4YJ3B

Crystal structure of tubulin bound to compound 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj3B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj3B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj3B01
3N2KA 5LYJB 4IHJA 4I50A 4YJ2A 4XCQA 4ZOLB 5CB4A 5J2TA 3N2KB 4O4HB 4IHJB 4TV8A 5LP6C 4ZI7A 3ZIDA 5CB4B 5J2TB 3JAWA 4TV8B 4ZI7B 1RLUA 5LOVA 3HKDA 3WGLA 3ZBPA 2Q1XA 4EI7A 5LOVB 3R4VA 3RYFB 3VPAA 5MN6A 5JH7A 4I4TA 4B45A 5IJ0A 4F6RB 2VXYA 3JASB 1W5EA 2Q1YA 2RHLA 3HKEA 4TV9A 3C8LA 2BTQA 5JQGA 3HKEB 4TV9B 5BMVB 1Z5VA 5LXTB 2BTQB 3CB2A 5JQGB 2VAMA 3WGJA 3JAKB 4U39A 4O2BB 5ITZB 3JATA 3RYHA 4I50B 4YJ2B 3WGNA 3WGMA 5JCOC 3V3TA 3VOBA 3JAWB 3HKDB 4WBNA 4X1KA 3RYIA 1TUBA 4LNUA 4M8IA 3ZBQA 4WBNB 3RYIB 3VO8A 4LNUB 3VOAA 3WGKA 5CA1A 5JH7B 4DXDA 1TVKA 4I4TB 2XKBA 4HNAA 4TUYA 1Z5WA 4X1YA 2RHHA 5CA0A 1TVKB 1SA0A 5IJ0B 2XKAA 4ZHQA 5LA6A 2RHJA 5CA0B 1SA0B 5IYZA 4ZHQB 1OFUA 1W581 5KX5A 3N2GA 5EZYA 3M89A 5IYZB 4O4IA 5KX5B 4O4LA 3N2GB 4DRXA 4O4IB 1JFFA 4YJ3A 4EI8A 5GONA 4X20A 4DRXB 1W5BA 4EB6A 1RQ7A 4B46A 3JATB 5JVDA 3RYHB 4EI9A 3RYCA 1FSZA 3VO9A 3RYCB 5EIBD 2VAWA 3JALA 2RHOA 1RQ2A 2R6R1 4X1KB 1TUBB 4U3JA 3JARA 4O2AA 5EIBC 4X1IA 5EYPA 2BTOA 4U3JB 5IJ9A 5CA1B 4X1IB 5EYPB 1W59A 5FNVA 4HNAB 4TUYB 5IJ9B 4X1YB 5J2UA 4O4JA 1FFXA 4ZOLA 1W5FA 5FNVB 4IIJA 4O4HA 3UT5A 5LA6B 3RB8A 5J2UB 4O4JB 1FFXB 4IIJB 3UT5B 5C8YA 5EZYB 4KWEA 5C8YB 4O4LB 3HKBA 3RYFA 4YJ3B 1JFFB 4E6EA 5GONB 3HKBB 4X20B 4I55A 4EB6B 3M8KA 5KMGA 4F6RA 5JVDB 4I55B 3JASA 5KMGB 2R751 5LP6A 5MN4A 5M7EA 3E22A 3JALB 5JCOA 5BMVA 5LP6B 5LXTA 3E22B 1W5AA 4FFBA 2GVIA 3JAKA 3HKCA 3JARB 2VAPA 4FFBB 4O2AB 4O2BA 3HKCB 5LYJA 5ITZA 5MN5A
chains in the Genus database with same CATH superfamily
3V7WA 4L76A 1YSCA 1JJ7A 3F74A 3MCAB 3BT7A 1GPDG 3CCVV 5E1DA 2FPSA 2DFTA 2WTNA 2IHZA 4ID3A 3QV1A 2C31A 4UM5A 3ZOZA 3I28A 1E99A 2W2LA 1RW4A 2GYVA 5KTKA 5EK0A 2QTNA 1JBKA 3D43A 5KYYA 1VQ4F 2GH1A 5FWYA 3DTVB 2NZYA 1W1IA 1UWVA 2P1ZA 2Y77A 1IIRA 4EI8A 2GNPA 4QOJA 2V7QA 2YWHA 2R65A 2OCHA 4LCBA 3IESA 1OWOA 2Q7HA 4CL2A 1SZXA 5K0GA 2UYJA 2NAPA 1M5UA 2A67A 4OJYA 1N8SA 5JFGA 1OTXA 3B48A 5ITWA 2HA0A 3E8HA 5C8YB 1E2GA 5FBKA 1XTRA 2CWJA 1U65A 2YFKA 3VHXA 4FOSA 2M7WA 1YDWA 4B81A 4EMUA 2CHFA 1C2YA 4F5EA 3E20B 3ME5A 2ZJBA 3OCCA 2O0KA 3SEFA 1Y7IA 1XXHB 2A5YB 2P3QA 3AVTA 4BFCA 4LF4O 3AWDA 3ZD9A 2HF9A 5BN4A 1WDWB 3QYPA 1XWIA 4HAIA 1TA4A 3MWEA 1Z6XA 4CF7A 3OT1A 1JLLA 1NDHA 2BEVA 4HTFB 3GJZA 3UJCA 1UM9B 1PS0A 4YC7A 2RCVA 5GTIZ 2YASA 4L75A 1ENVA 2WMOB 3MCVA 2GZ3A 3LQKA 2E85A 1DOAA 1JFSA 4CVNA 4IY1A 4F2GA 2C7QA 3UAVA 4GMFA 1COZA 1BAPA 3O8QA 1C4OA 3H0EA 4EY6A 3MWYW 2EU8A 1V1RA 1RWVA 1PSWA 1CLUA 4YRGA 3B9PA 3IIIA 3K32A 3M1AA 4J7CA 3BGIA 3KJEA 1UBKS 3SY8A 4E21A 4BQIA 4RJTA 4PVCA 5EKSA 1FXKB 3JQAB 2CNBA 3OSUA 4C7KA 4D9EA 5LFAA 4OHRA 1D8AA 3ECAA 5T57A 1PD1A 2HREA 1KYWA 1GX1A 2YJGA 1ZKMA 5KAMA 2FRXA 2YN4A 5TVGA 3IB3A 1EAMA 4ZFNA 1BVUA 1ZCBA 1CDOA 1PT5A 1VQ7V 2D1SA 4FB4A 4QT0A 4Y2HA 4ZEOA 2EZOA 3S0WA 2D5AA 1YS2X 4CMIA 2PUCA 3ILSA 5FUBA 4R9NA 1W19A 2C92A 2IEIA 3ASVA 2P3OA 3FMPB 2IJJA 3WGOA 3ESXA 2HD4A 1OBOA 5TE9A 5JW6A 4GOOD 2CVFA 3RVNA 5B58T 2OGSA 1P2TA 5HFNA 1Y76B 5K0ZA 1DUIA 3CNOA 3A6FA 4EF5A 2V3VA 3AP3A 2FR8C 2EYUA 1M1YA 1U9YA 1CUZA 5GY7A 2Q7XA 2HLNA 4HV4A 3B1WA 4CH3A 1T36B 3OFKA 3FMVA 4N7RA 4N9WA 3TGPA 1I36A 4CEHB 4C0SA 3WWPA 2VZ0A 2J09A 5D5PA 4OBWA 2WJHA 2CUGA 2CXOA 3VR2A 4X7PA 3SJCC 2QSAA 4U7NA 5BYBA 2JC3A 3HWRA 2Z2KA 4GVPA 3C6MA 3T7KA 3O8BA 2K2WA 1MF7A 1W49A 3GEEA 1E3SA 3ZS8C 3I53A 4QOHA 4D5EA 1ISMA 4L07A 4DNOA 3SM9A 1TFRA 4X60A 4UMDA 1RBQA 2YMLA 3HVUA 1G6UA 1G59A 4DM3A 2WIAA 5KCMA 1E2DA 1SUAA 3ZQKA 3AVPA 4N4AA 3T5GA 1UBCA 2CYAA 1RXUA 3RKSA 2IW1A 3P9NA 1EINA 4I9NA 5A3RA 4BE4A 3EEFA 4NY1A 1DIAA 1HZZA 1ISRA 1U1CA 1SS3A 2J1LA 3HKDA 4NJEB 3SSAA 3GLSA 4UBOA 2UYQA 2OYRA 2JFGA 4WNYA 2PXHA 3F5DA 3PDIB 4Y2YA 4ZCTA 4KFRA 4YUYA 2ZETA 1YUNA 3ETQA 2BL4A 3WLAA 1N3BA 1ZNWA 4ESEA 2O8FA 4EW1A 2JARA 5DYIA 4AECA 4GPEA 2Q41A 4DC1A 5E2AA 1PR6A 4QPDA 1U3FA 4RGVA 2F59A 4W5QA 1N7JA 3SR0A 4CLHA 5AVVA 2BM8A 4DR5O 2CLFB 4OL9A 2IXDA 1CUVA 5A7HA 2P65A 2JGFA 3WZMA 3DOHA 2GN4A 1YRQA 3C5HA 3KPYA 2VQ6A 9ABPA 3VZCA 4JYMA 2QVBA 5DCWA 4B4DA 5KOYA 2SKCA 5LWHA 3VBBA 1XRMA 1Q81H 2Q1XA 4MV0A 4KMSA 5H3CA 5A05A 1QMGA 1Z35A 3LNMB 3BRWA 2J8ZA 5AKIA 1RWXA 4G4JA 3EA4A 1OT3A 3QHPA 4WFQA 4DIDA 1T8YA 2HGSA 4MWBA 1KDVA 1N2XA 1GN4A 3IAXA 1GCOA 2ACVA 1C3LA 2GBIA 2Z6UA 3DL2A 4BLUA 3RAEC 1YWGO 1EUQA 2X9VA 2JHFA 2CHTA 2YI9A 2RGUA 3R74A 1ECFA 1E1RD 1O9GA 1OHHA 4Z4FA 4LOLA 2XKJE 3V9AA 3CYPB 4AU1A 4YRAA 2ZE5A 3ESJA 2H2WA 4GX0A 1FXHA 5LP1A 1ZA2A 4EVRA 3BFPA 4AG5A 3LNCA 1ABFA 3HKBB 2ZIAA 1JVSA 1PG2A 4ZVLA 5HP4A 3BPZA 2Q27A 4EGCB 2I6TA 4O2AB 4OGGA 1PL7A 3I6ZA 3PITA 4ZAYA 2G83A 1KP3A 2CGNA 4JBYA 1WXDA 2TMYA 2ZSHA 3L1IA 1GT91 2ORWA 4MRMB 3X44A 1WZCA 4DLYA 2GAJA 4L8WB 3CMAV 5JAIA 3B8NA 4TQFA 1MGPA 1HL7A 1VDMA 3BIFA 4J8PA 3T1QA 3LWQC 4Q02A 1YCFA 5EUCA 3QLEA 4I5EA 1CJCA 3COJA 2O9JA 2NPIA 2VDMB 2Q6VA 3IC5A 2H18A 2BMJA 1WXXA 3GG2A 3ERCA 1Q20A 3IGAC 4ANFA 3KP1A 1DBSA 2P78A 4MITA 4ARIA 1IOVA 4Q3LA 2BTOA 1SG9A 3OONA 1H4TA 1YNOA 1GA4A 4WFKA 3EXIB 2AWOA 1W8IA 4LF6O 1VGRA 4OQEA 1BSMA 5ED0A 3CNEA 2BDEA 3BXXA 2WZQA 5K3EA 3L7BA 4G5HA 5K7SA 1K4CC 1IN1A 3D3IA 3IA7A 3UUEA 4G8CA 1XOUA 4YV2A 1WBBA 1AGXA 4FK8A 2XF2A 3KRTA 3BJMA 4H7PA 5L45A 3DJYA 3CYQA 3B89A 3WK6A 4KV7A 4PXSA 2Q5CA 2P6NA 1Z8FA 2WKWA 1NW3A 2QI9C 1RSOB 1U0TA 4UCQA 3ANTA 1D1PA 4TT3D 4BLSA 3T9AA 1YRWA 2BHSA 1ZYUA 4MGZR 2VIIA 5ALDA 5LZ2A 1XI2A 3D7KA 1YIJF 1Q3KA 1P4SA 2HHHB 3CCMV 1YITV 3GB7C 1RRKA 5DI9A 4UJ5A 2UXNA 4DY6A 5A5GA 2RHBA 2RK6A 3DKRA 4LWSB 3WZLA 1VE9A 4OLBA 4U3JB 4YAUA 4C0KA 1WCWA 3QFRA 2DR2A 3A1FA 5A6SA 3I39X 2VQFO 1JJOA 1B0PA 2VHCA 3QMMA 3FCSB 3L41A 4Q03A 4HNSA 1C7FA 4DKXA 2XXBA 3GW8A 4BEVA 2B83A 3AKDA 3UXYA 1XDBA 5CNKA 3TBHA 4BX3A 2XUHA 2YXHA 1JG7A 1LTQA 1KI2A 3I3OA 4PIVA 1DRKA 4GDMA 4HWPA 1T0UA 4PQYA 3D0RA 3X1WA 2VQFB 5HKBA 5L7WA 3RF7A 4LJ9A 2A7QA 3BA9A 5KHGA 5G4KB 3EY4A 1JR3E 2E4XA 2I7VA 1NXSA 3PHJA 3VTZA 4MQEA 4MJ7A 4EHAA 1SHKA 4CS3A 5DDIP 2A0KA 4DRXA 4E7PA 1QONA 2C9ZA 3VJRA 2NADA 1FP7A 1JJFA 4QUGA 2J31A 4LE2A 2XNHA 5L3GA 2WZBA 2QUHA 2YY5A 4RCYA 3JTEA 3NOXA 4RQBA 1DARA 1T0HB 3NHUA 2ZKOA 2L18A 3K03A 1BX0A 4W4TA 4NHEA 4AUEA 4YRLA 2HJFC 3G88A 4PZ0A 4INZA 4P30A 3ITDA 4XWYA 4CTMA 4NWOB 3WWEA 1BJTA 3FOFC 2WSSA 5J9PC 4H7HA 2HMTA 1HGXA 4C0LA 1YTLA 4S1VA 4J1TC 2IH2A 1FLDA 2Z2XA 3ZOPA 3V80A 5F7XA 4RQUA 3DF9A 2P68A 4D9BA 5AKJA 2C58A 4MARA 4HRXA 2EX3A 4Q4HA 1I7LA 4HWOA 5FUYA 4OP2A 1NR1A 1BEUB 3VIUA 2WA4A 3O2JA 4GM1A 3JYNA 1SA0A 3QIAA 5IH3A 2A4KA 2C82A 3IS3A 2R00A 3D0QA 5GTHZ 3ZDBA 2EGHA 1U7WA 2WAXA 3CJQA 3KKLA 2IXEA 2V58A 2X1HA 4KTTE 2V4DA 3KLMX 1LVHA 3GYQA 2H9AA 1GADO 4G0VA 5FNVA 1FUEA 1SRQA 3L75H 4F84A 2RHWA 2ODBA 1W9HA 3RK4A 1NBOA 3LA6A 3WGVA 4I9QA 1D1TA 1RPJA 3H6KA 1S1MA 1EGAA 2H8EA 2NAFA 4JT2A 2JAPA 2AHRA 1RDFA 4LY6A 1W87A 3L79A 4L6CA 4E2XA 1UQUA 5KSZA 1NBMA 1ZZEA 3X2QC 4HAZA 1GDTA 2Z04A 5FPSA 4IFTA 2ZWIA 3GPCA 4IV5A 4NFHA 5DGTA 4WEOA 2KG7A 5KPDA 1KJ8A 4HZUB 3LP5A 1K34A 2Q4OA 1EVJA 1YA6A 4J0EA 4G1MB 3LVQE 2JVJA 5C51B 2O2XA 2J59A 2FJUA 2FYTA 1Z6TA 4ZVTA 2OECA 2HYDA 3N76A 4CM8B 2X0JA 1JSRA 3RRFA 3LUDA 4ZHSA 1RKUA 2HA4A 3AY0A 5ALHA 4O8CA 1VKHA 3E7WA 3GLIB 5CW2A 2GUZB 1Q12A 1XAGA 4HVLA 2HM7A 2PRKA 1DXQA 2UV8A 4WCEV 3FUWA 2C97A 2GEUA 3D4NA 4RQOA 5LKRA 1JWAB 4ERNA 1VTKA 3HV2A 2RJOA 3FVVA 3BMQA 1QRTA 1OREA 2C20A 5BP7A 3CGGA 4RXUA 1QC5B 3EEIA 1U5BA 3INNA 3MINB 3ZI0A 4I3FA 1A9TA 4M3NA 1H4QA 1QHSA 1RBMA 3TZCA 3GVMA 4JSTA 4J1QA 1T6BY 1BWQA 3C41J 1H8EG 5REQA 2RGWA 1DWUA 1MB2A 1P6UA 3DFKA 2W83A 3IE1A 4TSFD 1K7CA 4POAA 2I22A 1RMYA 2PDAA 1QO7A 3ZD7A 1MABB 1ORHA 1V6CA 5IPFA 4UCUA 2V03A 1K4DC 2JJ2A 2HIGA 4PYOA 1SQSA 4GKAA 2P9CA 1I5OA 1CS0B 1E9AA 3ESYA 2OCDA 1WCYA 1C30A 1UXKA 1USWA 5FUWA 4D6TH 5HILA 4OQFA 5KREA 1UFOA 2GWHA 1R8SA 4LNAA 4QFCA 1U99A 4M88A 2HF7A 1O5TA 1QYDA 2XDQA 4D5GA 3KIPA 4LW8A 2POCA 5K3FB 3X1ZA 5EFZA 3OZAA 4X6LA 4P38A 3E3MA 1N2ZA 4JT9A 4M1MA 2KHZA 3H9GA 2ZBUA 1LLQA 5JD3A 5A9TA 3V7QA 4UNPA 1VKOA 5FO1A 3FVRA 1KVRA 2GBLA 2QQ5A 4EMBA 1K0FA 4DNXA 3TFWA 2F3QA 1AH2A 2JS3A 1U3TA 1N0JA 1NJ5A 3BD9A 4O2AF 4BUCA 3I34X 4KE7A 1YOBA 2IBZH 2WWIA 4YCAA 4LOIA 5B58C 2WHYA 3K0BA 2J3QA 5ELXA 4LRWA 3KTOA 2QRUA 2BUBA 2HO5A 4LF5O 3AVOA 2K7ZA 3LS2A 3I4FA 4NV3A 1UCFA 3UAGA 3TPFA 3LK7A 3TZHA 3X0DA 1VQ8F 2Z8XA 5DGHA 1AXRA 5LDDC 2Q9UA 2QUAA 3VNAA 5BV1A 1QHHA 4BB9A 3D0OA 4US0R 2FWIA 1T9ZA 2ONKA 4RZSA 4Q7EA 4RDIA 3GLRA 1CU1A 1KI6A 3AG7A 5K2MA 4LF5B 4LHEA 3MFYA 4KO2S 2QF7A 4WF9V 1PLLA 4KK4A 2RHHA 4W1QA 3LO8A 5JARA 1DEHA 4FDTA 3ABRB 3FOZA 4QAJA 2R60A 3WKDA 1J2RA 5EKUA 1J39A 3E1GA 4DARA 4W7SA 5AESA 4BV2A 5TS3A 1G60A 5IXSA 1SC1A 3OCWA 4Q12A 3LPNA 1CEXA 1TTHA 2IU6A 3L43A 4AS1A 1FNKA 2AI3A 2RGBA 5C53B 1FFAA 3AR8A 1LPOA 2WVAA 4II2A 4AWBA 2J9GA 3CEPB 3PHIA 1XPJA 1KC3A 1M73E 4B47A 2I4TA 1WB9A 1JAYA 3TNLA 2ZQYA 1BMFG 1P6QA 1OFIA 3OBWA 1X3LA 2XUKA 4Y1RA 2XA1A 3OIGA 1XTIA 3NJ4A 4JYBA 3VR5A 4NDAA 4IDOA 2OORC 3RJMA 1HYBA 1Y1QA 1Y4DE 4XQGA 2IBTA 2LCAA 4DMHA 3O4FA 2PS3A 2QMQA 3N2LA 3GJTA 1EFVA 1IK6A 2GO7A 3WKEA 1BVHA 3KS9A 1T1RA 2R9VA 1E6EA 2A0FA 4DXDA 1VGVA 5A71A 1SCQA 4JFRA 5JAMA 4M7PA 1Z2EA 4N6OA 3HVHA 2HQOA 1L5WA 2VT2A 3GIWA 3RWRD 5CFLA 5I5GA 3QELB 3NB0A 3QX8A 2ILMA 2IPAB 3A3PA 3CRRA 3OPYB 3DAGA 4U7FA 3W8EA 4EG3A 1O57A 1QGUB 3K0GA 2PL9A 3JWHA 1MOQA 2CGEA 4KO3S 1T3SA 4HC4A 1JPJA 2Z5VA 4FYYA 5DWQA 2QMYA 3HB3B 2R7MA 2QMOA 1KYOF 1PCXA 1H23A 3UK0A 1FXSA 4M76B 4RFVA 4TS4A 1EG2A 1K7DA 5J5CA 4DUZO 4FX5A 4AMYA 2FW7A 2H4JA 4WZAE 2BFAA 3G2NA 3ZUGA 2EP7A 3H5OA 3O9ZA 1NAHA 1Z2OX 4AILC 2O3UA 2NZVG 1OZFA 3SXJA 3Q7QA 4Z51A 5GZ1A 3AQ4A 4DZTA 5FV4A 2J3JA 2V7VA 4RWUA 4MGEA 1VSUA 4MS4A 1EX7A 4OXYA 4TMKA 2YFHA 4YJKA 2YNMA 3CCRV 2AMYA 3BTVA 1FPQA 5L9AA 3GZNB 1VQLF 1FFXA 3SBOA 1G5TA 1YRBA 2JFWA 1UBJS 1OTYA 2BFOA 3UJBA 1C0LA 3ZDXB 3RSFA 2O19A 4X24A 1MV5A 2H31A 3I1JA 2QVGA 2PFSA 2PSDA 1DEAA 4WV3A 2JKYA 4BV8A 3OEEA 3ZV3A 3O8LA 5BPHA 3JD2A 2WYWA 4BT2A 2VYFA 3DWGA 2IJKA 3FOBA 3EUFA 2ZATA 5GJWC 3FPFA 2FPLA 2OAEA 4LZJA 1FMJA 4A26A 4PICA 2FFBA 1UC8A 3RUEA 4NXMO 2BGGA 1TXGA 4PV1B 1F17A 3ASYA 4ZO7A 4WTOA 1E6WA 3Q9SA 2ATXA 3LXRA 3U4QA 3SYQA 4I4NA 1Z5NA 3A11A 3I45A 2G08A 3L7MA 1K6MA 1T0AA 5IBQA 6ABPA 1Z5ZA 1R0BA 3AG2C 4ZK7A 1NW4A 4LR3A 3H1LH 1BE3H 3GCDA 5EYPB 2OQRA 1GUFA 3TJMA 2J0UA 3GVXA 2P9GA 4NXMB 3IJRA 3CP1A 4LBZA 3AG3B 1E61A 4FBLA 5DM1A 3DKKA 2AFHB 1N0WA 1UAGA 1UC4B 2F3UA 4MVJA 2A0UA 3MQFA 1CTQA 5ESRA 2HRDA 1TUIA 5BUSA 5I8WA 2P8JA 2W6OA 4UTPA 1WPRA 4DXWA 1C4WA 1YQWA 3MILA 1QUFA 1H2YA 2BR3A 4ESVA 5HKLA 1KJ9A 3EIHA 5EQFA 1LVGA 4EJ6A 3NVKE 4W1SA 2DOSA 1N8RH 3GRAA 1FP2A 2V0CA 4GCZA 1YZFA 3PPWA 4QT4A 3HB1A 4K03A 3H1KH 1XLTA 3BERA 2IVFA 4JV5B 4ZQIA 1FRQA 5DGDA 5CU7A 1NLUA 3HU3A 3DVQX 2OFPA 3FNIA 2QRLA 4DJFC 1XZAA 4NTXA 5J2UB 1L1FA 2YN2A 3PNOA 1ZI6A 4BQOA 5E9JA 2HS0A 4B79A 2WFLB 4FZRA 2C9MA 3QBTA 4RQAA 3PTLA 1T2VA 4J2OA 1QG2A 4BVSA 2XUAA 1UDRA 1OSNA 2FK7A 2I4LA 4C05A 3GDWA 2JASA 1GLGA 1L7RA 1OZGA 1ZHHA 4F97A 1FQWA 3KOZA 4RUFA 2P0YA 2PAFA 3TS1A 3S70A 1QIMA 3VVBA 2AHOA 4OUDB 2DWPA 2DUNA 2VJBA 1FZQA 3QHAA 4B73A 4C3ZA 2CMDA 1PDWA 1CG6A 3P4EA 3B6ZA 2YXNA 4K9OA 1RS0A 3ASNC 1UP4A 2JJ1A 3TLEA 2AN4A 4GVLA 4ZIRA 4NBWA 4TYYA 2XDYA 2ADPA 2A1UA 3UEOA 3LYLA 5HCNA 4JA2A 3AZPA 1U63A 5AVOA 2YV1A 5A3QA 2RBKA 1NZJA 3CUTA 3CXRA 1U0NA 1BXRB 1ZH2A 1DGSA 1EM8A 3NKVA 4N0QA 2ZRQA 1XNRO 4CODB 2QPAA 1I94O 4KN9S 3BHIA 3M5CA 8LDHA 1KZYC 4QDJA 1U1DA 2ZXUA 2PQ0A 4JI4B 2HHCA 2HYIC 1Y74A 3N39C 4HLQB 1EFAA 5EJ9A 3OEWA 1J42A 1K08A 3WLOA 3HBLA 4P58A 1T3HA 2YYAA 1A7KA 4XQ9A 4P9NA 3ORSA 2C0PA 3BDIA 5I9MA 4E09A 4I3GA 4ZVKA 4OF4A 4Z7QB 4GKVA 3DXXA 4NV0A 3S0JA 2CNLA 2BHTA 5CYPA 3LCUA 2PYLA 2UVPA 3KQPA 4IX1A 3NGLA 4RQFA 2HU8A 4G36A 1ULTA 2W43A 3V4SA 4NZMA 4PR3A 3GHYA 2PLAA 3FDZA 1V1MA 2ZSKA 2YJNA 3C7AA 3K09C 5AXCA 4TQGA 2Z3ZA 2GEJA 3NETA 1JYSA 3OT4A 4FHEA 1DWPA 2XNSA 4MPTA 1L5ZA 5HWSA 3TD3A 1V11A 1CR0A 4YWHA 1Q7BA 4TZZA 1YAJA 3WIDA 4NPHA 4F5DA 1VKZA 2CHSA 4TV9F 1W8DA 3COSA 2JGMA 3CW8X 3WGJA 3T35A 1MJNA 1JKMA 3LYUA 2ZIFA 1KRXA 1VPVA 4WECA 4WNAA 4MRAA 4AJOA 1I6LA 4QDUA 5DX8A 3RAGA 1YJNF 1YRLA 5CBPA 1Z5PA 3N2GA 2Y93A 2G06A 3VQWA 2IYYA 3VMFA 1KJNA 5T4BA 1Z0IA 2IQIA 1OB2A 5L3DA 3W5UA 4E1BA 4AUKA 3E2MA 4E6PA 5BR8O 1YDEA 3H5NA 1A0OA 2O8BB 3JVDA 1RVV1 3UOWA 3B2NA 3V1KA 1MO4A 3ZDEA 1AROP 1EG7A 1EDZA 5IM5A 3WYEA 3RHZA 3K9FC 3QUTA 5T4FA 5DF1A 3Q8LA 2JAOA 4BO2A 1EXVA 2HADA 1XO1A 3EXEB 3PFKA 2A9KA 3DSRA 2AOTB 1AKYA 3ZU6A 2D13A 2D1FA 3UB4A 2OHHA 1Q1EA 3ZYZA 5BR8B 3JZDA 2QTOA 2QVCA 3NVIB 1VC2A 3OM3B 5HOQA 1OKKA 3OURA 4LQ4A 4U7DA 4HO1X 4Q6GA 1A8HA 5FAKA 4A0HA 1NQVA 2TYSB 4P7KA 2XKKA 4HDKA 4PRKA 1W40A 3ILHA 3KSRA 4MB6A 4TVKA 3OLCX 4A3SA 1OCEA 1E69A 1F8YA 4DEYA 1TRHA 2O4CA 2FW0A 2P0EA 4GGPA 1O96A 1G20E 2O7VA 4HUJA 3O8OB 1Y1TA 3CQ9A 3UT5B 1HYEA 2ZRPA 3NHAA 3RANA 1BS3A 1K27A 5AI0A 1XMJA 1TAQA 2Q3LA 3W5JA 1GZ0A 3EF0A 3WADA 4FLXA 1V54C 2QTWB 1DCMA 1DBPA 3RM3A 1KIFA 3UJAA 3K05A 5EESA 2OCAA 1VQ6F 1QO0D 2Q5HA 4BNWA 4GLLA 4EO7A 3RYFB 5JEDA 3E82A 2ZBRA 5KNBA 3K0FB 4I9UA 1DJLA 1PP9H 2JZCA 3CCJF 4NH0A 2OTJV 3HBMA 2VGNA 3R5TA 1M8GA 5BQPA 2Y6UA 2GK6A 2H2GA 4BO9A 2B5WA 3LX8A 4QUBA 3H2ZA 5CNIA 3H9CA 2FFAA 3K5NA 4UXJA 3S2EA 2P5OA 1PV4A 4Y9SA 2OLKA 4OP3A 4EB0A 1T5SA 4BO8A 3EB9A 1N0IA 2IU0A 2PNFA 2ZEJA 2OTMA 1QOQB 4IKPA 1XKTA 3JD3A 4GH5A 5EQDA 4Z7NB 5AYVA 3AB8A 3OPXA 2A57A 2C3PA 2H65A 4NK5A 4TKUA 4KVGA 3KQSA 3BMNB 4RESA 2ADOA 3A6GA 2C7BA 3O9MA 4N40A 1E5XA 1B73A 1NMSA 3T5PA 2IZZA 2GSWA 3G80A 2ZWPA 4JOCA 4NS4A 4BAGA 4FEGA 5C8XA 4AKSA 2VEDA 3KFLA 3F2IA 3ADPA 2H7XA 1A9YA 1NF9A 4JBGA 2A5JA 3DOUA 1GFZA 4DSAA 4A15A 3EVGA 4GYJA 4L4XA 3FPIA 4GR9A 1RD4A 3OEHG 4D4HA 1QDLB 3AM3A 5TJ9A 1GQ2A 1PUXA 3ZCSA 4K28A 2Z3YA 4G0ZA 3AI7A 3R8CA 5DXJA 4NQRA 3RYCA 4E5NA 1K6IA 3C70A 3W3AH 1Y4SA 1VQMV 3QBDA 4HWTA 2R7AA 1N7HA 1L2TA 5IJ9B 1CUUA 4DDHA 2FKNA 5CFZA 2VWQA 4OQQA 4AZTA 1PFVA 4LDZA 4TGLA 4YP7A 5KYTA 1G8PA 4ZDIA 2Y69C 3IUMA 4DV4B 1MRZA 4XB2A 4E1AA 5E1OA 4C78A 1OLUA 5ADHA 1EFPB 4E32A 1XCMA 1R0LA 1ZWKA 3ZGLA 2ZR9A 1AN9A 3NP9A 4MIEA 3WBKA 4KVFA 1C1XA 4BFLA 4Y9RA 2V65A 4IMPA 3THYB 2CSUA 4GMGA 2IQQA 1QK5A 3AILA 4ER6A 3KIZA 2YWXA 1J0CA 5KQSA 2UKDA 4B80A 4ALKA 4Z4IA 1WLEA 1WSDA 1K86A 3VJKA 2OHJA 1CXZA 2BFCB 4LX0A 4UTZA 1ZMRA 1BC5A 1EESA 2QRHA 3CMEV 1XQWA 1MVLA 2Q4EA 2WLMA 3BC1A 1C3VA 4RY2A 4PFJA 3G8CA 1ZD4A 2QE7D 2AB0A 2AW3A 1H48A 1JPUA 1XU9A 2PGGA 5LA6B 3HYCA 5F76A 1GUYA 1XD2A 5CM8B 5TPWB 5K20A 1ZRNA 5B1AC 3IEUA 2IHKA 3EVCA 1VOTA 1XTJA 4CFZA 4FJCC 5G41A 2OV4A 3F8WA 3F8TA 2CB0A 2D0OB 2VHXA 4XLLA 5JI3E 3RK0A 2QMUA 2R8XA 5ADUS 1PZHA 2H1IA 3PK0A 1G21B 4Y6OA 5BNTA 4G37A 2V54A 5A2GA 1Q3HA 1XEXB 3B1YA 4KO8A 1ODIA 3UYLA 3KG2A 3G85A 3QPUA 1KBHA 4D8XA 3ROMA 2Q9CA 6PFKA 4BWFB 1ZDMA 3STZC 2BF7A 3SX0A 5IHXA 1CJUC 4ZOAA 3IPAA 4I9GA 1IQRA 3T95A 4QJ5A 4IJKA 1U9JA 5FTNA 4AF8A 3PUZA 4IIGA 1IQ0A 4M6WB 4PLCA 3DDWA 3EDQA 4JVNA 5LGNA 4F04A 4OV6B 1U28C 1SKYE 1YQXA 3E70C 4RFSA 4ZCPA 3WJ2A 1U0HC 3GX1A 4LWQA 1RWOA 3N2ZB 1N9GA 2RH4A 5CURA 4OB6A 2A4MA 2F90A 4X9QA 1QS0B 2E4WA 1USVA 2LPMA 2V74B 4MAAA 5J2TA 3HCAA 2HL6A 3C3EA 3SHTA 3JQBC 4P4LA 3OOSA 4JQOA 2QY6A 2C5LA 1JHRA 2W2KA 4DM7A 3RE3A 3NRCA 1F20A 4RK0A 1DBFA 1JRLA 3LDEA 4HCJA 1PUIA 1FNJA 2O2EA 4ZCIA 3RYIB 2WJJA 2LWIA 4HYEA 3JRWA 3QVLA 3TLXA 4RHAA 3SC3A 3E9DA 5B1EA 4FNOA 5J4YA 3UMCA 4C3OB 1CY7A 4Y2RA 3QFCA 2XT6A 3J81M 1DMRA 1YOVB 1ZN8A 4Y2VA 1SWVA 1P0FA 1E2MA 4N3NA 4QNMA 1VLMA 3OEYA 4I6GA 2ONCA 2DHQA 2X5NA 3ONWA 4KXLA 2NUPA 4MOWA 3TW8A 3K5WA 1H22A 4OQNA 5C7LO 2GN6A 1NJIH 3OJWA 3GWOA 2J41A 3ADCA 3SS7X 3EVFA 2RJZA 2DH6A 2QZZA 2PKYX 2IM9A 4UVCA 121PA 1O95C 3T1HO 2OT3B 3DHWC 3ZLBA 5EBLC 1ADGA 1J4AA 3N6VA 5LZ9A 3R5XA 1X7PA 4NOLA 3HL0A 3WFIA 4QRIA 1NZDA 3OTIA 4PO8A 2RH9B 4C0WA 2NO0A 1M1NB 4JUBA 3N0WA 1CBUA 2ZSDA 1G3RA 2AJLI 1KZ1A 4HQFA 1CUCA 1VKNA 4NJMB 1QLNA 5IT9M 2CHQA 1R4NB 3WAKA 2WFMA 2QX6A 4KZPA 2FRVA 1XHOA 2WYHA 2FCRA 1KZ6A 2XRFA 4WLVA 4A7PA 2XUQA 2YC2C 4WCFC 2L0XA 3DQPA 3OIWA 3IPLA 5EGNA 2I8AA 5FLXM 1QR2A 2C9BA 2HBQA 1WB5A 3GVHA 3RS9A 4RTSA 2CEAA 1WNTA 3FHLA 1U2TA 2JI4A 2P35A 4AICA 2EFEB 1UADA 3PXDA 2EJRA 3HU5A 2HV8A 5EXPA 3F7OA 2F00A 4EKNB 2QGFA 4EH1A 3QTCA 2ZAMA 1KYYA 3U7FB 2BHLA 5AJWA 4KIWA 3LWVC 2DHRA 4JYCA 4LF4B 4WFJA 3WLSA 4KLRA 3KEMA 2QAGA 3QTTA 4L8YA 1GAJA 3KPVA 3TQSA 4O4IF 3UCFA 4LV5B 5K1XA 1IN8A 3TLKA 1WNSA 4J7KA 4BJ1A 4ONEA 2OAGA 3WGUA 4TN5A 4UUQA 3HJFA 3UB3A 3COWA 1KSGA 4Z7JA 2W58A 1KS2A 2GF9A 3GAAA 2HUNA 2EQ5A 5DBIA 3NASA 1X7HA 5L3QA 5AVMA 4R83A 2V6JA 5DM4A 2ZWAA 4INPA 5M5BA 2C2OA 3E3AA 1O8CA 4K88A 4AJ1A 4UVBA 2HP0B 3C74A 3IXQA 3NM6B 3KQLA 3GPIA 3UO2A 2JA2A 3L8YA 1NWHA 4ZZ3A 2R8RA 4YCDA 5KHOC 4PHGA 1A4RA 4O2LA 1AK1A 3WDKA 1E8MA 2C8KA 3GBVA 2BW0A 3H13A 2IUUA 1G64A 5AR1A 2VPYA 3TLGA 1QFJA 1OIVA 4ILEA 4X88A 2O5RA 3CCVF 3MTBA 2NU7B 4BJ3A 2XKAA 1MO2A 4V24A 1BE8A 2VSOA 3HSYA 1H2AS 2X4GA 3ZHXA 4OGLA 5IYDO 2E82A 3VYRB 1E79D 3TVDA 1YJ8A 2AC4A 4FQ7A 3ZN2A 1AKRA 3T3OA 5JDIC 1VSBA 4YX9A 1STOA 1S2NA 1PO7A 3PSHA 5JO9A 4ABYA 4C4ZA 4M0UA 3TNFA 4X66O 3UBMA 5CFQA 1HTTA 4KI7A 2BHNA 1PNMA 2NNWB 2IOHA 1OLXB 4GXRA 3PGVA 4YHHO 1C9YA 1GZ6A 1JDVA 2R48A 3G67A 5FH9A 1WA5A 2RGCA 1GNQA 3L6BA 3NAGA 3T7DA 3O1IC 1Q1AA 2VTVA 3A9UA 5CLFA 1CZRA 3N8HA 3OICA 4JTCB 3A2FA 3MJFA 4ND6A 4DCMA 3ZBTA 4QFDA 4K6OA 3EGEA 4EPRA 5GANK 1ZX3A 1B6RA 3P9KA 1DRJA 1AQUA 4QG3A 4NECA 1GRJA 2PL1A 2QA5A 4YJFB 4AZ0B 2QRQA 3V8RA 4EMSA 3UG6A 3WGKA 1I30A 5GZ3A 1Y5MA 1E2FA 5F3DA 5IX8A 2QJOA 4YJ3A 4BMSA 1PNKA 1TX4B 1U7ZA 3R3YA 3ZD6A 2PUJA 2HRBA 3JQQA 2A94A 3GROA 1IPHA 4NF2A 5MFPA 1NX6A 3K04A 1W94A 2GGSA 3K71B 4A8JB 3CIFA 1BHSA 1YACA 2X7RB 3C8DA 1QRAA 3OMLA 1C0PA 5AJTA 5EXSA 2YWFA 5B30A 2CXRA 3VR1A 1I2CA 2NGRA 1AD2A 2JPDA 2BEUA 4J7UA 3O73A 1P1IA 4L02A 2HBZA 1XZ8A 4UCWA 1VE3A 1E3WB 3KKPA 2H1CA 3QKTA 4Y2PA 2RKWA 2KPOA 4UU0A 2GHQA 5KTNA 3UNXA 3PWZA 3ID6C 2YW2A 4MINA 3WLRA 2PVCA 4YO7A 3TR6A 1XZJA 2O7QA 4Y6RA 5FQNA 3TAHA 3CO0S 3DKIA 4G63A 4X7MA 1P80A 4XUDA 3F6RA 5LA6F 4LS3A 4M1SA 3VI6A 3KQYA 4BO4A 1M2WA 3DG9A 3UAXA 3FBTA 5HS4A 3WKCA 3IUPA 4EGFA 4YLGA 2AXNA 3STTA 3EEBA 1VQ7F 2B1QA 2JIOA 2XXAA 1G2QA 1G7TA 2GHRA 1BL8A 3RIXA 1K06A 9MHTA 5K4HA 4Y7DA 3SYNA 3CVJA 2IJHA 4BX8A 3S2YA 2GK3A 5JXHA 1XJWA 1IVYA 4M7RA 1CR4A 4M1TA 2HJRA 4DR5B 2HWKA 2Y76A 3SR3A 1IWOA 2BEWB 3LOUA 3T5BA 4Y1GA 1H2EA 4QXPA 2ZJ6A 4W6ZA 4R6WA 1ZHFA 1AZSC 3LWDA 3K3WA 1IATA 3R7WB 1UKBA 4ARUA 2W6IG 4INAA 3DM5A 2XVMA 4X54A 2XECA 1NQOA 1KE2A 2XE7A 3RVZA 3ZCUA 2UZIR 3KEFA 3A2MA 2O2ZA 1SCDA 3O65A 1SC4A 3R3WA 1ZUNA 5AVTA 4XDKA 4CS2A 2OGTA 5B2FA 1BQ0A 1DGQA 3CH5A 1VYUA 2XJ4A 3Q2IA 1B93A 3IUSA 4BCDA 1YR9A 2PZJA 1GIAA 3ZY3A 2HO4A 2EIMB 4GZRB 3AU9A 5FL3A 1FOEB 4I08A 3R23A 3OKFA 2HQBA 3MT8A 1O94C 5F64A 1OX5A 3UGJA 4ZANA 2HF2A 3GYGA 3AUJB 4OK3A 3M1XA 4DA9A 3MD9A 4FR5A 4K8XA 1FNBA 4KYTA 4WY2A 1QIGA 2QYSA 3SJAA 4F9EA 3L8EA 4A9AA 2W6PA 5G0TA 621PA 1H05A 3MG9A 4A0FA 2JG3A 1O95D 3UMVA 1ORQC 2RONA 3FKSD 3THWA 4EFMA 5DLEA 4QO8A 4DLSA 4LC9A 3H2GA 2QRNA 1HFWA 1LPPA 4RVUA 2BFBA 3MOIA 2W0XA 3N86A 3EORA 5E3HA 2ZVZA 1Q7EA 4GZLA 2HA5A 3LHSA 3DOEA 4EHDA 1KOJA 4U7PB 1SKVA 1QZTA 3EWSA 3OWHA 4AULA 4RHYA 3TINA 5E2IA 2LW7A 4RTJA 1E2KA 1GOTA 3GD5A 5HBRA 4Z1MD 3B1XA 5BN5B 2HWXA 3DEYX 2IJGX 5L3SB 2FPIB 1JX6A 1U3GA 3HFSA 4DSUA 3M81A 3MNFA 1GCIA 3KTDA 3FPCA 1RXSA 2L42A 2HIHA 2O5EA 5EY5B 2ZUVA 5K8TA 1UJ2A 3IFSA 5ALRA 2GA8A 4P3OA 3BL8A 3RARA 1IXZA 3VUEA 4IJVA 1SCKA 5IDJA 1J8MF 4FFLA 1FXWA 5IKPA 4NWIA 4LF6B 3R4VA 4WT7A 2GEDA 1WR8A 3IT0A 2QV7A 4MVQA 1PN3A 3WOVA 4MWZA 5EMNA 1XD9A 3QWIA 3O3CA 1EYZA 2CVOA 2G5PA 1TU4A 4E2FA 4DIOA 1N2IA 4M53A 3K1AB 2TECE 1HE3A 3RIYA 4WOPA 4G8BA 5BQFA 2GPSA 4DJJA 4ZC1A 2AOUB 4G0MA 4RVHA 1W581 1K98A 5JD4A 1T2NA 1Z82A 1V8PA 2CH7A 2YCBA 5BSVA 1BXZA 4KLAA 4QE9A 2WAOA 1MNQA 3I6IA 1FTQA 5D3KA 1NWCA 1FU7A 1XZDA 5TLSA 4BMYA 4GOXA 1S2LA 3UT0A 2MSLA 3M6IA 4MNTA 3V9PA 2I1VB 3RT7A 2DR3A 2CNDA 1YDMA 2GRJA 1US8A 2EP5A 3VQVA 5EZQA 3USZA 1DQRA 2AN9A 2EHJA 5T3UA 5A06A 1XAHA 5DYTA 2I6RA 3H42B 5H59A 2BTUA 3C3JA 2PKQP 4ALJA 1MUUA 1WLYA 1DDGA 2Z30A 3SNHA 4ENQA 5EVCA 4WOKA 2OG1A 3F0EA 3QE2A 3T8YA 4DAEA 1EZVH 1YB7A 4FFMA 3ZK9A 5FB3A 3FLBA 2QWNB 4XE5A 1A4XA 1BHQ1 1Q7CA 3RLFA 2HJHA 5DXFA 1Y63A 2HU2A 4IEIA 1PXWA 5HZGA 1ZD2P 3AF0A 3GFSA 4DQLA 3CMAF 4MHOA 2AZMA 4B3CA 4IZ6A 1Q91A 3HXOA 4XIIA 3AH8A 3I01M 2EIKC 5FPYA 4Q3AA 4OYHA 3HDTA 3RCBA 4B4WA 4URFA 2BFMA 2HA6A 3RKUA 1BGYH 1PK7A 1VQVA 2V9YA 2YI8A 4O59O 2FSPA 1PZNA 5CDUA 1V55B 2PBRA 4JP5A 3W90A 2AQ8A 5LSAA 1XCLA 2AFIA 3P9SA 1PJ2A 1DXYA 4FQ8A 2OCLA 3S1AA 3GDFA 2QTVA 4IFEA 3WTCA 5H5NA 3EC7A 3ZDFA 1EE1A 2B7BA 2A30A 2ICAA 1QOPB 2CK3G 3O3MB 4MA0A 3RGBA 4I50A 1C1HA 4K35A 4KBGA 1A5ZA 4EUHA 1CUBA 3SF0A 4YHBA 1BQEA 1Z4PX 2HVJC 2W8BB 4RVCA 2ALJA 3FX2A 2CFOA 5IYCO 3I7TA 2Q0HA 1EJ6A 3R6LA 5THKA 3W5BA 4JA0A 1KAHA 3ZY5A 4E3WA 2NZJA 1ZISA 3NKLA 2N3ZA 1W57A 2ZVPX 5CBFA 3BHJA 1Y6XA 3LFUA 2NU8B 4UV9A 1ZUWA 4D25A 3K6SB 3I09A 3PGXA 1IOWA 2XH8A 2ZOSA 5FWXA 3F5FA 3S5JA 4D6XA 1PGOA 3AGPA 3JZAA 5TARA 4O4HA 1XYYA 5B53A 3CCMF 1YITF 1NSFA 2Q73A 2XZOA 1M6VA 1PHRA 5BSWA 3VQYA 3AUTA 4JASA 1RPOA 1GYQA 1P1KA 3DAFA 3A3OA 3COPA 3B6MA 2PZEA 2FDCA 5CB4F 2DWQA 1EVLA 2YHIB 3HNOA 1QB8A 2H2FA 3O82A 2FX3A 5CR9A 1Y7HA 4MW2A 3DTUB 1DRWA 2PT7A 4N7BA 2O5VA 2PWZA 4N21A 1CY4A 5K8IA 1RZRA 2QAJA 3O3OB 3WIVA 2EJVA 1EZZA 3QKRA 4NBRA 3KQQA 3TRDA 3RS0A 2P6JA 3MTAA 3UJDA 5KTPA 4AMVA 1RTKA 1GEGA 4XDYA 2OQVA 3CC4V 2R8EA 1AQIA 2E2WA 2K1SA 1E4EA 1XRPA 2HXGA 3OMAB 2NN4A 5HVNA 1P1BA 3FUXA 1Y3HA 4C6RA 3RS4A 3FNQA 1DMSA 3D4LA 1J70A 3CUKA 1XTTA 1NXXA 4C06A 1ISPA 1TW2A 1Z06A 4OKSA 3FKQA 1SGWA 3MT0A 2QB5A 4NBNA 2PWAA 4YRTA 2O5CA 1YA8A 4IXNA 4Y18A 1J0BA 4W5HA 4YJGB 5DP2A 1IHDA 1UZLA 1GDDA 1T0IA 3ERNA 1Z8DA 1ZD9A 1BCCH 1ETHA 4MUXA 2NW6A 2ZJ0A 2WF6A 3RC1A 1R0RE 3UQ8A 1KPHA 5E9AA 4B82A 4TZTA 1ABEA 4JMLA 4MS3A 2EILB 4ASUA 2D6FA 4FBMA 4CR7A 1GKLA 3I52A 3HRHA 2HF8A 1J56A 3IL2A 2GJKA 3PWTA 1YR2A 1US6A 1EFDN 1XL0A 3S2FA 1UMBA 1SRRA 4X8HA 1TPYA 4PC3A 3B60A 4S2UA 4RDXA 5JS6A 1X7XB 3K9LA 2LRHA 3G4SV 1SZPA 3LUCA 1SC3A 1QVFF 1N92A 2ZRIA 2YS7A 1U3WA 1O94D 4ZMBA 5DU2A 3CCSF 4RLHA 3HTXA 4LYAA 2HUPA 4XVRA 1R10A 4JVMA 1NMZA 1BGVA 1HZJA 2J30A 4ND7A 4F12A 4IHJF 4OREX 4X90A 1A1VA 4LMBA 5KYUA 1CRLA 3N2KB 4PPGA 2IYFA 4R2JA 1Q86H 3O84A 3GEIA 3S1LA 1FSSA 2EQBA 4QUAA 1Q7YH 5H9CA 1Y8ZA 4RVGA 4TTTS 5JATA 5BRNA 3WAJA 3C1AA 5TC4A 5LL6Y 3SYKA 1ZIYA 2XCQA 1VI2A 3N74A 3R5KA 3A1NA 2VQEO 3A6LA 1IHUA 4U7GA 2F1KA 2IYPA 3FD6A 4M1EA 4U8HA 5IT4A 4WK0B 2QLBA 3FYDA 3GGOA 4WBXC 1WX1A 5HDBB 3PUHA 1T3LA 1NTZH 1C8KA 2XTMA 7REQB 1B23P 1W35A 2C42A 2Q0OC 1J0XO 1A9OA 1GYPA 3B2EA 4RETA 5E7JA 5C7OO 1J06A 1YULA 4KHPO 3KZVA 4EFNA 1B2RA 3LLVA 2VJNA 3UIEA 4QPJC 1Y6JA 1Y82A 1IRXA 1DS6A 3A0RB 3ZVRA 3HNRA 1IY0A 4UM9B 3ABUA 2UYYA 3VC2A 2BFEA 2PSHA 3MCUA 3PHGA 3HA5A 4QYIA 2EOAA 1SVOA 2CDAA 2J6BA 1DHRA 1R3DA 4TV9B 3RU3A 5BW6B 3R7DA 2VDKB 3HDGA 3WL3A 1M90H 2E5WA 2P41A 3PKZA 1VXOA 4M0PA 4J3JA 5I01A 4R0VA 4D8YA 4TUYA 3WDMA 3IUYA 4CPDA 4B32A 4AD8A 3U62A 4WINA 2BFDA 3ESRA 2ZBVA 1RE0A 3IBYA 2OXRA 4GYKA 1B3QA 3JAMN 1T5LA 3UK6A 3N0XA 1D2HA 1R5NA 1XQXA 1SC5B 3EH2A 4CTNA 1NOIA 1C8BA 4Q9JA 1EFRD 3A1UA 2Q9LA 2C77A 1U0EA 3AM5A 1F48A 5K01A 3FB4A 3QVVA 3HKCB 2JFVA 5BW5A 1GPH1 2I7DA 2ZKIA 4PCUA 3BIWA 4DW0A 1YJ9V 3CLVA 3P5SA 2OTLV 3MTDA 4U2BA 3IC7A 5ICGA 5FT9A 4WBSA 2P7TC 4RULA 4M8NE 1PX2A 5EBWC 2F4VO 1V5GA 1Q2UA 3NHZA 4WLNA 1OCCC 2RB4A 5JCOC 1L7MA 1LK0A 4N48A 1Y34E 5K8JB 2ZB4A 3OJXA 4BNLA 3ZC3A 1T24A 3FPEA 4QU0A 3IRUA 1DG1G 3ET4A 1JX9A 3KZKA 5FOSA 1GM9A 1E5DA 1GK9A 3DBOB 1S8NA 3PHCA 2ZG6A 3OZGA 2FN7A 3PZRA 3EXHA 4GECA 2H7VA 3GT7A 3AYXB 1GUAA 3GLFE 3PEFA 4B7AA 4TYWA 3WB0A 3D5EA 3QFTA 3R9XB 3G23A 3LQ4A 2GWRA 1ZVJA 1N33O 3UHFA 2GBOA 4PANA 3BH7A 1E59A 4O3MA 5IBRA 4L8LA 4L6AA 2P5UA 1E5LA 2WD8A 3MOSA 4L9WA 4F38A 5FBVB 1E3MA 1PW5A 2OZKA 4RF5A 1D03A 3KOXA 4AJNA 1I10A 4BT3A 4R1LA 3Q4HA 2FQQA 2JH3A 1QU2A 4YMIA 2QW8A 1E63A 4KX3A 1B4DA 3T94A 4DUZB 1FFEA 3IE2A 1GGHA 3BWXA 1N33B 1NATA 2QROA 1NJFA 5LIPA 1HK7A 4YLYA 4REOA 3QX7A 2AEEA 1MBZA 3FGNA 4PRYA 3U3ZA 3U7HB 5CM9C 3SS9X 3HJWC 5AHRA 3JPYA 3KXIA 1YVEI 3ZXSA 3A0BZ 3LPDA 4DPMA 1R5BA 1NNLA 2AZXA 4D26A 4P80A 2XHZA 2ODMA 4LFCO 3ZIAG 3WRYA 3EXFA 4KITB 3E18A 3IODA 4DCSA 5DTEA 5CDSA 3PB3A 4RMJA 4YP6A 3HR0A 1M56C 1K8AH 4P8RA 2ETNA 3U4CA 2BJWA 4DB4A 3IEQA 4B45A 1FTSA 1V16B 2C2ZA 3C6XA 2XQJA 2CXQA 5IKMA 2QX4A 2P9EA 3BXZA 4FZVA 4UEKA 1I4DD 1LLFA 5A9SA 1DB3A 1QGOA 3MW8A 5DTRA 2FWRA 3BD6A 4Y6PA 3SJQC 3O74A 1XRNA 5KLVH 3FTPA 4UE2A 4IM7A 4WERA 1G9SA 3NBXX 5G0UA 1TZMA 1HE5A 3H3FA 4H1VA 2I80A 1K75A 1NTKH 2WYVA 2YXZA 2H48A 1PKEA 2X77A 2DRIA 5LMNO 3DDZX 3S44A 1Y6ZA 4B83A 1MX1A 3V97A 2FOIA 3E4CA 3KAQA 2QIPA 1JHMA 4FNMA 3K53A 4C21A 4TMVA 1FK8A 1B6SA 2GLZA 3Q7RA 4F1WA 1L5RA 3AY3A 1D6NA 2TRSB 1UPAA 3V1MA 1BU8A 1IM8A 3PI7A 1ADJA 1RYHA 3AL2A 5LYJA 3M4XA 4NICA 1P17A 4YXWG 4EFLA 4NS1A 2DUJA 5LMNB 2HP8A 3NATA 4HNVA 2O1XA 2O1WA 2IWRA 1JG4A 5DM6V 2WAAA 4R98A 3D7LA 1QFYA 5HFMA 4XOIA 3ABTA 3MJSA 4F4DA 2VH2A 3ZE8A 4OQDA 5F5XA 3K9QO 3KR9A 1O6FA 3JQ7A 3MM4A 2R2GA 4AURA 1OIXA 3E2PA 5JH7B 4IVPA 2W2NA 3G7NA 4QUKA 1XL4A 5CIYA 3K5IA 4JEMA 5BQ3A 4QHSA 3K0EA 2J9FA 1T9KA 1PR4A 3KKMA 1YQDA 1XYVA 3MOGA 3UYKA 4BNDA 2NQTA 4I5FA 4JVOA 4AWXA 3P4XA 4URYR 3RIHA 3ZKAA 3KLBA 5ERXA 1Y4MA 5DSTA 4GXNA 3E8GA 2CD9A 3R2JA 3AFHA 4QUEA 2JAHA 3RG8A 4RK6A 4MV7A 4HLDA 1MJGA 1WTCA 3FPLA 5KHLB 4OHZA 1JBQA 4B3DA 5KWIA 3Q8KA 1YHYA 3WL7A 1EXWA 5BWBA 3H18A 1YVWA 3TVYA 2H08A 3UXEA 2XBUA 3EZ6A 3D00A 3KUKA 4LP8A 4QVKA 4J16A 2VKTA 4Y7CA 1BU5A 4K6FA 1FSPA 3KD2A 3TLZA 5EA2A 3SPXA 3ANLA 2W71A 5EERA 2RGEA 4EG4A 4ERXA 3D6TB 4AKTA 4UVHA 4M46A 5JCJD 1PLKA 3OZWA 2FEPA 4ND2A 3ZMZA 2C84A 1KWGA 2AYZA 3C6KA 4KWHA 1E18A 4JC8A 4J0DA 1UXIA 4BO7A 2R3SA 1OAPA 4XWOA 1UKAA 4U63A 5IBCA 3V1UA 3DP7A 3M9XA 1DZIA 3JTMA 2WLHA 3KPWA 3HZRA 1N2CB 3JVUA 1RM3A 4KN8A 3CEMA 2IA5A 1XNRB 1TVMA 1XZFA 1I94B 2QX8A 2ZR3A 3BCSA 1H3NA 3FE2A 4RKQA 1NVTA 2JFPA 4U2KA 4RTQA 5HQTA 1KRHA 3HY6A 3TIGA 2ZSJA 1OVMA 1V9LA 3GP8A 1O08A 1B8OA 4KQ6A 5HXUA 3I9JA 2E4AA 1KSJA 2IEGA 4Y2UA 3RAJA 4R4JA 3LCVB 3OTHA 1QP4A 4D8VA 2REQB 3TNJA 3A70A 2ZI6A 2I8CA 3H83A 3PQDA 2VJMA 3OR7C 1RKXA 2DB3A 1GM7A 1HRKA 3NOVA 1HDGO 4ZEWA 4MZXA 5EIBC 1KAQA 1AKMA 3H9BA 1I01A 4GT1A 1U02A 4KUMA 2C03A 2MW2B 4FVMA 1KP9A 2WUEA 1V5FA 1M0WA 4PA9A 4UCXA 5I45A 5DM60 4BNGA 2ZUWA 1FU4A 1WW3A 3WI7A 1TEZA 3SPCA 1VJGA 3R41A 5JLJA 3IUQA 2UYGA 5JC8A 3C6BA 1L8LA 5LMCA 1YL7A 2OVBA 1IY1A 5JJKA 1A9QA 2FEXA 4RF3A 3CRQA 1N2JA 3M99B 3BXOA 4PVDA 1T2UA 5DEOA 3W8NA 2GBPA 2WZDA 1NVWQ 5FBZA 1QQCA 3SMVA 1UBEA 1J21A 4C6TA 3N6RA 3OO0A 4J10A 3VPHA 5D6OA 3FHCB 2I3DA 4C01A 1BRTA 1J07A 1P3JA 4P4TA 4EB8A 4RNCA 5K0JA 2NTJA 1Z3CA 5EIWA 4PZDA 5TIIA 1SFRA 3DEZA 4GZ3A 1UPUA 5DHFA 2Q0XA 4U6NA 3L0YA 4KCGA 3ZVLA 3C8ZA 4LBYA 1NW6A 1U2GC 1UKEA 2V4UA 1Y1SA 2QM0A 5FWNA 1LS1A 4DDVA 2B3DA 4JL8A 2I2FA 3PLRA 1FD9A 1Q11A 2VPQA 5FDFA 3MBMA 4HXFB 3HS3A 1BZYA 2QJTA 2VPPA 2DYKA 3LYAA 2CV2A 3CJHB 3IAUA 1UPBA 3K8YA 1UMDB 1BFUA 1XRQA 1M1KW 3REGA 5FR2A 3AXTA 3W5VA 3PUXA 4BMOB 3H2SA 2AIRA 2JRIA 1B41A 2N48A 2WJ4A 1N2GA 4PGFA 5JY6A 2FL4A 2JI8A 3G89A 2VPWA 1G20B 2B33A 4GWLA 2RC5A 4KXVA 4CDNA 2DUMA 5JAPA 4QELA 4LFAO 3M6VA 3WJ1A 4O4IB 5HXAA 1WXGA 2N1BA 5LHGA 5FV7A 1V8BA 4JSRA 1MABG 1SBHA 4O25A 1QH1B 2PUEA 1ZVMA 3U0OA 3WGYA 2QR2A 2R66A 5HRCA 3G7UA 1WMAA 3DJFA 4AZ3B 3E0XA 1BFKA 4JGIA 3ENVA 5I8PA 4OK6A 3DBHB 2IKQA 2RGNA 4ITVA 3CH4B 4UEWA 1R4MB 2ZSUA 2ZJYA 1KDPA 4PW0A 4DLVA 2QIOA 1D5AA 4LFAB 4QIHA 1PRYA 3JWIA 3ASOB 3JQFA 3LXMA 5BNIA 2N46A 1J9GA 1ECPA 5L51A 2WJWA 1MEEA 1GXSA 4NG5A 1R9GA 2HLPA 4W4KA 3EFBA 4R8LA 1EFKA 4L0DA 1XZLA 1MAWA 3AHCA 4PLYA 3QPAA 5HOEA 5KNDA 2CY0A 5AOVA 3FHJA 2EKZA 4RMIA 1QTNA 2PZBA 5AI5A 3F4KA 3AK1A 4BN0A 2EFCB 3ET5A 2CXUA 4XDHA 3NBKA 4ZVMA 4B6OA 1S8FA 5J5VA 5TQ2B 4MKIA 3V8QA 3EZLA 1UMKA 1VL8A 1E92A 4UFOA 1NVEA 1XBLA 1AV7A 1X92A 1QSGA 1J1IA 4OBXA 2QAIA 2G17A 4N76A 3RQSA 2VF8A 2OZLB 1NFQA 3SFVA 3ETLA 2HVYD 3HY3A 4AY3A 1BMTA 4OHMA 4FYXA 5LP6C 3CT4A 1Q6UA 4JYPA 5GOZA 3OI7A 4FR2A 3JVEA 3RVPA 2A9QA 4LF9O 1NN0A 1HLPA 2DBQA 3V32A 3CZAA 3R9IA 1Z5VA 3FZEA 2IY7A 4XRRA 4D98A 4P31A 2HQSA 3TB4A 4OQPA 5KJ6A 4I19A 4B5KA 4R6ZA 1ID1A 3OJEA 3D1JA 2VTBA 1Q0TA 1TLLA 1T34A 3P32A 5TMBA 2F8MA 1BFDA 2B2XA 2RIRA 1LX6A 3EDCA 3EZYA 1O3YA 2FJ0A 1Q0QA 2XJ9A 2Z2ZA 2QR5A 3CKMA 3C3PA 4CW7A 3DE6X 2CWDA 1KYQA 2HRRA 2F93B 3AF3A 1W0KD 3AEKB 1T2CA 1KORA 1P7GA 3T52A 1V4NA 4LI0A 1OWPA 5K6TA 1H85A 3S27A 4ENSA 2WF7A 1ESDA 5JH7F 3O7MA 1LDMA 5EWRA 1R3UA 3QVXA 1ZOOA 3R7BA 2BSQA 1H1TA 2FGYA 3L0BA 3EVAA 2FTKE 2IDZA 1M34A 2W8ZA 1UKZA 1T9CA 3W5IA 4RVDA 4D96A 4KPUA 3DFFA 1YR7A 3RT9A 4BBPA 3RC7A 4G5QA 3DUFA 1FX0B 5HQ3B 2XYVA 5FI1B 1ADBA 1I0IA 1K3FA 3PPYA 2OTJF 4AMBA 3CC2V 4UZEA 3FI0A 4X41A 4L7VA 2GOYA 1JEJA 4CH6A 3CE6A 3NBFA 1VQPF 4K3AA 4RCVA 3H9VA 3Q15C 4CLEA 3UAWA 4DBVO 3F9CA 4YBZA 2G25A 2PVPA 5MFZA 3KCNA 2IZ5A 2GYYA 1N9ZA 2JIZD 3PJDA 2ZYSA 1BH2A 1GCGA 1ZL8A 1L6RA 1UXJA 3LY5A 3LM8A 1UK8A 2Y1EA 2XA9A 4CBCA 4QYSA 3BD8A 4R50A 2ZR7A 4IQ0A 1WB7A 3M1IA 3OIYA 2I1LA 1GL9B 3ESZA 4UTOA 3EGVA 2VYND 3I8OA 1L7VC 4LY9A 5L8VA 5JSYA 1I3NA 4E4YA 4QPKA 2X0EA 4CHTA 1E3EA 2WI8A 3GFGA 1SXHA 1BKYA 1OAAA 2EGUA 2HXSA 3B20A 4ZV7A 2M32A 3C43A 1E7YA 3U5ZB 3QG1A 1HOTA 2Q49A 4E31A 3TW0A 4W7IA 1OYYA 2M6RA 4MV1A 3NTQA 5IDXA 1JA9A 5EIBD 1TYDE 3AG4C 2Q6AA 4BNNA 4G25A 1RYBA 3MF4A 1OCZC 4D6PA 1JHXA 3DOJA 4FBGA 4ZT2A 3GJ3A 2E49A 2HJGA 4JBNA 1DOZA 1SXIA 2NXNA 3IFXA 1HNNA 1T9DA 3A0HZ 3ZXUB 3VCZA 4BMXA 4DW1A 2I4IA 3AVQA 3EVEA 3A1EA 2DPMA 4B8WA 4UPEA 1UBUS 4E2YA 5JHGB 3WHPA 4O33A 1HDYA 1N8TA 5DMXA 3UJ7A 2UUBO 4FEYA 4K46A 4D0RA 2XAHA 1NJ8A 3COVA 4LSZA 4ER0A 1SVKA 4RA9B 1P18A 4XEHA 1S3JA 4HUQB 4QWWA 4LV8B 4LSMA 5A4JA 4CEIA 1VQNV 4Z9XA 4KGZA 3OZCA 2Z9DA 1YO6A 2EEZA 1E3LA 1ZK4A 4HRAA 5ALYA 3B1JA 4RH1A 4R71A 3MQWA 5BSTA 3HXPA 4WFBV 4BPBA 4L8GA 3RVOA 3STHA 1B2LA 3KELA 3QLVC 2EBFX 2O2GA 4TWIA 5HMLA 3RTGA 1CZKA 4BNJA 1I9CA 1X1QA 1UXHA 4IJUA 1RR6A 4IIJA 1Y6RA 3CMEF 1AR5A 1M4UA 1AB3A 3LC0A 4CM9D 4L08A 4P0PB 3C7KA 5A4KA 1J8FA 3JX9A 3PGKA 1HYQA 4EDHA 4IAOA 2GD1O 2B8TA 3CGWA 3GLTA 4LN1A 1WUKS 5E9WA 4HXGA 1DJMA 3E53A 5AVYA 1OH6A 4NULA 4HWRA 2PSFA 2SCUB 2O07A 4BTLA 4JI5O 2FPGB 3JQ8B 2ZR2A 3CV3A 2IP1A 3B3FA 3T1HB 3LQ2A 2X5KO 5TPZA 5B6IA 4EMTA 3KK0A 4DDWA 3IMEA 4CV1A 4LGMA 1Q83A 4QNHB 3FYCA 4J76A 1TIKA 4MWEA 3SS8A 1CF9A 1NQXA 5KQMA 1XR3A 5CX1A 3G0CA 3EIEA 3SPJA 1NF2A 2EG5A 2AE2A 3U49A 2WVGA 1VQ9F 3LU1A 1Z38A 3DS8A 1ONNA 4BYMA 2JHCA 1GZUA 4MVRA 4MRPA 3E22A 3ZDCA 1HG0A 4MB2A 3R9WA 4XFDA 1D4FA 3RV3A 3HHEA 2P8SA 4YK7A 1M6NA 4FPXA 4DEVA 2WWRA 4MKXA 3CCQV 4A0SA 1TT5A 1FTGA 2X5XA 4K87A 1LQTA 4KUGA 2BTQB 4LOAA 4CC5A 3T7JA 3CSXA 3I62A 5DBGA 5DO9A 1JKJA 3GJ0A 1KAMA 3WSWA 1EK1A 3DUWA 3K94A 3BHPA 2HQRA 2Q68A 4WASA 2ZT6A 1R3KC 4KJZA 3GRKA 3R77A 3OE7D 3A36A 3B78A 4K9DA 1UBGA 1RLIA 3ZOKA 3GELA 1VARA 1PGNA 1ZJ5A 4ZICA 3MIIA 4QTXA 2W6JD 3DBRB 3U48A 1QBGA 2GTIA 2PUSA 2X0LA 3KYCA 3H2BA 1I2MA 4FLYA 1NH2B 3OIVA 1S02A 4FFDA 3V4PB 3QXGA 4RE5A 3LHIA 5GONB 2Z2JA 4BVEA 3P0RA 5LQCA 1LUWA 1ABBA 2FMXA 3VVCA 1R2QA 5I48A 1P4GA 2DPYA 2WTUA 2FZWA 4B8ZA 2ZU0C 1ODSA 4RO2A 1GARA 5CXUA 3LUFA 4MQLA 3KT0A 2X2FA 2HLDG 1HTBA 1FTWA 1V0JA 1D04A 3AG5A 2YFYA 3P96A 2QGZA 4A0RA 5KO2A 3AEQA 2G72A 3JVHA 4BNHA 4EKYA 1YTFD 2P75A 4C30A 4B5LA 5CN0A 4UHDA 4F3YA 4HZGA 1DF4A 2DQ4A 2WAYA 3L6CA 1RXYA 5B57C 2IPOA 3DXZA 4AN4A 2C5GA 5IYZA 2AN1A 4G5YA 4I46A 3T1TA 3OE1A 1L3CA 3FHOA 1X13A 1NTMH 5ELLA 4OX9Y 2GN8A 3T1YO 1GNVA 1JSXA 3TW6A 1YB6A 3BXGA 3AR6A 5DN6D 5D86A 2G0NA 1VB5A 4OP1A 4B4OA 4HQNA 4FYHA 1ONSA 4X44A 1KJYA 3DD1A 1MMFB 3PS9A 2JA1A 4BNIA 2FP4B 1VFPA 2PHZA 3AEUA 5CDFE 2HWYA 2BGJA 4X66B 4NBVA 2P6YA 4DDUA 3KQMA 4C8IA 3AK3A 3CX6A 5CB4B 2JEZA 3W06A 3EVBA 4EZEA 1QQTA 1E6CA 4CH4A 2AH5A 4YHHB 3GY0A 4FWBA 1ML3A 5CPFA 3T4DA 1QGZA 5JQGA 2JAXA 4OYRA 1NM5A 2IW5A 3KKYA 3REOA 3PFCA 4MV8A 2FPMA 2DMXA 5FHQA 1UFVA 4L5CA 5BWLA 2Q62A 1M74A 1QUEA 2UZ1A 4FKMA 2AG5A 1J23A 4MYSA 2RH5A 1QHYA 2QLTA 5AK6A 3Q1KA 1X14A 5FULA 2B3TA 3R7NA 3DLHA 2I2WA 4C4RA 2PBZA 4Z4GA 4WACA 1V9CA 4HYTA 3SZGA 3TXYA 2DY1A 3HLYA 3LC1O 2EARA 3AERB 3RWMB 4U02A 2FUCA 1USUA 2GN1A 4EJ2A 2QK4A 3CLRC 4QXRA 4F6RA 1QPZA 1ZIPA 3HCRA 1QIKA 1VE5A 2BWJA 5JZOA 5BNWA 1A3CA 2X6TA 5LKAA 4HJXA 1XMIA 4FPPA 2QWQB 1OR8A 2IRWA 1K1EA 4YV1A 1VPTA 4AZWA 1S4MA 3KSUA 5J1TB 5HUHA 5LB4A 5KCZA 2VYQA 5E6SA 1IN6A 4JU8A 5T8KA 2KGWA 3CXCU 4G5SA 3SZMA 3X2EA 2Q5LA 1OWLA 3KU4A 3TLBA 4F4LA 1CLEA 5IUKC 1XFAA 4FYKA 1SD2A 4B3GA 4Q4AB 2NTNA 4HGRA 1BN7A 2MCFA 4Q4CA 4O4JA 1IXSB 3DBLB 3SX2A 4PJ0Z 1XQ1A 5EP2A 3C9RA 3KPUA 2CJWB 4PV7A 5HG0A 4QTTB 3S3TA 4CR6A 3GO4A 1FDSA 4ZJPA 4ACAA 4LK3A 1IFXA 4IHJB 3KTFA 1FNSA 3OY2A 1L4UA 4XGIA 3WXBA 3CNLA 4X1OA 2GDZA 3TIFA 4PE5B 1O77A 2IOYA 2F62A 4C7UA 3W8DA 3IQHX 1I0HA 1WUTA 3KVRA 3CPJB 1HBJA 1A9XA 4A5OA 1SCAA 4MUIA 1ELOA 1VIMA 1R9NA 3W4KA 1QMPA 3D02A 3VU0A 3Q3GE 1PP4A 3DE4X 1TCCA 5K51A 1P1HA 2ILTA 1ZUQA 1Y3BE 1TFUA 1G2PA 2ZRKA 1QG4A 1I13A 2HS3A 1R8XA 2Q5IA 3H5VA 1JB1A 4ECEA 2V45A 4IDBA 3BZBA 3UV7A 4QBGB 4IJ6A 1Z6AA 5LGTA 2BUAA 1FDOA 5K6AC 5LWQA 4B6SA 3TTUA 3RNLA 4XQCA 3PRKE 4G4WA 1Z2NX 3K2QA 3ZHCA 2UZ4A 3A31A 3P0IA 3CKYA 1T8WA 3AETB 2FN4A 4QDKA 2BGKA 4PSAA 2HFJA 2JEUA 1ZD5A 3DOCA 2QI9F 2O20A 3EVDA 1BWRA 4I14A 4QVIA 1OI7A 2HN9A 1YDGA 5C37A 4PN7A 4CIBA 4F6CA 5CBKA 4Q4JB 1R6KA 2NU6B 4NYIQ 1BE1A 2PT9A 3ACDA 4YWJA 1IRIA 2RH8A 4FM0A 1RU3A 4ZAXA 3S2SA 2IY8A 1GPWB 3BICA 3KX2A 4ITRC 4DMRA 4ZZIA 1KGSA 1LB1B 1RAEA 4DVJA 4D46A 3ULKA 1QHFA 3K79A 4IOMA 3TDMA 1DQZA 3CKKA 4WX2B 2PUFA 3GD7A 4V0NA 4GGMX 4G5XA 4RHTA 4OMDA 1JU4A 2GPWA 3C4VA 2GXSA 4E4RA 4RSHA 1V2HE 3PI6A 4FLTA 2JGDB 3WK8A 3VHRA 1FFHA 4JEUA 4HVCA 1XRGA 3P94A 4CKEB 3TIIA 2GM9A 3QVUA 3KQNA 3KTAA 1TC1A 1J1ZA 1DIOB 4MQFB 4OD0A 4RTLA 4UEQA 2OCBA 2YS6A 3CU5A 3M6UA 1ORRA 5ALPA 3F3YA 4ESHA 2A5FA 1W2HA 2C2WA 4RDCA 1LY1A 1QQ5A 4FEEA 1F3OA 2RBGA 3GWKC 4R5HA 2AHYA 5G0SA 3H8WA 3ZYCA 5KMGB 3IEPA 3DT9A 3T9FA 2IH1C 4TSFG 2EBOA 1F51A 1R3LC 5FFMA 4WZ6A 2KI5A 5HZKA 4DR3O 1QVAA 1YQEA 1ICIA 3BPSA 3A4IA 1NHGA 1Z15A 1FJGO 5H9WA 4ZT4A 1KEWA 4WXHA 4N8EA 1W88B 6Q21A 3H1GA 3LLCA 4I9FA 4JLKA 3H3JA 4DEXA 4YONB 2X6RA 2IOFK 4UVAA 3SM3A 1K7FB 1I7FA 3ZLTA 4P34A 5FPHA 2J67A 1H2ZA 4ZYZA 3OM0A 2QKAA 2ZSEA 3GVIA 4DR3B 4EPWA 2YY6A 3IEKA 2V59A 2PEZA 2XI4A 2F1JA 4IILA 5GONF 4UUMA 1F7UA 5EP3A 1XQ6A 5GMOA 3JQCA 1KXJA 5FA6A 4CKCB 3I6QA 3X2SA 1E8DA 3NWOA 1TQ6A 3UZUA 4J6EA 3JSLA 3LH5A 3P45A 4YDSA 4OLFA 4DQXA 1LDEA 2AF4C 3B12A 3F6MA 2YNMC 4LKOA 3LQRA 3Q3IA 3JWGA 3BWBA 2FX5A 5KHAA 3CSUA 1MA1A 3O95A 1ONPA 4JLVA 2G07A 2A0WA 3U1VA 4AJ2A 1EEXB 3L8GA 1PG0A 2BV3A 3SVZA 2PQ6A 2ISCA 2XCRB 1V2GA 1DXOA 4KACA 4Q4LA 2RHLA 1JY8A 2O0MA 2N75A 3M2PA 5CEEA 5D7NA 2FZ5A 2GFQA 2JLBA 3KL2A 1AGYA 4GR4A 1G5RA 1S2MA 3T1NA 2QN3A 3GRCA 3VNRA 4NI5A 3EAGA 3CZ9A 2P69A 1RI3A 2JFNA 1VE6A 2M6LA 4HNHA 3LPAA 4YRSA 4QUHA 3VOUA 3G49A 3VNQA 1U7DA 1DT3A 5CIQA 1UBTS 2QD1A 4AS2A 1EVKA 3ROEA 1NAIA 3CNBA 3CRZA 2H7YA 3CLRD 2C2HA 4H7JA 4YAEA 1MGOA 1MO6A 2D1YA 2Z4TA 5EAZA 3OZTA 5FO0A 3TQHA 5BVHB 1WIWA 3MHPA 4QLAA 3ABMC 3BEDA 2GX6A 5AIAA 2HT1A 3RVLA 4WGFA 2EKDA 4V39A 3FSJX 4CMCA 1OBVA 3OUFA 3NORA 3ZWOA 1NTRA 3BTSA 3QZUA 3ZHQA 1EUCA 5C7IO 1U6KA 4KQ1A 2PM8A 4GOMD 5B1HA 3I76A 4YRIA 3RSZA 1UKVY 4DR1O 4KQEA 4IEEA 2XTNA 2C2GA 4X0EA 3LA8A 3KZCA 5CFRA 2ZTLA 4JJ7A 2IVZA 3NUZA 1QR9A 4DANA 4EB6A 5NULA 1N5LA 1G5QA 1MB4A 3Q72A 2HFKA 1X1DA 5HM6A 1P7PA 2H94A 5DHSA 2VDLB 4XB1A 1KI8A 1QHTA 4KXMA 4WKPA 4S12A 1K6EA 1WB4A 4MIYA 4HMOA 5TQJA 2VNIA 1UF9A 1XLTC 3NBZC 1D4ZA 3APOA 1PZFA 3E5RA 3BDAA 1ZFNA 1AE1A 4TMXA 4L2IB 3U10A 2P9FA 2AE1A 3L4BC 3V46A 1Q14A 3V4OA 1DO0A 4JP2A 4BZQA 4LJSA 1U40A 3AU8A 1YQ9A 1G98A 3ELBA 3G0OA 4YMSA 1YJBA 3ZGXA 1EK2A 3M5DA 3J80N 3RT1A 3HA7A 1L5GB 2D2CB 2ZYUX 4I0XB 4N5MA 1A04A 2YUAA 1FYEA 5J59A 1XDGA 1X9HA 4YUZA 3EFEA 4KE9A 5CLHA 2E74B 4A5SA 1L9KA 2C2KA 2ZDHA 4IDDA 3F4BA 2DR0A 2EFYA 4ZTUB 4LECA 3WYDA 4DLWA 1TRKA 2DPLA 2J46A 5KOIA 1KAEA 1X7GA 1H8HG 3NHWA 4IO1A 4YCCA 3WNBA 4ISBA 1N6IA 1OJHA 1ZQ1A 1EB9A 3PJRA 3OETA 3OD5A 4L9AA 2DWEC 2EX0A 1TCBA 2BGNA 3TQTA 1BA2A 3IJEB 1WDTA 3MD0A 4DA7A 3QKSB 1KNKA 4B7CA 4TLAA 3C9UA 2CL0X 2Y05A 4JNKA 4DXHA 5LCXA 3NAMA 4Q1CA 4CLRA 1B6TA 3I5MA 1X1CA 1MX3A 1REQB 2OK7A 1XHLA 3OW2U 3OP4A 1DHTA 3PUIA 3BBPA 4YH1A 1JG6A 2FXIA 3O4VA 1JWBB 3GYBA 4NPAA 3E0QA 1J0DA 3O9OA 1TAUA 1YBFA 1XHZA 4EG7A 3IR7A 1RPZA 1ECJA 1QNLA 4HR7A 2VQEB 1JHVA 3QU5A 2HC9A 1UDXA 2E4VA 5TY0A 3AVUA 2Q5JA 4URZR 3AWIA 1F8FA 2NG1A 4HNGA 3OAAA 1L5VA 2JAQA 3OM8A 3JWPA 1X7ZA 4XB6B 5EOVA 1FFCA 2A5LA 3NRJA 4ETIA 2ZBFA 2JS7A 4L51A 4KHPB 3VOSA 1UPCA 4YQEA 4BCCA 1D9XA 4ZI7A 2PLNA 1E2JA 4F72A 2WE8A 2WDZA 1KQSU 3IILA 4YRPA 3U61B 5JLAA 1PJBA 4XX0B 2C5BA 2CLOB 3B1FA 2DPXA 1UC5B 1TW3A 1MOFA 5CGZA 2OXTA 1VP7A 3SJUA 3WO0A 2CDYA 1JJ2U 4M9CA 3ZVNA 4OYLA 2R47A 1OOEA 4Y9TA 3ZS9A 2AXQA 1PUJA 1MEJA 2GEVA 3T9DA 3IAHA 3IIJA 3IXMA 4CR8A 5EWLB 3CF2A 4P4GA 3F46A 2G8NA 4WFAV 1FYJA 4FWIB 3VO2A 2OFOA 1INLA 4EECA 2Q2VA 1KBZA 1W25A 3NC4A 1EWQA 4ALNA 4YRFA 1UK6A 4GZ6A 4O4LB 3WYGA 4NONA 4QICA 2JLQA 3NG1A 1SUEA 4GRAA 2B1GA 4OA5A 1R3IC 5DX1A 4D9GA 3ENQA 3G4SF 2JH9A 1P7CA 3U3RA 1ISSA 4NCIA 2G04A 3NCTA 4MTCA 1MORA 3NTLA 5LBIA 4LYGA 4DJDC 4REQB 1ZXXA 4ID9A 3OZSA 2AC7A 2NVBA 1KDYA 1FYDA 1PR2A 4AYTA 1BEZA 2QRPA 3HCWA 4I5GA 4H1WA 1NT4A 3LAWA 1F6BA 4XYBA 2ZPTX 4BGVA 4HNUA 2DM6A 1CJMA 3RFFA 3RFXA 2OIGA 5HE8A 1QHGA 2OCGA 2G6BA 4DLUA 3RGGA 1Y4UA 4PZAA 2F4VB 1XKLA 3T3MB 4EITA 1PJ4A 2LZ0A 2VSFA 1QYXA 3AHGA 5JALA 1GRVA 4WZAB 4TPKA 2I87A 1U3VA 3HRKA 2VI5A 2QN7A 2D62A 1U7HA 5E7IA 1T4GA 1M54A 1NVAA 3IEMA 3VR4A 3AHEA 3OFNA 1E66A 1JN0A 4LAFA 3KVYA 3FJYA 3HWX1 2NTYC 4HPWA 4XXHA 3ZLUA 2UYKA 4QU9A 1KECA 4GBJA 3RRXA 1IPFA 3QQPA 5C4IA 2QR3A 2I2BA 1SKUA 4JI1O 3ZU3A 4JT4A 2PANA 1KFJB 4KIJA 3ZLJA 3K8QA 5C5CA 1NG1A 3C3KA 2BEJA 3BFKA 4BQFA 4UULA 1DJPA 5BUCA 4ZN6A 3K92A 4EO4A 1N5MA 1VHJA 2GRAA 1XK7A 3K0SA 2J0SA 1T8TA 3HUDA 5DN9A 1RPTA 5EQTA 3KZ1E 2QKYA 2L17A 2DUUA 4RVFA 4BAZA 1UZNA 2XTJA 3TZKA 5D01A 3Q0IA 3M8AA 5IJ0B 2H0QA 3HCFA 5B1DA 1L5OA 4DK0A 3S7ZA 3H11B 4WN9B 1N2SA 2EIJB 2XBLA 2YINC 2H1OA 5BSRA 5CM2Z 3A6DA 4ZKDA 4IXDA 3TRHA 3RG2A 4INOA 1QRSA 3GNLA 1Z68A 3I32A 2MSKA 4FIZA 3AB7A 4YYEA 2CBXA 4CCYA 4DIUA 3ZU4A 4AZVA 1L0BA 2H51A 2B25A 3I55V 3EASA 1KIMA 4KLZA 4LFCB 5KA6A 3A1CA 4K8OA 2WHPA 3GP3A 3EZXA 3FGPA 5B3LA 2CN1A 1VXRA 1VJTA 1IVNA 2WPDD 2VJDA 1SO8A 2AUTA 1G1AA 4FVTA 4QNRA 3UGKA 2ZI5A 3OP1A 4GBED 2QE6A 4TLBA 1CJVC 1M2NA 1PVVA 2GO1A 5BVGA 1YJ9F 1EFCA 4FYJA 2OTLF 1SCUA 2CC2A 2R68A 3FYTA 1H2WA 5BXQC 2N42A 1MG5A 1QRUA 3G8BA 2IQ5A 3SC2A 2HA2A 4EYEA 1M2GA 3KAJA 3HB4X 1JHAA 1XK6A 1RC1A 2NP6A 4ISCA 4EYQA 1QPGA 3BRQA 4JCOA 3MGKA 2QTZA 3QV2A 1I4TD 4L5YA 3FZYA 4J0HA 1DAPA 4IF6A 1A8UA 1FLVA 5ITVA 2ODWA 2WZCA 3UPUA 1E1QA 2PS0A 4B35A 3BE6A 1N6PA 3G0BA 4N12A 3TOSA 2XTAA 3GAFA 5JEEA 3FUTA 4QD3A 3BX1A 4U9HS 5CLLA 1P5FA 4MMZB 2ZDIC 4MPJA 3AM4A 2BGTA 2XNDD 5H70A 4ARAA 1AZWA 1DPGA 3WPWA 1M2VA 4TLCA 1UP7A 1R50A 1GG9A 2DW4A 3WGLA 3B6JA 3SLGA 3CPHA 2FB9A 1T9GR 5KOJA 2H0AA 4LSGA 1ZUD1 3MQ2A 3P20A 3RSHA 1LU9A 3A2LA 1PL6A 2P7IA 2I4OA 2I76A 1VQOV 5TQVA 5SY4A 2ES4A 4F5ZA 5BSMA 4H16A 1L5NA 2JJQA 1PTJA 2GEKA 2AJBA 4NABA 2R1VB 1H0SA 4GKBA 4C2AA 1J2JA 5JMWA 2H1LA 3CZQA 2BRUC 2JEOA 3L46A 3S03A 2XGGA 3NNNA 3CCRF 3PA6A 3U4MA 4QQFA 3PEYA 4XQEA 2WLJA 1GA6A 2IPLA 2MWMA 1PR0A 4M99A 3ECSA 4ND8B 2RAFA 4C88A 2HHLA 3VR6D 1AK2A 1K66A 2FX2A 5AICA 5ED4A 1M67A 2Q3MA 4U0KA 1E9EA 5KWVA 2B0CA 4MKRA 3OZEA 2BFFA 2Q5OA 4DSTA 4P0QB 4O29A 1KDOA 3PJEA 4D4GA 1Y7PA 4R1PA 3DMFA 3AKEA 1AGNA 4OQLA 3EEYA 5BMVB 4G4ZA 3I04M 3V55A 1VPWA 4E88A 1L5LA 1GGMA 2IV7A 4B0PA 4MRRA 1I7PA 3M34A 1Y1LA 3WZ2A 2QPTA 3STLC 1K9MW 2PFKA 1KWKA 2X9LA 1M9NA 4GU5A 1M2OB 3GWZA 2G40A 1E9SA 4X6XA 2PQMA 5KDOA 5AKYA 4LJ7A 2ZJAA 3E8SA 4XSVA 5FOTA 2I29A 1GVNB 2GD6A 3GN1A 3SSOA 3WRXA 4DR7O 4PM4A 1G38A 1IBKO 3GI1A 1X1AA 4LZWA 4OHCA 3M9WA 1ZH4A 2C1XA 4YAFA 3V8BA 4KIUA 3D4BA 2NNUA 1FLNA 2CBGA 2ZR0A 5KNCA 1DAEA 4EHFA 3CIOA 3LQFA 3L2OB 1U80A 1YHNA 4CQMD 1W0JG 1Q43A 2EJUA 2B82A 3UUGA 5JI2E 4FOLA 3D54D 3KQKA 2V9ZA 1M5RA 4Q01A 4H18A 3RIGA 4BFUA 5JCXA 3NM4A 3RTAA 3GT4A 1IBKB 4DM4A 3UKOA 1N7IA 4E2ZA 2UXDO 3SC4A 3BZUA 1U7XA 4D3YA 2N9UA 3T9BA 4UAUA 4R1UA 5IARA 1P77A 2YYSA 1NVGA 4AL4A 1I4WA 3MSCA 3UXHA 3UB2A 3ON1A 3IAYA 3U3MA 2H1HA 5K0LA 3TFQA 4Z53A 3ZJVA 1SQ6A 1A95A 2PIAA 2DJIA 1Y8QB 2E1PA 4EI9A 2FPPA 2YEVA 4B4UA 2DJ5A 4KB5A 4PLHA 3PF9A 4EHJA 2B2NA 2PRSA 2PKQO 4TLMB 1PFGA 2OL4A 4ZZ0A 4BAYA 1DLJA 4Y67A 5EJ7A 4LDPA 4YR9A 1HYGA