3SIVA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, dimeric form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
total genus 41
structure length 128
sequence length 128
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3sivA00
1VQ7F 5EWRA 1M90H 1SDSA 2LBXA 1IPAA 2KTVA 3RA6A 3CC2F 3CPWF 3LWVC 3NK7A 2QA4F 3CD6F 5GANK 3G4SF 1GO1A 3LFOA 5DCVA 1VQ9F 3CCEF 2JNBA 5GINC 1S72F 3RA5A 2AIFA 1YJNF 1W42A 1YJ9F 3CMAF 5G4UC 1X52A 3PLAC 5FJ4C 2VGMA 3LWQC 5GIPC 1XBIA 3CCRF 2HVYD 3CXCF 5G4VC 2FC3A 2BO1A 3CC4F 1DT9A 3OBWA 1T0KB 3NMUC 4BW0B 3OW2F 1CK2A 2KTUA 1Q81H 5EO3A 3CCUF 4X3MA 2ALEA 2CZWA 1Q7YH 3NK6A 3NVKE 3J81M 5FLXM 1RLGA 3JAMM 3ON1A 2LBWA 5GAPK 3OBYA 3CCSF 2OTLF 3CPQA 2WALA 1Q86H 1VQNF 3CC7F 3CCQF 2QEXF 3J80M 3N4YA 1VQLF 3JCMM 3LWPC 3CCLF 3PAFA 3VI6A 3I56F 3LWOC 1GO0A 1VQPF 3GYQA 1QVGF 3N4ZA 3HJWC 2QI2A 1KQSF 1VQOF 1KC8H 5IT9M 1GZ0A 3I55F 1N8RH 1K9MH 1CN7A 2VGNA 1KD1H 4C4WC 3CCMF 1X7OA 3WXMB 1W40A 3NVIB 1K8AH 1YITF 4LCKA 3CMEF 1YI2F 1NMUB 3IR9A 1NJIH 2KG4A 3CG6A 3G71F 1JJ2F 1VQ4F 3LWRC 1VQKF 1YHQF 1VQ5F 3J7AR 1ZWZA 1W2BF 4X3LA 1H7MA 3CCJF 3V7EA 3AGKA 1K73H 3V7QA 1W41A 1YJWF 1W3EX 1X7PA 1Q82H 3HAXD 2I6DA 1VQ8F 5GIOC 3SIUA 3G6EF 5A2QM 1E7KA 3O85A 3FFMA 3MCAB 3VMFB 2OTJF 4NUTA 4TZZA 1M1KH 3SIVA 1PXWA 3CCVF 3E1YA 1RA4A 4BY9D 1QVFF 1YIJF 1VQ6F 3E20B 2OZBA 2OHWA 1VQMF
chains in the Genus database with same CATH superfamily
3FPIA 4O4HA 3HKEA 5EB1B 5LP6B 1GX1A 3Q8HA 1SDSA 1XV2A 4ZI7B 5C8YA 2BTUA 3RA6A 3JAWA 3NK7A 3RYIB 5FNVA 3LFOA 5LA6A 3VYTC 5HP8A 1S72F 3RA5A 4IHJB 1W42A 3E22B 3MDOA 3M84A 1W5EA 3HKCB 4O4JB 4IIJA 3CXCF 2Z1UA 1KNKA 1TUBA 1T0KB 3HKBA 3KIZA 4BT2A 4ZHQB 4BT6A 2CZWA 3ZP4A 3BYQA 4B45A 2HP3A 2RHLA 3N2KA 4I50A 1FFXB 2RHJA 5FLXM 1RLGA 3DC2A 3QHDA 2I6RA 4EI7A 2CVLA 3ON1A 2HQSC 4XCQA 1R1MA 3UT5B 5LP6C 3WGLA 2OTLF 3CPQA 3N2GA 1VQNF 3CC7F 4F6RB 3F0FA 3CCQF 5LOVA 2UYKA 3VYSC 3LWPC 3P10A 3LWOC 4RQOA 2Q1XA 1GO0A 5KMGB 4EB6A 1VQPF 1DBFA 4O2AB 4ZOLA 3F0DA 1OFUA 4C81A 1VQOF 5IT9M 4C82A 5HY1A 2VGNA 5MN6A 4C4WC 4X1KB 3HTNA 1YI2F 3IR9A 3KJKA 5HY0A 2H8EA 5JQGA 1JJ2F 4C8EA 3FD5A 2V9YA 3KE1A 3S02A 3M4SA 4HNAA 4E6EA 4BT3A 4ZHYB 2AMTA 1Z5WA 5J2UA 1VHAA 1VQ5F 1ZWZA 3M1XA 1RLUA 2B33A 1H7MA 5EB0A 3CCJF 2GVIA 3V7EA 3OONA 4O4IA 1W41A 1YJWF 1X7PA 2HP0A 1Q82H 3C9RA 5LYJA 3P0ZA 2I6DA 2Z1FA 4X20B 5CA1A 2RB9A 1VQ8F 3F6MA 3O85A 3C9SA 1JD1A 3K14A 2FGYA 4TZZA 1XRGA 5LP6A 1PXWA 3CCVF 1COMA 3FD6A 1VQ6F 2OZBA 1VQ7F 2HS3A 1M90H 2LBXA 1UI9A 4DRXB 3WPXA 3V3TA 3CPWF 3VTIC 3CD6F 5GANK 2VAMA 3JAKB 1VQVA 3GTZA 5EIBC 1TVKA 3JALB 5KX5B 3LWQC 4C8IA 1XBIA 1J7HA 2K1SA 3CC4F 2FC3A 4ZHQA 3OBWA 1XHOA 3WGMA 4G4WA 1UFYA 5EYPA 1FFXA 5EO3A 3CCUF 5IJ0B 3K2XA 2UYPA 4M8IA 3ZO8A 4YJ3B 3VOBA 3NVKE 2PHNA 3J81M 3CYPB 5CB4B 3WJPA 4BT5A 3JAMM 2GZLA 3IKEA 2LBWA 3IEWA 3RYFB 3S0WA 1Q86H 1U40A 1Z5VA 3J80M 3N4YA 2L26A 5IJ9B 1VQLF 3C8LA 5KMGA 3VIUA 3PAFA 4U3JB 5JVDB 2NMUA 5EAZA 3JVHA 3I7TA 2HS0A 4ZK7A 2QI2A 3ERNA 4G4YA 3VO8A 3HKDA 1GZ0A 3I55F 4ERHA 2LCAA 5BMVA 3U0OA 3CCMF 1X7OA 3WXMB 2CSLA 2ZAUA 4U39A 1YITF 2UYJA 3R0PA 1K8AH 5HXZA 5LXTB 4G4VA 3GHZA 2IAFA 3MBMA 1NJIH 3CG6A 1JY8A 4YJ2B 3LWRC 1VQKF 5HXUA 2Z1TA 1YHQF 2KGWA 4BVRA 5JCOA 3J7AR 4BVQA 4BT7A 4C8GA 1IV4A 4O4HB 3HKEB 3K0TA 3AGKA 3V7QA 2IG8A 4BVSA 5C8YB 2UYNB 5GONB 2OTMA 4TV8B 1NQ3A 5EIBD 2W8BC 3FFMA 4I4TB 1IV2A 2G9IA 4NUTA 4NQ3A 2BTOA 4I55B 3JATB 4BY9D 5ITZA 1QVFF 3I3FA 5IYZA 3RYCB 1VQMF 5FJ4C 2LBTA 3T80A 4WBNA 5EWRA 4IIJB 3WJRA 4LNUB 1TUBB 1U3LA 1RQ2A 3HKBB 3G4SF 1GO1A 2ZVZA 5DCVA 5J2TB 4TUYA 2CWJA 1X25A 5MN5A 3JALA 5KX5A 2H8CA 2JNBA 3N2KB 2UZHA 2AIFA 1YJNF 1W5AA 3CMAF 3L7QA 3PLAC 1OAPA 3LMEA 4PWTA 4BVTA 5GIPC 4X1YB 4TV9B 2HVYD 5G4VC 1CLIA 1DT9A 1IV3A 2ZODA 4ZI7A 3N2GB 1ONIA 3ZP7A 5IJ0A 3NMUC 3LDTA 3RYIA 4B5CA 1CK2A 2KTUA 1Q81H 5CB4A 4X3MA 4R40B 5AVMA 1U43A 3JARB 1Q7YH 3NK6A 3VOAA 4ZOLB 4IHJA 3E22A 4B46A 3HKCA 4O4JA 3F0GA 5IJ9A 4X1IB 2WALA 5JH7B 5JVDA 4ZHWA 2QEXF 1JN1A 1IV1A 3JCMM 5JQGB 1SZQA 3S06A 2HS4A 3JASB 5EZYB 3I56F 4HNAB 1RQ7A 3GYQA 3N4ZA 3HJWC 1KQSF 3QUWA 1U3PA 4NWOB 5HWEA 1CN7A 4G4XA 3KJJA 1KD1H 3WJQA 5HY2A 1W59A 4O4IB 2VAPA 3UT5A 1W40A 3NVIB 2HP0B 4LCKA 4F6RA 5CA1B 1H47A 2IQQA 4FFBB 3RYHB 3ZOPA 1VQ4F 5B8FA 2CHTA 4O2AA 2F9ZC 4X3LA 2UYNA 1JFFB 5GONA 2AIZP 4TV8A 1K73H 4X1KA 5CA0B 4I4TA 4O2BB 3HAXD 5GIOC 3SIUA 5A2QM 3HWUA 4I55A 3JATA 3MCAB 2Z01A 3VMFB 3S03A 2Q1YA 3RYCA 3SIVA 3F0EA 1RA4A 1SA0B 1TVKB 1YIJF 3E20B 4LNUA 2OHWA 3S0HA 1QU9A 1IPAA 4O4LB 2KTVA 5J2TA 3ELCA 3CC2F 4X20A 3LWVC 2QA4F 5EYPB 2HX0A 3JAWB 2HRUA 5HP7A 1VQ9F 2GLZA 3CCEF 5GINC 1W5FA 4X1YA 5FNVB 4TV9A 5LA6B 3CB2A 3VCZA 3DDNA 1YJ9F 1X52A 3IKFA 5G4UC 2VGMA 4G4ZA 1FNJA 2QTPA 3QTYA 2RHOA 2ZVYA 3CCRF 2BO1A 3K12A 4DRXA 1YGYA 3JARA 1T0AA 2PMPA 2N48A 4BW0B 3OW2F 3JAKA 2ALEA 4BT4A 2YXZA 3WGKA 4X1IA 3HKDB 5JH7A 3TD3A 4RHAA 4ZHVA 5BMVB 2R6R1 1FSZA 1QD9A 3WGNA 2R751 3OBYA 4I50B 5GAPK 3CCSF 3ESJA 3MQWA 3JASA 5EZYA 4EI8A 2VXYA 3D01A 3LYBA 2P6YA 2VAWA 3VYUC 2RHHA 2CHSA 3CCLF 3MCQA 1PF5A 3VI6A 2BTQB 1W57A 3V4DA 3WGJA 3D00A 5LOVB 4YJ3A 5HY4A 2YYEA 3IMPA 1QVGF 2DYYA 1KC8H 4G88A 2CW4A 1KNJA 3WPWA 1N8RH 1K9MH 4EB6B 4FFBA 2ZOVA 3RYHA 1H48A 2Z1EA 3RYFA 3B6NA 2H6LA 3CMEF 3D54A 3FBAA 3P4EA 1NMUB 1FNKA 3TD5A 2KG4A 3EORA 3G71F 4DXDA 3C9TA 4B62A 4U3JA 1ODEA 1JFFA 1VH8A 2HRYA 2MQEA 5ITZB 1W2BF 1W5BA 4KWEA 5CA0A 4O2BA 5IYZB 3TD4A 3S0YA 4WBNB 5J2UB 1W3EX 3C9UA 5LXTA 3G6EF 1QAHA 2ZF8A 2DT4A 1E7KA 1YQNA 1SA0A 4TUYB 4YJ2A 1W55A 5LYJB 1VK3A 5MN4A 3CYQA 2OTJF 1M1KH 1W581 2EWCA 3E1YA 5JCOC 1Q8RA 3RE3A 3IEQA 4O4LA 3KHNA 4EI9A
chains in the Genus database with same CATH topology
1VQ7F 5EWRA 1M90H 1SDSA 2LBXA 1IPAA 2KTVA 3RA6A 3CC2F 3V3TA 3LWVC 3CPWF 3NK7A 2QA4F 3CD6F 5GANK 3G4SF 1GO1A 3LFOA 5DCVA 1VQ9F 2GLZA 3CCEF 2JNBA 5GINC 1S72F 3RA5A 2AIFA 1YJNF 1W42A 1YJ9F 3CMAF 5G4UC 1X52A 3PLAC 5FJ4C 2VGMA 3LWQC 4BVTA 1XBIA 5GIPC 3CCRF 2HVYD 3CXCF 2FC3A 2BO1A 5G4VC 3CC4F 1DT9A 3OBWA 1T0KB 3NMUC 4BW0B 3OW2F 1CK2A 2KTUA 1Q81H 5EO3A 3CCUF 4X3MA 2ALEA 2CZWA 1Q7YH 3NK6A 3NVKE 3J81M 5FLXM 1RLGA 4EI7A 3JAMM 3ON1A 4XCQA 2LBWA 5GAPK 3OBYA 3CCSF 2OTLF 3CPQA 2WALA 1Q86H 4EI8A 1VQNF 3CC7F 3CCQF 2QEXF 3J80M 3N4YA 1VQLF 3JCMM 3LWPC 3CCLF 3PAFA 3VI6A 3I56F 3LWOC 3D00A 1GO0A 1VQPF 5HY4A 3GYQA 1QVGF 3N4ZA 3HJWC 2QI2A 1KQSF 1VQOF 1KC8H 5IT9M 1GZ0A 3I55F 5HWEA 5HY1A 1N8RH 1K9MH 1CN7A 2VGNA 1KD1H 5HY2A 3CCMF 1X7OA 4C4WC 3WXMB 1W40A 3NVIB 1K8AH 1YITF 4LCKA 3CMEF 5HXZA 1YI2F 1NMUB 3IR9A 5HY0A 1NJIH 2KG4A 3CG6A 3G71F 1JJ2F 1VQ4F 3LWRC 1VQKF 5HXUA 1YHQF 4BVRA 1VQ5F 3J7AR 1ZWZA 1W2BF 4BVQA 2F9ZC 4X3LA 1H7MA 3CCJF 3V7EA 3AGKA 1K73H 3V7QA 1W41A 4BVSA 1YJWF 1W3EX 1X7PA 1Q82H 3HAXD 2I6DA 1VQ8F 5GIOC 3SIUA 3G6EF 5A2QM 1E7KA 3O85A 3FFMA 3MCAB 3VMFB 2OTJF 4NUTA 2FGYA 4TZZA 4NQ3A 1M1KH 3SIVA 1PXWA 3CCVF 3E1YA 1RA4A 4BY9D 1QVFF 1YIJF 1VQ6F 3E20B 2OZBA 2OHWA 4EI9A 1VQMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 F;  5EWR A;  1M90 H;  1SDS A;  2LBX A;  1IPA A;  2KTV A;  3RA6 A;  3CC2 F;  3CPW F;  3LWV C;  3NK7 A;  2QA4 F;  3CD6 F;  5GAN K;  3G4S F;  1GO1 A;  3LFO A;  5DCV A;  1VQ9 F;  3CCE F;  2JNB A;  5GIN C;  1S72 F;  3RA5 A;  2AIF A;  1YJN F;  1W42 A;  1YJ9 F;  3CMA F;  5G4U C;  1X52 A;  3PLA C;  5FJ4 C;  2VGM A;  3LWQ C;  5GIP C;  1XBI A;  3CCR F;  2HVY D;  3CXC F;  5G4V C;  2FC3 A;  2BO1 A;  3CC4 F;  1DT9 A;  3OBW A;  1T0K B;  3NMU C;  4BW0 B;  3OW2 F;  1CK2 A;  2KTU A;  1Q81 H;  5EO3 A;  3CCU F;  4X3M A;  2ALE A;  2CZW A;  1Q7Y H;  3NK6 A;  3NVK E;  3J81 M;  5FLX M;  1RLG A;  3JAM M;  3ON1 A;  2LBW A;  5GAP K;  3OBY A;  3CCS F;  2OTL F;  3CPQ A;  2WAL A;  1Q86 H;  1VQN F;  3CC7 F;  3CCQ F;  2QEX F;  3J80 M;  3N4Y A;  1VQL F;  3JCM M;  3LWP C;  3CCL F;  3PAF A;  3VI6 A;  3I56 F;  3LWO C;  1GO0 A;  1VQP F;  3GYQ A;  1QVG F;  3N4Z A;  3HJW C;  2QI2 A;  1KQS F;  1VQO F;  1KC8 H;  5IT9 M;  1GZ0 A;  3I55 F;  1N8R H;  1K9M H;  1CN7 A;  2VGN A;  1KD1 H;  4C4W C;  3CCM F;  1X7O A;  3WXM B;  1W40 A;  3NVI B;  1K8A H;  1YIT F;  4LCK A;  3CME F;  1YI2 F;  1NMU B;  3IR9 A;  1NJI H;  2KG4 A;  3CG6 A;  3G71 F;  1JJ2 F;  1VQ4 F;  3LWR C;  1VQK F;  1YHQ F;  1VQ5 F;  3J7A R;  1ZWZ A;  1W2B F;  4X3L A;  1H7M A;  3CCJ F;  3V7E A;  3AGK A;  1K73 H;  3V7Q A;  1W41 A;  1YJW F;  1W3E X;  1X7P A;  1Q82 H;  3HAX D;  2I6D A;  1VQ8 F;  5GIO C;  3SIU A;  3G6E F;  5A2Q M;  1E7K A;  3O85 A;  3FFM A;  3MCA B;  3VMF B;  2OTJ F;  4NUT A;  4TZZ A;  1M1K H;  3SIV A;  1PXW A;  3CCV F;  3E1Y A;  1RA4 A;  4BY9 D;  1QVF F;  1YIJ F;  1VQ6 F;  3E20 B;  2OZB A;  2OHW A;  1VQM F; 
#chains in the Genus database with same CATH topology
 3FPI A;  4O4H A;  3HKE A;  5EB1 B;  5LP6 B;  1GX1 A;  3Q8H A;  1SDS A;  1XV2 A;  4ZI7 B;  5C8Y A;  2BTU A;  3RA6 A;  3JAW A;  3NK7 A;  3RYI B;  5FNV A;  3LFO A;  5LA6 A;  3VYT C;  5HP8 A;  1S72 F;  3RA5 A;  4IHJ B;  1W42 A;  3E22 B;  3MDO A;  3M84 A;  1W5E A;  3HKC B;  4O4J B;  4IIJ A;  3CXC F;  2Z1U A;  1KNK A;  1TUB A;  1T0K B;  3HKB A;  3KIZ A;  4BT2 A;  4ZHQ B;  4BT6 A;  2CZW A;  3ZP4 A;  3BYQ A;  4B45 A;  2HP3 A;  2RHL A;  3N2K A;  4I50 A;  1FFX B;  2RHJ A;  5FLX M;  1RLG A;  3DC2 A;  3QHD A;  2I6R A;  4EI7 A;  2CVL A;  3ON1 A;  2HQS C;  4XCQ A;  1R1M A;  3UT5 B;  5LP6 C;  3WGL A;  2OTL F;  3CPQ A;  3N2G A;  1VQN F;  3CC7 F;  4F6R B;  3F0F A;  3CCQ F;  5LOV A;  2UYK A;  3VYS C;  3LWP C;  3P10 A;  3LWO C;  4RQO A;  2Q1X A;  1GO0 A;  5KMG B;  4EB6 A;  1VQP F;  1DBF A;  4O2A B;  4ZOL A;  3F0D A;  1OFU A;  4C81 A;  1VQO F;  5IT9 M;  4C82 A;  5HY1 A;  2VGN A;  5MN6 A;  4C4W C;  4X1K B;  3HTN A;  1YI2 F;  3IR9 A;  3KJK A;  5HY0 A;  2H8E A;  5JQG A;  1JJ2 F;  4C8E A;  3FD5 A;  2V9Y A;  3KE1 A;  3S02 A;  3M4S A;  4HNA A;  4E6E A;  4BT3 A;  4ZHY B;  2AMT A;  1Z5W A;  5J2U A;  1VHA A;  1VQ5 F;  1ZWZ A;  3M1X A;  1RLU A;  2B33 A;  1H7M A;  5EB0 A;  3CCJ F;  2GVI A;  3V7E A;  3OON A;  4O4I A;  1W41 A;  1YJW F;  1X7P A;  2HP0 A;  1Q82 H;  3C9R A;  5LYJ A;  3P0Z A;  2I6D A;  2Z1F A;  4X20 B;  5CA1 A;  2RB9 A;  1VQ8 F;  3F6M A;  3O85 A;  3C9S A;  1JD1 A;  3K14 A;  2FGY A;  4TZZ A;  1XRG A;  5LP6 A;  1PXW A;  3CCV F;  1COM A;  3FD6 A;  1VQ6 F;  2OZB A;  1VQ7 F;  2HS3 A;  1M90 H;  2LBX A;  1UI9 A;  4DRX B;  3WPX A;  3V3T A;  3CPW F;  3VTI C;  3CD6 F;  5GAN K;  2VAM A;  3JAK B;  1VQV A;  3GTZ A;  5EIB C;  1TVK A;  3JAL B;  5KX5 B;  3LWQ C;  4C8I A;  1XBI A;  1J7H A;  2K1S A;  3CC4 F;  2FC3 A;  4ZHQ A;  3OBW A;  1XHO A;  3WGM A;  4G4W A;  1UFY A;  5EYP A;  1FFX A;  5EO3 A;  3CCU F;  5IJ0 B;  3K2X A;  2UYP A;  4M8I A;  3ZO8 A;  4YJ3 B;  3VOB A;  3NVK E;  2PHN A;  3J81 M;  3CYP B;  5CB4 B;  3WJP A;  4BT5 A;  3JAM M;  2GZL A;  3IKE A;  2LBW A;  3IEW A;  3RYF B;  3S0W A;  1Q86 H;  1U40 A;  1Z5V A;  3J80 M;  3N4Y A;  2L26 A;  5IJ9 B;  1VQL F;  3C8L A;  5KMG A;  3VIU A;  3PAF A;  4U3J B;  5JVD B;  2NMU A;  5EAZ A;  3JVH A;  3I7T A;  2HS0 A;  4ZK7 A;  2QI2 A;  3ERN A;  4G4Y A;  3VO8 A;  3HKD A;  1GZ0 A;  3I55 F;  4ERH A;  2LCA A;  5BMV A;  3U0O A;  3CCM F;  1X7O A;  3WXM B;  2CSL A;  2ZAU A;  4U39 A;  1YIT F;  2UYJ A;  3R0P A;  1K8A H;  5HXZ A;  5LXT B;  4G4V A;  3GHZ A;  2IAF A;  3MBM A;  1NJI H;  3CG6 A;  1JY8 A;  4YJ2 B;  3LWR C;  1VQK F;  5HXU A;  2Z1T A;  1YHQ F;  2KGW A;  4BVR A;  5JCO A;  3J7A R;  4BVQ A;  4BT7 A;  4C8G A;  1IV4 A;  4O4H B;  3HKE B;  3K0T A;  3AGK A;  3V7Q A;  2IG8 A;  4BVS A;  5C8Y B;  2UYN B;  5GON B;  2OTM A;  4TV8 B;  1NQ3 A;  5EIB D;  2W8B C;  3FFM A;  4I4T B;  1IV2 A;  2G9I A;  4NUT A;  4NQ3 A;  2BTO A;  4I55 B;  3JAT B;  4BY9 D;  5ITZ A;  1QVF F;  3I3F A;  5IYZ A;  3RYC B;  1VQM F;  5FJ4 C;  2LBT A;  3T80 A;  4WBN A;  5EWR A;  4IIJ B;  3WJR A;  4LNU B;  1TUB B;  1U3L A;  1RQ2 A;  3HKB B;  3G4S F;  1GO1 A;  2ZVZ A;  5DCV A;  5J2T B;  4TUY A;  2CWJ A;  1X25 A;  5MN5 A;  3JAL A;  5KX5 A;  2H8C A;  2JNB A;  3N2K B;  2UZH A;  2AIF A;  1YJN F;  1W5A A;  3CMA F;  3L7Q A;  3PLA C;  1OAP A;  3LME A;  4PWT A;  4BVT A;  5GIP C;  4X1Y B;  4TV9 B;  2HVY D;  5G4V C;  1CLI A;  1DT9 A;  1IV3 A;  2ZOD A;  4ZI7 A;  3N2G B;  1ONI A;  3ZP7 A;  5IJ0 A;  3NMU C;  3LDT A;  3RYI A;  4B5C A;  1CK2 A;  2KTU A;  1Q81 H;  5CB4 A;  4X3M A;  4R40 B;  5AVM A;  1U43 A;  3JAR B;  1Q7Y H;  3NK6 A;  3VOA A;  4ZOL B;  4IHJ A;  3E22 A;  4B46 A;  3HKC A;  4O4J A;  3F0G A;  5IJ9 A;  4X1I B;  2WAL A;  5JH7 B;  5JVD A;  4ZHW A;  2QEX F;  1JN1 A;  1IV1 A;  3JCM M;  5JQG B;  1SZQ A;  3S06 A;  2HS4 A;  3JAS B;  5EZY B;  3I56 F;  4HNA B;  1RQ7 A;  3GYQ A;  3N4Z A;  3HJW C;  1KQS F;  3QUW A;  1U3P A;  4NWO B;  5HWE A;  1CN7 A;  4G4X A;  3KJJ A;  1KD1 H;  3WJQ A;  5HY2 A;  1W59 A;  4O4I B;  2VAP A;  3UT5 A;  1W40 A;  3NVI B;  2HP0 B;  4LCK A;  4F6R A;  5CA1 B;  1H47 A;  2IQQ A;  4FFB B;  3RYH B;  3ZOP A;  1VQ4 F;  5B8F A;  2CHT A;  4O2A A;  2F9Z C;  4X3L A;  2UYN A;  1JFF B;  5GON A;  2AIZ P;  4TV8 A;  1K73 H;  4X1K A;  5CA0 B;  4I4T A;  4O2B B;  3HAX D;  5GIO C;  3SIU A;  5A2Q M;  3HWU A;  4I55 A;  3JAT A;  3MCA B;  2Z01 A;  3VMF B;  3S03 A;  2Q1Y A;  3RYC A;  3SIV A;  3F0E A;  1RA4 A;  1SA0 B;  1TVK B;  1YIJ F;  3E20 B;  4LNU A;  2OHW A;  3S0H A;  1QU9 A;  1IPA A;  4O4L B;  2KTV A;  5J2T A;  3ELC A;  3CC2 F;  4X20 A;  3LWV C;  2QA4 F;  5EYP B;  2HX0 A;  3JAW B;  2HRU A;  5HP7 A;  1VQ9 F;  2GLZ A;  3CCE F;  5GIN C;  1W5F A;  4X1Y A;  5FNV B;  4TV9 A;  5LA6 B;  3CB2 A;  3VCZ A;  3DDN A;  1YJ9 F;  1X52 A;  3IKF A;  5G4U C;  2VGM A;  4G4Z A;  1FNJ A;  2QTP A;  3QTY A;  2RHO A;  2ZVY A;  3CCR F;  2BO1 A;  3K12 A;  4DRX A;  1YGY A;  3JAR A;  1T0A A;  2PMP A;  2N48 A;  4BW0 B;  3OW2 F;  3JAK A;  2ALE A;  4BT4 A;  2YXZ A;  3WGK A;  4X1I A;  3HKD B;  5JH7 A;  3TD3 A;  4RHA A;  4ZHV A;  5BMV B;  2R6R 1;  1FSZ A;  1QD9 A;  3WGN A;  2R75 1;  3OBY A;  4I50 B;  5GAP K;  3CCS F;  3ESJ A;  3MQW A;  3JAS A;  5EZY A;  4EI8 A;  2VXY A;  3D01 A;  3LYB A;  2P6Y A;  2VAW A;  3VYU C;  2RHH A;  2CHS A;  3CCL F;  3MCQ A;  1PF5 A;  3VI6 A;  2BTQ B;  1W57 A;  3V4D A;  3WGJ A;  3D00 A;  5LOV B;  4YJ3 A;  5HY4 A;  2YYE A;  3IMP A;  1QVG F;  2DYY A;  1KC8 H;  4G88 A;  2CW4 A;  1KNJ A;  3WPW A;  1N8R H;  1K9M H;  4EB6 B;  4FFB A;  2ZOV A;  3RYH A;  1H48 A;  2Z1E A;  3RYF A;  3B6N A;  2H6L A;  3CME F;  3D54 A;  3FBA A;  3P4E A;  1NMU B;  1FNK A;  3TD5 A;  2KG4 A;  3EOR A;  3G71 F;  4DXD A;  3C9T A;  4B62 A;  4U3J A;  1ODE A;  1JFF A;  1VH8 A;  2HRY A;  2MQE A;  5ITZ B;  1W2B F;  1W5B A;  4KWE A;  5CA0 A;  4O2B A;  5IYZ B;  3TD4 A;  3S0Y A;  4WBN B;  5J2U B;  1W3E X;  3C9U A;  5LXT A;  3G6E F;  1QAH A;  2ZF8 A;  2DT4 A;  1E7K A;  1YQN A;  1SA0 A;  4TUY B;  4YJ2 A;  1W55 A;  5LYJ B;  1VK3 A;  5MN4 A;  3CYQ A;  2OTJ F;  1M1K H;  1W58 1;  2EWC A;  3E1Y A;  5JCO C;  1Q8R A;  3RE3 A;  3IEQ A;  4O4L A;  3KHN A;  4EI9 A; 
#chains in the Genus database with same CATH homology
 1VQ7 F;  5EWR A;  1M90 H;  1SDS A;  2LBX A;  1IPA A;  2KTV A;  3RA6 A;  3CC2 F;  3V3T A;  3LWV C;  3CPW F;  3NK7 A;  2QA4 F;  3CD6 F;  5GAN K;  3G4S F;  1GO1 A;  3LFO A;  5DCV A;  1VQ9 F;  2GLZ A;  3CCE F;  2JNB A;  5GIN C;  1S72 F;  3RA5 A;  2AIF A;  1YJN F;  1W42 A;  1YJ9 F;  3CMA F;  5G4U C;  1X52 A;  3PLA C;  5FJ4 C;  2VGM A;  3LWQ C;  4BVT A;  1XBI A;  5GIP C;  3CCR F;  2HVY D;  3CXC F;  2FC3 A;  2BO1 A;  5G4V C;  3CC4 F;  1DT9 A;  3OBW A;  1T0K B;  3NMU C;  4BW0 B;  3OW2 F;  1CK2 A;  2KTU A;  1Q81 H;  5EO3 A;  3CCU F;  4X3M A;  2ALE A;  2CZW A;  1Q7Y H;  3NK6 A;  3NVK E;  3J81 M;  5FLX M;  1RLG A;  4EI7 A;  3JAM M;  3ON1 A;  4XCQ A;  2LBW A;  5GAP K;  3OBY A;  3CCS F;  2OTL F;  3CPQ A;  2WAL A;  1Q86 H;  4EI8 A;  1VQN F;  3CC7 F;  3CCQ F;  2QEX F;  3J80 M;  3N4Y A;  1VQL F;  3JCM M;  3LWP C;  3CCL F;  3PAF A;  3VI6 A;  3I56 F;  3LWO C;  3D00 A;  1GO0 A;  1VQP F;  5HY4 A;  3GYQ A;  1QVG F;  3N4Z A;  3HJW C;  2QI2 A;  1KQS F;  1VQO F;  1KC8 H;  5IT9 M;  1GZ0 A;  3I55 F;  5HWE A;  5HY1 A;  1N8R H;  1K9M H;  1CN7 A;  2VGN A;  1KD1 H;  5HY2 A;  3CCM F;  1X7O A;  4C4W C;  3WXM B;  1W40 A;  3NVI B;  1K8A H;  1YIT F;  4LCK A;  3CME F;  5HXZ A;  1YI2 F;  1NMU B;  3IR9 A;  5HY0 A;  1NJI H;  2KG4 A;  3CG6 A;  3G71 F;  1JJ2 F;  1VQ4 F;  3LWR C;  1VQK F;  5HXU A;  1YHQ F;  4BVR A;  1VQ5 F;  3J7A R;  1ZWZ A;  1W2B F;  4BVQ A;  2F9Z C;  4X3L A;  1H7M A;  3CCJ F;  3V7E A;  3AGK A;  1K73 H;  3V7Q A;  1W41 A;  4BVS A;  1YJW F;  1W3E X;  1X7P A;  1Q82 H;  3HAX D;  2I6D A;  1VQ8 F;  5GIO C;  3SIU A;  3G6E F;  5A2Q M;  1E7K A;  3O85 A;  3FFM A;  3MCA B;  3VMF B;  2OTJ F;  4NUT A;  2FGY A;  4TZZ A;  4NQ3 A;  1M1K H;  3SIV A;  1PXW A;  3CCV F;  3E1Y A;  1RA4 A;  4BY9 D;  1QVF F;  1YIJ F;  1VQ6 F;  3E20 B;  2OZB A;  2OHW A;  4EI9 A;  1VQM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...