A;  5GIP C;  4NQ3 A;  1ODE A;  3KJJ A;  2UYN B;  3IR9 A;  2F9Z C;  3E20 B;  3V4D A;  2JNB A;  4TV9 B;  3ZP7 A;  1W5F A;  2IG8 A;  3JAL A;  3JAS B;  3QUW A;  4I50 A;  4ZI7 B;  2BTO A;  4O4J A;  3VYT C;  3V7Q A;  5CB4 A;  2DYY A;  3C9S A;  4C82 A;  2OTM A;  3N4Y A;  1Q82 H;  2CSL A;  4ZHQ B;  3S0H A;  5J2T A;  4X1Y A;  3LWQ C;  3CCL F;  3ZOP A;  2OZB A;  3BYQ A;  3D01 A;  1VQ9 F;  4TV8 A;  2ZOV A;  3O85 A;  2H8C A;  5EYP B;  3RYC B;  1VQM F;  5CA1 B;  3VIU A;  2HP0 A;  1TVK B;  5J2T B;  2LBT A;  1IV4 A;  1U43 A;  4C8G A;  1JFF A;  1VQV A;  3CPW F;  1YJW F;  4BT4 A;  3P10 A;  1VQ5 F;  3IKE A;  3JAT A;  1FSZ A;  1S72 F;  5HY4 A;  5A2Q M;  4I55 B;  3PAF A;  4BT3 A;  3CC2 F;  2OTJ F;  1YIJ F;  1VQN F;  1VK3 A;  1X7P A;  1CK2 A;  2R6R 1;  5EIB C;  3WPW A;  2QA4 F;  3P0Z A;  1W55 A;  2K1S A;  5EZY B;  1VQ6 F;  1R1M A;  5HP8 A;  5LOV A;  4X20 A;  1GO1 A;  4B62 A;  3K14 A;  4FFB A;  1VQ8 F;  1VQO F;  5KX5 A;  3N4Z A;  3JAT B;  4BVS A;  1YIT F;  5JCO A;  2VGN A;  1KC8 H;  1UI9 A;  3RYH A;  2AMT A;  1JN1 A;  2I6D A;  3TD4 A;  1CLI A;  4YJ3 B;  3KHN A;  4G4Z A;  4ZHY B;  4U3J A;  5DCV A;  3F0F A;  3WGK A;  2B33 A;  1Z5W A;  3HKB B;  1H7M A;  5JH7 A;  2DT4 A;  4U39 A;  5BMV A;  5IYZ A;  1W41 A;  5FJ4 C;  3JAR A;  3D00 A;  3VYS C;  4WBN A;  1VQK F;  1IV2 A;  2P6Y A;  3F0G A;  5HY2 A;  5EIB D;  3CCM F;  1FFX B;  2UYP A;  1RA4 A;  5J2U A;  2CVL A;  5JCO C;  3JVH A;  3J80 M;  5LA6 B;  3G71 F;  2H6L A;  2I6R A;  1PXW A;  5IJ9 A;  3S0Y A;  1VH8 A;  2HS4 A;  3LYB A;  3J7A R;  2IAF A;  1K73 H;  3WPX A;  3JAK A;  2HRU A;  3I7T A;  4X1I B;  2Z1F A;  1Q86 H;  3ERN A;  2HP3 A;  4EB6 B;  3HKE B;  1YI2 F;  4C4W C;  1DT9 A;  4EI9 A;  3GYQ A;  3EOR A;  3HTN A;  1H47 A;  2UYN A;  4EI7 A;  3CMA F;  3QHD A;  3RYF B;  3C8L A;  4TV9 A;  1XHO A;  3HKC B;  4O2B B;  5HXU A;  3JAS A;  2LBX A;  4IHJ B;  3K0T A;  1COM A;  1W58 1;  4ZI7 A;  2AIZ P;  3OBY A;  3LWO C;  1GX1 A;  3CCV F;  1GO0 A;  1SZQ A;  3G6E F;  2Z01 A;  3JAM M;  2BO1 A;  4ZHQ A;  3E22 B;  4RHA A;  5GIO C;  3S06 A;  2N48 A;  4BT6 A;  3HKD B;  3S0W A;  2RHL A;  1YHQ F;  4TUY B;  3VO8 A;  1QU9 A;  2HS3 A;  1RLG A;  3KJK A;  5EYP A;  3WXM B;  3RYC A;  1T0K B;  3IKF A;  3LWR C;  1DBF A;  5CA1 A;  2FC3 A;  5EB1 B;  1TVK A;  1W5A A;  3F6M A;  3OON A;  4O4L B;  5CA0 B;  2RHH A;  1W42 A;  1W2B F;  2BTU A;  1U3L A;  4B5C A;  5MN5 A;  4B45 A;  2GLZ A;  3CPQ A;  1K9M H;  5C8Y B;  4I55 A;  3GHZ A;  2VGM A;  3SIV A;  4EI8 A;  2PHN A;  3P4E A;  4NWO B;  3VI6 A;  5EZY A;  4NUT A;  2L26 A;  4C8E A;  2QI2 A;  3C9T A;  3V3T A;  3NK6 A;  3NVI B;  3CG6 A;  1M1K H;  4XCQ A;  3OW2 F;  5KMG B;  1K8A H;  2HQS C;  2Z1E A;  3UT5 B;  3WJR A;  4YJ3 A;  3RA6 A;  3VCZ A;  1Q8R A;  3WJP A;  3HKB A;  1X7O A;  4LNU B;  5IJ0 B;  3MQW A;  5G4V C;  2ZAU A;  1FNJ A;  3L7Q A;  5B8F A;  3CME F;  3JCM M;  3V7E A;  5EB0 A;  2W8B C;  5JVD B;  2LCA A;  3ELC A;  3WGJ A;  4YJ2 B;  5LXT B;  4LCK A;  3VOB A;  1FFX A;  3RA5 A;  1J7H A;  5GIN C;  5G4U C;  4IIJ B;  5LA6 A;  3JAW B;  4BVQ A;  1TUB B;  5GON B;  3LFO A;  3VYU C;  4F6R B;  3C9R A;  1X52 A;  4BT7 A;  4X1I A;  3F0E A;  3CCS F;  4EB6 A;  3HKE A;  3HAX D;  3I55 F;  1Z5V A;  5EAZ A;  5JQG B;  3WGM A;  3RYF A;  1RQ2 A;  3ZP4 A;  4O2B A;  3HKC A;  1VQL F;  1IV3 A;  4IHJ A;  3KE1 A;  3CC4 F;  3VMF B;  1JD1 A;  1XV2 A;  4O4H B;  3RE3 A;  1X25 A;  3FFM A;  2VAP A;  2VXY A;  1SA0 B;  4ZK7 A;  5HXZ A;  3E22 A;  3N2K B;  2FGY A;  2ZF8 A;  2UYK A;  4X3L A;  3LME A;  4I4T B;  4X3M A;  3HKD A;  2YYE A;  3CCU F;  4TUY A;  5FLX M;  3PLA C;  4HNA B;  5EWR A;  4X1K B;  5EO3 A;  4BVR A;  1QVG F;  1W5E A;  1Q81 H;  1PF5 A;  3S02 A;  1KQS F;  4ZOL B;  5ITZ A;  2EWC A; 
#chains in the Genus database with same CATH homology
 1GO1 A;  2VGM A;  3SIV A;  3G4S F;  1NJI H;  4EI8 A;  3VI6 A;  1VQ8 F;  1VQO F;  3N4Z A;  5HWE A;  4BVS A;  1QVF F;  4NUT A;  1YIT F;  2VGN A;  1KC8 H;  2HVY D;  2AIF A;  2QI2 A;  3V3T A;  3HJW C;  1YJN F;  2I6D A;  3NK6 A;  3J81 M;  3NVI B;  3CD6 F;  3CG6 A;  5HY0 A;  1M1K H;  4XCQ A;  3OW2 F;  5DCV A;  2OHW A;  1K8A H;  1H7M A;  3CCJ F;  3CCQ F;  1W41 A;  5FJ4 C;  1M90 H;  3CCR F;  1KD1 H;  3D00 A;  3LWV C;  3RA6 A;  1CN7 A;  2CZW A;  1VQK F;  1NMU B;  5HY2 A;  3CXC F;  2QEX F;  2WAL A;  3ON1 A;  1X7O A;  4BVT A;  5G4V C;  3CCE F;  3CCM F;  1W40 A;  1RA4 A;  3CME F;  3JCM M;  3V7E A;  3NVK E;  3J80 M;  3G71 F;  5GAP K;  5GAN K;  1GZ0 A;  1PXW A;  2ALE A;  1VQ7 F;  4BY9 D;  4LCK A;  5HY1 A;  3J7A R;  1K73 H;  3OBW A;  1ZWZ A;  5GIP C;  3RA5 A;  4NQ3 A;  5GIN C;  3IR9 A;  2F9Z C;  1Q86 H;  5G4U C;  3E20 B;  2KTU A;  4TZZ A;  4BVQ A;  2JNB A;  1YI2 F;  4C4W C;  1DT9 A;  4EI9 A;  3LFO A;  1XBI A;  3GYQ A;  4BW0 B;  1X52 A;  4EI7 A;  1JJ2 F;  3CMA F;  3V7Q A;  3CC7 F;  3CCS F;  3NMU C;  3HAX D;  2KG4 A;  1N8R H;  3I55 F;  5HXU A;  2LBX A;  3N4Y A;  2LBW A;  1Q82 H;  3E1Y A;  3OBY A;  3LWO C;  3CCV F;  3LWP C;  1YJ9 F;  3LWQ C;  3CCL F;  1GO0 A;  1VQ4 F;  3G6E F;  2OZB A;  3SIU A;  1VQL F;  3JAM M;  2BO1 A;  1VQ9 F;  3AGK A;  5IT9 M;  3I56 F;  1W3E X;  5GIO C;  3CC4 F;  3VMF B;  3O85 A;  1E7K A;  3FFM A;  1VQM F;  1YHQ F;  2OTL F;  5HXZ A;  1RLG A;  2FGY A;  3CPW F;  1YJW F;  4X3L A;  3WXM B;  1T0K B;  2KTV A;  4X3M A;  3LWR C;  3NK7 A;  3CCU F;  3MCA B;  1SDS A;  2FC3 A;  1VQP F;  1VQ5 F;  5FLX M;  3PLA C;  1S72 F;  5HY4 A;  5A2Q M;  3PAF A;  2OTJ F;  1W42 A;  5EWR A;  3CC2 F;  1YIJ F;  1W2B F;  1VQN F;  5EO3 A;  1IPA A;  1CK2 A;  1X7P A;  4BVR A;  2QA4 F;  1QVG F;  1Q81 H;  2GLZ A;  1VQ6 F;  1KQS F;  3CPQ A;  1Q7Y H;  1K9M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...