4YJ3B

Crystal structure of tubulin bound to compound 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj3B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj3B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj3B01
5FNVB 1W5EA 1TVKA 1JFFB 5MN4A 3JATB 4U39A 3VO9A 3RYHA 2VAMA 5IJ0A 5EYPB 2RHLA 5IJ9A 5ITZB 4M8IA 4YJ2A 4O4LB 5LYJA 3RYIA 5JH7A 4TV8A 5BMVA 4O4IA 3RYFA 1FFXB 2BTQB 4TV9B 5LA6A 4DXDA 5EIBC 4O2AB 5GONA 5C8YA 3N2KB 4X1IB 4X1KA 2XKBA 4IIJA 1RLUA 4E6EA 3E22B 5LOVA 2GVIA 4ZHQA 4WBNA 3HKEB 5LXTB 3ZBPA 4ZI7A 4I50A 4B45A 3RYCA 5EZYA 5JQGA 4LNUB 4I55A 1Z5VA 5IYZB 3JARA 4DRXA 5J2TB 4EB6B 5FNVA 4O4JB 3WGNA 3JAKB 1JFFA 5CA1B 4XCQA 5M7EA 3RB8A 3ZBQA 4YJ3B 4I4TB 4B46A 5EYPA 5KMGA 4F6RA 5CA0B 5ITZA 2RHOA 3WGLA 4U3JA 3VOBA 3HKDB 2R751 4O2BB 4X1YB 4O4LA 4TUYA 1FFXA 4X20B 2BTQA 3HKCB 5KX5B 4TV9A 5J2UA 3UT5B 5JCOC 1W59A 3N2KA 4X1IA 3JASA 3E22A 3ZIDA 2XKAA 5JVDB 1TUBB 3JARB 5LP6C 3HKEA 5IJ0B 5LXTA 3JALA 5IJ9B 2Q1YA 3CB2A 4O4HA 4EI8A 4LNUA 5LYJB 1RQ2A 2VAPA 3WGJA 4TV8B 3RYFB 5IYZA 5J2TA 3JAWB 4EI7A 4EB6A 3JATA 3HKBB 5LA6B 5LP6B 4IHJB 3N2GB 5CA1A 4X1KB 4ZOLB 4KWEA 4IIJB 1W5AA 4YJ3A 4FFBB 1W581 4ZHQB 5MN5A 5CA0A 2BTOA 5CB4B 2VXYA 1SA0B 4I50B 1W5BA 3HKDA 1FSZA 4HNAB 4O2BA 4X1YA 3RYCB 5EZYB 1W5FA 3M8KA 2RHJA 4EI9A 1TVKB 4X20A 3HKCA 4O2AA 5KX5A 2Q1XA 3WGMA 3UT5A 3RYHB 2R6R1 3VPAA 5JVDA 1TUBA 4YJ2B 5KMGB 4F6RB 5MN6A 4U3JB 3RYIB 5JH7B 5BMVB 4O4IB 1Z5WA 3C8LA 4TUYB 4O4JA 2RHHA 5JCOA 3JAKA 3VOAA 3JAWA 5C8YB 5GONB 5EIBD 3HKBA 5J2UB 5LP6A 4IHJA 3R4VA 4I4TA 3N2GA 5LOVB 1OFUA 2VAWA 1RQ7A 4WBNB 4ZOLA 3JASB 4FFBA 4ZI7B 3JALB 5JQGB 5CB4A 3M89A 1SA0A 3VO8A 3V3TA 4I55B 3WGKA 4HNAA 4O4HB 4DRXB
chains in the Genus database with same CATH superfamily
3ER6A 4K9QA 3F1KA 3OPYB 5BWBA 1U2PA 1KL7A 3CC7V 2ZT8A 5B1OA 1ZK2A 5K2OA 2AMYA 1NLFA 4XIJA 5KVVA 4E2WA 1CK4A 5M3BA 4LF6O 1NAHA 1LSOA 3ZWXA 4XGIA 3CC2F 3IBCA 1VFPA 1QOPB 1TKBA 1UBTS 4COOA 1SG6A 3N58A 4GE3A 1L5LA 1H1LA 1NVGA 3RA6A 2P9EA 1ZR2A 2G38A 3LMKA 3ENZA 1QWOA 1ATZA 1M2KA 3PGA1 3FCOA 4NK5A 3ZWPA 3GMDA 2FJPA 2I78A 3QA9A 1KBHA 1KKMA 3B20A 1RIFA 2QI9C 1GSAA 4KXUA 4YGXB 3SYPA 3QKIA 1G21E 3BWBA 3PV0A 1XTVA 2ZYWX 1XLWA 2PH7A 4XJTA 3MQFA 4BQNA 4C6HA 2NU9A 2JGDB 2RKOA 2Z2IA 2YOGA 4OSOA 3WGKA 1K9MH 1R4MB 4E31A 1H2NA 2TSYB 4KGZA 3PYLA 4RZ2A 4QPKA 3VKWA 4PTLA 2HDWA 2AXEA 2BMWA 1NLZA 2F8LA 4BWVA 2EHJA 1PNLA 3TFOA 1E94E 5JS8A 4QRDA 1UJ4A 5F2NA 4PPYA 5IY5B 3FFMA 3JSNA 1AP6A 3U3DA 3T95A 5G1NA 3BRWD 5CLFA 3JU3A 1IEXA 4BJ3A 4RADA 1R64A 2JHFA 2IJGX 2C8KA 1YZKA 4NG4A 1WTCA 2DUUA 1TAQA 3TRDA 4R0VA 2VQ6A 4EGAA 1NTOA 5LD2B 1H9AA 1EN6A 2BI8A 3TNYA 1YFLA 5AMXA 3GDFA 3CE2A 4JIMA 2F90A 3AH8A 3QWBA 5H80A 4FMCF 2RH9B 1XL1A 2E2WA 3QNMA 3AP2A 3APOA 4LDNA 4PN3A 1N3YA 2QBYA 3P2EA 4NTXA 4NBWA 3BA6A 5G40A 3TLEA 1DQNA 4U7DA 2ZSUA 4MKRA 1CD5A 4FIZA 1P3JA 4EJ0A 1GTMA 2F1OA 4UREA 4QBGB 2ZYRA 1OLUA 1L5VA 1IXMA 2VNIA 2VP5A 4OYYA 3ZWMA 5A5FA 4ICIA 1K5QA 1SKAA 1YNSA 1GPAA 2NUTB 4EJFA 2BZGA 3NWPA 2GM5A 3TINA 2GHRA 4PGGA 2RIPA 1T36A 1KJIA 2J3IA 3SXPA 1N1MA 1I8TA 1NNUA 3TX2A 3R41A 2G80A 1SKYE 2UXCO 3RNLA 3M33A 2PLNA 1PX0A 2ARHA 3WFZA 1KS2A 1IXRC 1ZCJA 1MAUA 3TLKA 3BK7A 2DY1A 2QG9A 4F38A 3Q8LA 1QIDA 3EGDA 4OQ4A 5ULLA 4G85A 1PLLA 3MHPA 4PQGA 3RU2A 1U80A 1ZUWA 4X66B 1TCVA 3I9OA 1VQ1A 4U7GA 4DV5O 4ZAVA 5C8DA 2XZTA 1D4AA 4ZO8A 4OXSA 1CQXA 1G64A 1UBMS 1EDEA 5FUWA 1ODKA 1I33A 5KYVA 4F1JA 2Q1WA 4RK6A 1SAYA 2V4ZA 3WICA 2OBBA 2F6RA 2HB6A 2FN7A 5HFNA 1J24A 1L8LA 3TUIC 3EG5A 2G17A 3IB3A 4OJKA 2AS0A 4EY5A 3P32A 1C9KA 3K92A 4B3BA 5J4KA 4DCPA 4UEOA 3W7VA 1KMHB 3ED5A 3OG9A 3RC9A 3O8RA 2PPLA 2P2CA 2G9QA 3ROQA 4P6VF 3GFGA 3LE8A 3NP7A 1TRHA 4KUEA 1WXXA 2JGJA 2D06A 3UW1A 1PZNA 3OECA 3EVFA 4GLLA 4L95C 3GLKA 5GGYA 3JW8A 4S1PA 2CHUA 4C6TA 1EGVB 2REBA 2Z9CA 4BO5A 2DQKA 3FSRA 2A9KA 2LV8A 5GPBA 4UNSA 3R0ZA 5FOXA 1JF8A 2I6SA 5FB3A 4GQAA 5KHAA 3ZJ5A 3NW9A 2FEXA 1M1NB 4HMOA 1NBMA 1I7QB 4QE7A 4I9NA 2ZCUA 2UXBB 1QGYA 4MUHA 4ERNA 1HYBA 1ZBDA 2VRCA 4NQRA 2YRXA 3H1LH 3F4LA 3BUSA 2G72A 2ODAA 1H8HG 2E37A 4XCVA 1JSCA 1WMAA 3ESZA 2RAFA 4GNKA 3R40A 5KVAA 3WWOA 3EAQA 1NU1H 3HP1A 4P9NA 5D5QA 3UTDA 4NYMR 1YRWA 3PC7A 3B82A 4X6UA 4Y6PA 3T52A 3FVRA 1VDMA 1FYJA 4B7UA 1Q0LA 2CLIB 1Z2AA 1GT6A 3FRHA 3VM6A 721PA 5DT9A 3WGIA 1U4NA 2WA2A 2WWIA 5A4AA 1QHTA 4MPJA 4YRBA 3SWWA 4AX4A 1ZO8A 3II6X 2HBRA 4RV4A 1ANKA 2BYTA 1O9BA 3V4SA 4PGHA 2ZRLA 1OC4A 5H8WA 1Y5RA 2ZI7A 4WERA 2C3YA 2ADQB 4N65A 1QHNA 2ZIWB 1PPJH 3CMMA 1CP2A 1EZVH 1N75A 5HCUA 4LH7A 2FVXA 3EASA 1DWUA 2GF9A 3C45A 4H13B 4Z4EA 4ALJA 2JK0A 4O2LA 4PELA 1CZLA 1N2EA 1VMGA 3TRIA 1GQRA 1EH5A 1HQCA 1U02A 5L95A 3I01A 2I6UA 4B3RO 5KSOA 3DZBA 3ZI4A 1WB8A 5I4IA 1S3GA 1JSXA 2ZUUA 1GGVA 4HWKA 5ESWA 1N25A 1YONA 2DFVA 4N7JA 4WVLA 1MOFA 4Q9JA 4HDAA 4FT2A 3VFDA 3RM3A 1LC0A 5F98A 1YI1A 4BE9A 1FXWF 4JL5A 3NV7A 1ZN9A 2Z98A 3U37A 3FRIA 4CYMA 4Q34A 1MGOA 3HJCA 4DLKA 4TMZA 3V4ZA 4HS4A 5K6AC 4JWTA 2QUZA 3PDUA 5REQA 4FDTA 5DDIP 3DCYA 3PKIA 2WT9A 2IM9A 3WMEA 7REQB 2FF5A 4EJSB 1DKQA 5H1YA 1P5FA 4Y3UA 1CUVA 5IW8A 4C7KA 1X42A 4M2LA 2JIQA 3L43A 4QLBA 5IXJA 4IJWA 2D1FA 4X8HA 1WXWA 3MT9A 3TEFA 1DAHA 1JPJA 1RPTA 3RLFA 1O5OA 4LCEA 2MT9A 3BWCA 4PDLA 4X66O 2B7CA 2UUAB 4H4EA 2WJ4A 4OMFG 4W9RA 1AC5A 3F9RA 3GLIE 4CR8A 2RH8A 4K9DA 4FEEA 1PK9A 3CZ5A 5DI3B 5E0KB 1QFMA 4LK2A 4PYLA 1XF9A 4DIKA 5EHXA 1RRMA 3GWOA 1G17A 1GFZA 3WBBA 5I47A 4JLSA 4WX2B 1N32B 1TUBB 3B40A 3K8YA 2XUZA 3P3NA 3K35A 2J8ZA 5LYJB 5B30A 2H85A 3NEPX 4ODIA 1OCOC 4HVCA 3AJAA 3C87A 5A3SA 5G0UA 4L72A 2XY4A 5EJ9A 3T1OA 3UUGA 3L8ZA 2AG5A 4U1RA 2ATVA 3FUTA 1AROP 3ZRWA 2C5GA 4MA0A 2OEPA 3I28A 1T8SA 1XZ8A 2K9PA 4RAOA 1Z5PA 1YB2A 2Q6LA 4Y2HA 3OZUA 3M5PA 1GZ6A 4FHEA 1GG9A 1EWTA 1V1MA 2GT1A 3T7KA 4DNQA 4I08A 3UGQA 1VQ8V 1FU7A 3P0HA 4XWAA 1RBYA 4U3FH 3DLIA 5FF9A 1UBUS 4KL1A 1E1RD 1RADA 1XO1A 3KB1A 1P1RA 2CCGA 1ZAYA 2ZLBA 5F64A 4QTZA 3TW0A 1SD1A 2PHZA 4J3FA 3K6SB 3LPDA 4JP2A 4K81B 4DV7B 3DMHA 3ENVA 3RT9A 4UM5A 1SELA 4HNUA 2EF1A 3QU7A 3RHTA 3OJCA 4Z2YA 4WQMA 2QF7A 2Q0QA 2OBMA 5FYDA 2G06A 2IY8A 2BP7B 1KWGA 1AHHA 4IVRA 4NSNA 1R0WA 3BFKA 3ZIAG 3KSDO 3BQNB 3VR2D 4AQYB 3OONA 2Q5LA 4C29A 4A5SA 3ZQUA 2IHTA 2E4YA 2A5JA 4IHJA 4ZMRA 5EI5A 3DB1A 4W1RA 5C7IO 1W1UA 3M1XA 3I64A 4LOJA 3A58B 1P72A 3SLGA 2HRYA 4GUAA 2NWQA 4R8LA 2ZWVA 1M1KW 1S8FA 3IOCA 3OW2F 5D3MB 4RSRA 1N6IA 4J42A 1N9GB 5GONA 4JXXA 3LVQE 3ZN0A 2XMGA 3S2EA 3LCMA 5T8KA 3OQVA 4BO8A 5KJFA 2VHCA 4XWWA 3LV8A 3BGVA 3TKAA 4B7ZA 1E7MA 5JNWA 3TCUA 4QUGA 3OF2A 1ZK1A 5J5VA 3SIRA 3OZXA 4MP8A 1DRUA 3SC2B 2FZ5A 4FFKA 1RQ2A 3FYUB 3I61A 1ZTEA 4I4CA 3G23A 3WMWA 2V7PA 3KJHA 3G4SV 1N7IA 3ZDYB 2VF5X 4WEQA 2A79B 4M60A 2F1RA 2WMOB 2BEKA 3AHCA 5FR1A 4LF5B 2K1EA 4BUCA 3R6LA 2IP2A 2Y67A 4ND7A 4ZQFA 1B8OA 4J2OA 4UE3S 4G81A 2WFLA 3RVZA 3NK6A 4NU5A 5CMUA 2AG6A 2FUG6 2V55B 1NF8A 1H94A 2I91A 1T0UA 2A3NA 3GBVA 3TBFA 2JFHA 2WY2D 2J5QA 3SR0A 2OBLA 3Q0IA 4MS3B 3AJRA 3NDBB 1PT6A 3OY2A 1RYDA 3HJTA 4Y1GA 3D3EA 1OAKA 3W2GA 1YQGA 4RJKA 3EGXA 3VIUA 1FCJA 1SXJA 2UUAO 2E82A 5HYVA 1YIJF 4RCYA 5AFSA 5JC1A 2JVKA 1X80B 1U7PA 2PL3A 3ESQA 5B55A 3WGGA 3W5CA 1ADJA 1W0JD 3HA5A 1I4DD 3PHGA 4QEKA 4AF6A 4DW1A 4Z4QA 3C3DA 4P4SA 4YMSA 4D1YA 4Z1VA 3VJMA 2NO5A 3D3JA 1EAMA 3KE8A 5FO0A 2JFFA 4QE9A 4HGOA 3DLTA 2JIPA 4XDHA 4QX6A 2XMZA 1AP5A 4HUQA 2PL9A 3EVNA 4I1PA 4Y0VA 2PSEA 5DTRA 5FEMA 4CCYA 4UXIA 5IT9M 4BKMA 3SJZA 1QXSA 2KHZA 1UQUA 4U2FA 3SGLA 1E3JA 3SGIA 1V16A 4IKOA 3H3FA 1DAEA 2JDID 5E9AA 4UMFA 5L3QA 2CC2A 2GBCA 1Q14A 3JTMA 3KAJA 4FDMA 2VNSA 1I5EA 1D09A 4XWOA 1ND5A 1LPBB 4XUDA 1R8JA 1UBOS 1TL7C 3K9QO 5EC8A 2F3SA 2QYHA 1QJCA 2P4EA 5FPRA 2X6TA 1VF6A 1WN7A 3O4GA 2E3CA 2KM1A 1OIVA 5TARA 2XAGA 4JN6B 2A06H 3MCWA 3QPCA 2ZSDA 4PC1A 3TTXA 1MH1A 2WF5A 3U81A 4KFTA 5ESXA 3UCXA 4EH1A 3LECA 1BWSA 4E5PA 3H75A 1HFKA 1DHRA 4DV7O 4D6YA 1CS4C 5CTJA 5K3DA 3OTGA 4JYZA 1WLEA 1TIKA 3Q88A 1K8XB 3K96A 5F2KA 3ECCA 1IOWA 2EJBA 1GKIA 3ZN1A 2YFHA 2ID4A 1AD2A 4GGOA 4BGIA 2YIVX 4E5KA 4QG3A 3NT5A 1XNRB 3OOYA 2YINC 5D51S 1QYCA 1JAHA 3CW2A 4P92A 1E0KA 4G07A 2OHVA 3E6AA 3JY6A 1Y3AA 1SD5A 1KIAA 1CULC 2V58A 1KVRA 1L7MA 1GOTA 3E9NA 1J49A 4PYNA 2L6LA 3FAVB 2AC4A 1G21A 4ZYXA 3ZGOA 4BNNA 4RMJA 1F4PA 3CB2A 4ICGA 5BOSB 1H1TA 3SZRA 4MGKR 3PEWA 2NO4A 1JSZA 4Y6SA 3VR6H 3ZHSA 2G1UA 1IUOA 1GU7A 1QR2A 1MFPA 2O2SA 1WB6A 1OHHG 4CW7A 5A3QA 4PONA 5A3VA 1RRGA 3JVHA 4UE2A 3HU5A 3ML1A 1D2RA 4Q3KA 4ZHQF 2PE5A 3RYHB 1G2OA 4TXLA 4P30A 3T7CA 3CMAV 4IDNA 4RIHA 3H84A 3M49A 1VPDA 1KO5A 3JASB 5JSUA 2E49A 3C3KA 3GLFB 1Q90D 5ITVA 2XUQA 1DKMA 2YY7A 2D2CB 4QOEA 1CEXA 5L7TA 1GCIA 3BMQA 5AM3A 3F8WA 2O8CA 3OOJA 2N9UA 3SZ3A 4B44A 4A2PA 5IKPA 2RMKB 3D6UA 4LJSA 1Y6GA 5D5HA 3H9UA 3AR9A 4GG1A 4GPIB 3ELUA 3GN1A 3PN1A 3RJZA 2YBDA 4GKKB 3VTAA 4UTNA 2WQZA 4F71A 3ICOA 1IJFA 1GQFA 1RYNA 1SR8A 1T3SA 4X1KB 1DTWB 3RW0A 5LB4A 2C5LA 2R9AA 3WOVA 3RU9A 3QA3E 1AQJA 4OGQB 4DBLC 2RBEA 3WQRA 1E20A 3TETA 1W36B 1XEXB 3R4CA 5CBGA 1U2ZA 5KCMA 3LBNA 3UBTA 2OWOA 2CNWD 2HM7A 2QENA 2RSLA 5AJWA 4AZVA 2G5PA 4BKRA 5CBFA 1KI8A 4U6QA 3PXUA 4UCXA 2XE6A 4HNSA 3IXLA 4OJYA 2HBQA 3K4QA 3PWZA 2PWZA 4DDHA 4EMBA 4KFSA 3ET5A 5J47A 1WF3A 4RQBA 1M34B 4FP9A 1K3FA 2CUGA 1Z4KA 3Q3HA 4WZZA 4OI1A 3K1JA 3R74A 1EM1A 1I1QB 1EB9A 2ESRA 2UXXA 1W4ZA 3C8HA 3PGVA 1U3WA 4TYYA 4RTRA 2PZFA 1V8FA 1E79D 1Z4LA 2C42A 4HSEA 3ADBA 2AOXA 4IJUA 1YHZA 3T4PA 3U4HA 3K14A 4MSWC 3FD6A 5CJPA 3HU1A 1X7DA 2GN2A 3CC4F 1TU3A 2VDNB 4WKCA 2WM3A 4TM8A 1ZH0A 3QLVC 1JI3A 2VWHA 3VI3B 4FJ1A 3ZD9A 1CB0A 2OZVA 1IPEA 4P8RA 4A0GA 5AOVA 4D8XA 3M4SA 2CNKA 4OUKX 4JXJA 1E3SA 3R7NA 2Q68A 2YJ5A 2P4KA 2YRWA 3EWAA 1F9EA 2FR8C 1H7MA 1JA0A 2FEPA 4F3YA 4E4EA 1P7ZA 4MVJD 1KR5A 4NU0A 2J48A 2ZETA 1YMUA 2WP0A 4KGDA 3ZJZA 2G82A 1FJ2A 4FXOA 3ADCA 1V39A 3NI2A 1E5XA 4QPDA 2OGTA 3H2JA 5FBZA 4IWYA 3I92A 1WP7A 3U9LA 4ZVPA 4LJ5A 1QFXA 5CA3A 4ZT7A 1TMOA 3HDYA 4MVYA 2ZYGA 3T9DA 5EKUA 5HCIA 2XVXA 3EFHA 5U1PA 4G28B 4J0QA 4ZOLF 4Z5XA 1T1GA 3H16A 2HA2A 4OGFA 1HORA 4G88A 4EX7A 3F6RA 2ZP1A 2GBGA 4AF8A 1PG0A 4NV0A 5A2QM 3MJHA 4JQYA 3ORFA 4KG7A 3WAGA 1SF9A 5SYMA 3RUPA 1U0JA 2OUKA 3IAM6 2EZUA 3LFUA 5D6OA 1K7EB 1KJQA 1XPRA 1Z0KA 1K5GA 3RUEA 1IWPB 4EPVA 3DZGA 5GJVC 3NB0A 1QZUA 3SHTA 2H1IA 3L8DA 1ESNA 3G79A 3BH0A 2BRUA 2IQIA 1PHPA 2OHXA 2VCYA 1E9AA 4P0TA 4NH4A 5DNAA 1RAIA 1U8ZA 2DX7A 3J81A 4YN3A 4P3OA 2FJUA 4FMDF 1ODFA 4ZVVA 3CCRF 5HKKA 4EUFA 4NTWA 1MHTA 3AK2A 3ZCXA 2HMVA 1I2CA 4D4HA 4KACA 3NNSA 3KHUA 2JGRA 3LDEA 1MB9A 1UXHA 4NFLA 5BT8A 2A5GA 2CTRA 3KUCA 2ZT9B 2FWJA 1BROA 4M4SA 1ZJ6A 2OYCA 3IVAA 2YC4C 4Z7NB 2YV5A 5DYYA 3LYAA 3KSAC 2X22A 3C3CA 3HZHA 4L4RA 4BHTA 5BWOA 3AUFA 4JUFA 1VDZA 5KUTA 4B43A 3F7MA 2ZRJA 3SJBA 2G0AA 4RDIA 4HLQB 1RLUA 1NFRA 3RC3A 4WCVA 1P1KA 2IDMA 3LX6A 3OVMA 4HRXA 1C3LA 4CEJB 2NZWA 4ZYZA 2ZIUB 1J8DA 3LNCA 5FOQA 4ZO7A 2IPMA 4NYMQ 3NHWA 1BCRA 3G88A 4UOEA 4JI2O 5EVCA 1TM4E 4YCLA 4MP6A 4IEIA 1AX9A 3TKLA 4JZGA 2QRQA 2J4CA 3D54A 2GZSA 5IDWA 3W9UA 5AVWA 4L8VA 3QVTA 4BQPA 4XFKA 1K6MA 2W6MA 1AUOA 2YVQA 3D3WB 4R83A 1T4CB 3GLIA 1Y76A 2YC2C 1ZKDA 4I5FA 5TGDA 3KU4A 3L07A 2WNSA 1DC3A 1XD9A 1XDUA 3LUGA 1DCKA 3QXGA 5C4MA 3WNQA 3FTDA 1E1YA 1A9XB 1UEJA 1D1SA 3G5AA 4R2MA 2GNPA 1GKUB 5CX1A 1M6HA 3VO2A 2RJ3A 4XQCA 5JADA 4N5MA 1A71A 3QLUC 4MPPA 1T0HB 1BU5A 1FYFA 3OQIB 4ZEOA 4GZ6A 3VV2A 4AJHA 4Z99A 1Y80A 1VK3A 1QPGA 5JARA 2G67A 1MXFA 4JI7O 1UZAA 3O3NB 1XXHE 1WCXA 3E81A 3I6QA 4KO1S 3O9OA 2X9NA 4ENUA 2YIJA 3AF6A 3PRHA 2P62A 2GCNA 4BMZA 1SQBH 3V9AA 1JQ3A 4CDRA 5TJHA 4F85A 2JRLA 4JOBA 3VJKA 2E5LB 2GASA 5LNK1 2VJMA 1PI3A 5L9AA 3MUFA 2XUDA 1WPXA 1TUGA 3WGUA 3FKSD 4YFYA 2IW1A 1TOAA 1JYFA 1NH2B 2GGSA 2B99A 1H23A 3PHJA 1WF6A 3TWOA 4Z1MG 2YMMA 3D3KA 2BFDA 3B7WA 4ZQHA 1U99A 1H2MA 1J2TA 1YDEA 4TTJA 3WJQA 4ZU6X 1YULA 4J1TC 4RLQA 4HAVA 1ZL8A 4EJ6A 4AJ9A 1L7PA 3SY8A 5DBHX 4QPPA 4ARIA 1SB9A 1QHHB 4Q5IA 1YJQA 5TISZ 3VVMA 1N78A 2D0IA 5IAEA 3EEFA 2VSOA 1FSZA 3RSSA 2WHQA 4CLXA 4KQKA 1U3PA 3DAHA 4NIMA 3N27A 4G01B 1J2RA 4LWSB 2BSAA 4E51A 1GTVA 2GAFA 3DT6A 1L3BA 1DT9A 2VAXA 5JSYA 1F48A 1XJ0A 5JWPA 4CTNA 5FI3A 3N87A 2E6UX 4RIGA 1XRSB 2QJOA 3ZDCA 3CT4A 4LWZA 2ITDC 4M1KA 1GSIA 3JD2A 3V8NA 3SHVA 3NC0C 1OWMA 4TMYA 4WNAA 3UEOA 3EQ7A 4G0VA 5IM4A 3CX6A 4NBKA 3ZD6A 5EMNA 3TJZA 4P7FA 3WWZA 4QU0A 2CXNA 3E9ZA 4X9QA 1QDLB 1P9RA 3EVBA 2C95A 4BEJA 4MUFA 3S0YA 2GVDC 4B2YA 4QUIA 1KI4A 2HQRA 1YJAA 4WINA 1CN7A 3GNTA 3WTCA 3K5NA 3WYDA 1T8TA 4IZIA 1TCBA 1Z34A 2CLLB 2PXCA 3UB2A 4JP3A 2FPIB 3FPSA 4O02B 1IY1A 2QI9F 1E7SA 2Q50A 3C8DA 4G0NA 3IVCA 3C1UA 5ICCA 5DW0A 4IM7A 1K5SA 2CHGA 4GLFA 3RSCA 2GCEA 3Q8KA 3VU0A 4NZOA 1IM2A 3BMNB 2YJGA 3QGMA 4J76A 1YVDA 3T9AA 4OPHA 5LQKA 4X8OA 2ZWAA 1EK6A 3A1SA 3NBXX 2QTHA 3AEKB 3AEQA 1QG0A 3S70A 1E2EA 3VMMA 4EB6B 1PIWA 1FS0G 4NQ3A 1CQWA 3AVQA 3C4VA 3FPLA 3WLIA 3IOBA 3A0BZ 3GEMA 1PDWA 2C3OA 3I9LA 1VI2A 3NHZA 4P2ZA 1F0YA 2ZYVX 4IRXA 1KPIA 4OYLA 4V2UA 3GF4A 3DFZA 5B3AA 3T7EA 3GEIA 3UUEA 3RUHA 4RS3A 4WL0A 2VPPA 5IJXA 2IIPA 1VL6A 1GNVA 4HB4A 3SFTA 1PNQA 4EEXA 4WY2A 4OQDA 3VV3A 4X95A 2XVMA 3A6DA 3M3PA 1AV6A 1OOEA 5KLVH 1DK1A 1NULA 1PNOA 2LFSA 5CVDA 2PDAA 4B4VA 4LA4A 2XNDD 1CZUA 5GM1A 1BKYA 2RJOA 3ZGLA 2GSMB 3PT5A 1BDJA 2AR7A 3EPLA 3WGQA 3P4XA 1GRCA 1YQEA 4OAQA 1Q11A 1NQAO 1XJWA 4G4SP 1DPFA 3LW7A 4WCFA 2WIGA 5AW1A 2YN0A 1ADYA 3K9BA 2AGAA 4TKZA 2QX8A 4X5OA 4LC1A 1W3EX 3DZ8A 1PJ3A 1KQFA 3KHTA 4URXR 2E48A 5CXUA 1QVWA 4W9MC 5M2QA 5IDYA 2O05A 4G0ZA 1YBVA 2FCAA 3PT9A 1JR4A 1X94A 2LO1A 2AW5A 3DFFA 1M5IA 3ORYA 4CF3A 2EILB 3LFHA 1N2XA 4GWGA 4OFXA 2WV7A 1GU1A 1G0OA 3DBRA 3HO8A 1FQJA 4KBYA 4MDFA 3QELB 1X86B 3HGTA 3RYCB 4WLEA 1ZM3A 1PL8A 1FMLA 5EQJB 4BO4A 1SZJG 2AR0A 1Q7YW 3HY3A 2GNOA 1E5QA 4Y9UA 2R8PA 4TZZA 2WTNA 1Z37A 1LSSA 4MWGA 1RA4A 2QE7G 1YOVA 4D8WA 2GESA 3KBOA 3PPXA 4GMGA 3AG5A 2JC3A 3KVNA 5ALLA 1NVTA 5JD6A 3U3RA 1UEIA 1F3OA 4ZI5A 4FHDA 1MJGA 1EE2A 5DLEA 3PUVA 4MYUA 3EUAA 1V41E 4UVAA 1FAFA 3DWIA 5DEIA 2HSJA 1W5TA 4D43A 4JZYA 3OPNA 1Q1QA 4LYAA 3JQ8B 1PFVA 1HTWA 4A8JA 5AW5A 1G8YA 1XBIA 1BE6A 3NKVA 1A5ZA 2V98A 4TQFA 4IG4A 1L1FA 9MHTA 4S1VA 4AZ0B 4JGBA 3RF6A 4D74A 1X7YA 4F4JA 1V54C 1FP4A 3CQ9A 1T6YA 1VQ7V 1N2JA 1GGKA 2O0MA 1CEQA 1U40A 2WUVA 3RFCA 3UWSA 1UZLA 1WU8A 4ZV4A 2G9VA 2XADA 2LKDA 3DTVA 3H8JA 5E7QA 1OT5A 5ENDA 1QR9A 4AECA 4RV9A 5T64A 2Q27A 1ZN2A 4HZUB 5EC2C 4LDPA 2YKGA 1ISHA 4I55B 2WVHA 4DY6A 3C3YA 4I14A 2KJQA 4IICA 3CPWF 3B2EA 2ACEA 3OQPA 1YJWV 3VCZA 2H8CA 2OORC 3PUHA 1B23P 2AI3A 4DQVA 1E1QG 1Z12A 2VQFO 4IV5A 2H52A 2WT8A 4FINA 1QWSA 2Z9BA 2QEQA 2RBGA 5J2UA 4DR1B 1A4IA 3VX3A 5EQDA 4DABA 2DKNA 4K86A 3KDAA 3L6OO 1H2XA 4XDJA 2DHRA 4BNKA 1RRVA 3AONB 4FLEA 4MR7B 2Y77A 1VP9A 2HCFA 1VQ5V 3BJEA 2FG5A 4TWIA 1ZGAA 2BM0A 4HTFB 2XBMA 4TROA 1CXZB 2B5WA 1FBTA 2O6HA 5CLHA 4P54A 2OGZA 4RPLA 1E4EB 4KX5A 1ZOSA 2QJFA 3WLEA 1XRRA 4K26A 2O2DA 1Q0ZA 4GYKA 5BN5B 3QXCA 4GXNA 1HBJA 4MW1A 4IOLA 2KSQA 1X1TA 4HEA1 2ZUBA 3SQXA 1ZGBA 4JTAB 3OTQA 1HEIA 2OV3A 2Y05A 5KJ6A 3H42B 1LFDB 1MCZA 1NJ1A 3I2YX 3JAKB 3K1TA 3CGGA 4JI5B 1C8LA 1HTTA 5IU6A 2VWQA 1CJCA 3ASUA 1EU1A 2QDXA 4Z2AA 4RFLA 1DOAA 1DBPA 1YL6A 4LBZA 2Q9AA 2GPWA 2R8RA 1WZEA 4HGZA 1QDUA 3B1ZA 4POOA 3ZDEA 2GZ2A 1AE1A 2AOVA 1J23A 5G4VC 1JSRA 2I6RA 2I34A 4TYMA 1DMSA 4D2IA 4MGHA 4JYAB 2Z2YA 2AN4A 1QQBA 1R0CA 4LR3A 2P6NA 4E5VA 2UZ3A 5IEJA 1S3IA 2OTLV 3FFWA 4BJ5A 1SKQA 4F4DA 3BFRA 3PQ8A 3A1VA 4CQLA 3A6JA 3M6IA 1I3MA 4X1IB 5A71A 5HZMA 2XF8A 3ZCUA 5G0SA 2QRKA 1IY9A 4HRYA 4ZTZB 1NNEA 2QZPA 4TRJA 1SXJE 2NTYC 4LY0A 3BPZA 4IIYA 2R1UA 1MJ5A 4PY2A 2Q7OE 2OT3B 2Q69A 3CUSA 1V35A 3CUEF 3CXCU 4HS9A 1EFDN 3K2EA 1KFKB 3CCEV 3AL2A 3KCXA 1M0SA 3QTYA 2VPTA 3OKFA 2V1DA 4BIMA 4BMSA 5AM5A 2IS4A 3PE6A 3NEYA 4LDRA 4H1TA 4R3WA 2AWOA 2IJIA 2C7QA 3ICEA 4IIJF 1FYXA 1NUSA 2Q1TA 4H6PA 1M2VB 3CZ9A 4G1MB 3FZGA 3L7BA 1SIOA 3UMVA 2D0PB 4PYKA 5L8VA 3KE9A 3S03A 3OE1A 4OLHA 4G1FA 4FLUA 2RGNA 2PZJA 3E3MA 2JFYA 1R1MA 1AGXA 4M8NE 1PGJA 1TZMA 4MHTA 3EMKA 4RPHA 2YYYA 4OP2A 2CE2X 3DPSA 2WD7A 4M7OA 1FK8A 2WIDA 3RKUA 2NN3C 1TU0A 1DIBA 4MTFA 1JGTA 3O6VA 4TUYA 1GX1A 1K7XB 3KUKA 1P9WA 3T7IA 5JCOC 1FP1D 3PFFA 3U4MA 2AF3C 4Z3DA 1PZGA 2J4DA 1A4XA 2BEVA 4QGAA 5FWXB 2ZPTX 2BGMA 1TTPB 2XGGA 3BERA 1D9ZA 4XI9A 2B34A 3TTUA 4UC0A 3TQRA 4G0WA 4AY5A 2Z01A 4L0MA 4KGXA 3DUFB 3AR7A 4DUYB 3F46A 2WUFA 4AY4A 2GYVA 4TVSA 1SIUA 1LQUA 3EX7C 5IFLA 2X8LA 1BS1A 3VU9B 4RUKA 2O8DA 2A7WA 3K9AA 4YPVA 2ZJ1A 2NVWA 2JW5A 1H22A 3NO4A 2DE0X 4BJ6A 1YBHA 2VCEA 1NAIA 1QG6A 2XUJA 2IYQA 4Z4GA 2JAOA 5T57A 3KT6A 3D2AA 1TYEB 3HKCB 2VEOA 3F5TA 3PLAC 5HDBB 1VPTA 4ZRMA 4NAVA 4XASA 4IDOA 3NOVA 4MI9A 3L9XA 4PS1A 2FDRA 2QA5A 1DO2A 4MTOA 4X1OA 1NBEA 1M8JA 3W9YA 4LF7B 1L1QA 4UNPA 2XSZA 3KWLA 1KSGA 2J3JA 2VYQA 1X0XA 3HHPA 4HOYA 4PYOA 3BCCH 3N8DA 2F43B 2O2CA 5G1OA 2Y4TA 2BUAA 3EQ9A 3T1QA 5CYGA 1B73A 4L07A 3U44A 2NT3A 3JWHA 4RYDA 2W2QA 1GPH1 1YCFA 2QVXX 2APJA 1MKYA 1RHKA 4YP6A 5I4KA 3N3AC 3DHNA 3N2KB 1ULUA 3M6FA 5I7RA 3Q8MA 3R3WA 4DJTA 1Z13A 3ZNNA 1XXHA 4UFPA 1DI0A 1CJTC 3B1XA 3W3AA 5IYZB 3LWQC 3A1EA 3TN7A 2WINI 3QHQA 1TQDA 2VO1A 2ALJA 4G5XA 5CA0F 1S8AA 4J0CA 4PRKA 1CUWA 4LJ8A 4QXAA 4MJ3A 2ERCA 2MSDB 3RBAA 4TSFG 2V97A 2ILTA 3AHDA 1QFJA 4XIFA 1IJEA 2Y1FA 2EC5A 3AEUA 1A9OA 3NRJA 1HDGO 4ID9A 5LZ8A 3V8MA 2R48A 3KHNA 5IUJC 2Y76A 3GNQA 1YCHA 3CCUV 3KSMA 3UMFA 3DVAA 4X3LA 3RC7A 1RRPA 3U3ZA 4HYOA 2ZVYA 1WXHA 4ISBA 2HMYB 3O0TA 1XVAA 1YKFA 4O4IA 3P9PA 2P78A 2QVGA 3SIPA 3ZOZA 3GBSA 3NBAA 2WSSA 3W8NA 3E9CA 3RRJA 3NHMA 2VZ9A 2O20A 2Y92A 3BN3A 3WGLA 1AG9A 1N6PA 4OI2A 5B1EA 3N86A 3EJWA 1BG6A 2NNLD 1FUUA 3KQUA 1GPWB 3N8KA 4GVPA 4H0FA 1VKOA 4DBZA 3OP4A 4MVXA 1M2JA 3UK0A 1Y98A 1YS9A 1AXGA 4XUGB 1AKQA 3IUSA 3JZFA 1HR0B 2H8KA 2R96A 3ZMVA 2DWDC 2XT6A 1WE2A 1HFJA 4FMTA 1HNZB 2AJTA 1IDOA 4JKYA 2WRZA 1DE0A 2JLQA 4IVNA 2CUKA 1VLLA 3MLBA 4MHSA 3GU3A 4URZR 4XA8A 5FI0B 2HMWA 5FHQA 3H4TA 4INJA 2GPJA 3RRXA 3MVEA 2M1XA 3GYGA 1YC2A 1NUPA 3MAJA 3ONFA 3PTAA 1NPDA 3SPGA 1AHIA 1VHWA 2CBZA 4KQGA 1YB6A 4BIIA 4BU1A 2DH5A 2DYRB 3BG5A 3AIIA 4KLRA 1KY5A 3S0HA 4CQMB 4H7IA 4B6RA 4MRNA 4B6OA 1SHTX 3OX1A 1F1JA 4TYPA 4I4TF 3ZDDA 2QQFA 2Y0IA 221PA 4QJ5A 4H15A 1VE3A 3T5BA 3TDNA 3BIWA 1FRZA 4L5IA 3IT3A 4KN5A 2LGQA 3R3VA 5LSAA 4K8OA 3S3XA 4J1QA 4Q3EA 4D4IA 2VQDA 4PHGA 4K28A 4K5QA 2I03A 5EMMA 3CXUA 2QVLA 2CNBA 1O96A 1VQLF 3WG9A 2GZRA 1R3DA 4YQFA 2H0RA 3I6YA 3AR4A 2RDMA 4E7PA 1BE3H 3LUHA 4PIMA 3CYFA 4DV6B 4Q93A 1UK8A 4REMA 4B3CA 2VDUE 4ASUA 2DFDA 4AJLA 2IEYA 1JDBB 4UHKA 3IESA 3CWQA 4U0KA 3JYOA 3UAWA 4FVMA 2P2GA 2NTVA 3MGAA 2FMHA 5TC4A 3V32A 5A5DA 3HDGA 3BILA 5DXFA 4FILA 3DHVA 5AKXA 2RB5A 3GJ8A 3ZQKA 2WT4A 2A0YA 1XWIA 3IAS1 2XQJA 3DW3X 2HVYD 1E1LA 4LMPA 3N6XA 1OTHA 2X0KA 5GGXA 3ABKB 1F6WA 4DG9A 4LRSB 2Y4OA 2CNDA 4D92A 3E03A 1G5PA 4YT2A 4UUAA 4R1LA 5AXDA 3A9TA 2HA0A 2BTOA 4JQCA 3TIFA 4A73A 1O0SA 3W4JA 5FL7A 3WL6A 3Q7IA 5DPMA 3K59A 3E89A 1DF4A 2JGIA 3LF2A 1RDFA 4D57A 3WR5A 4IS3A 5C53B 2ZRIA 1ID8A 4KODA 4L8WB 4WEOA 2QAGA 3P2OA 3NORA 3PJEA 3LQ1A 2VWGA 4EENA 5DWQA 2IPNA 2NAPA 2FW9A 1CUGA 2PGIA 1QRTA 3WLAA 1AKRA 5LWQA 2WICA 3AFNA 4GI5A 1MORA 2PA3A 4ZJPA 3QTLA 1F0PA 1K7CA 1NN0A 2KI5A 3GRZA 3Q8WA 4OHWA 4PQFA 1UXJA 4QUKA 4HJXA 3RS3A 2VA8A 4PZUA 4I99A 1GZ7A 3QMVA 2GYUA 3B6EA 5BWMA 4R69A 2YWEA 4V1CA 1XHLA 2R6HA 4BT5A 1K34A 4ZPJA 3CPHA 5AICA 3G0CA 3EFOB 2CLCX 2HFEC 1FW8A 1W29A 4YUVA 3AVPA 1WXQA 1R12A 1HR0O 2DUNA 2ZB2A 1THTA 3VGPA 1KZ7B 4IIGA 1PSZA 4DHWA 2CVFA 2QVZX 3OEEA 4LYEA 4A1FA 1ND6A 3L7OA 3CR7A 3O74A 5FFNA 3DLHA 1BH2A 1LX6A 3TZQA 1UDCA 3VYWA 2ZXUA 4B71A 2HH9A 3C8ZA 3A2MA 3P8ZA 3WOHA 1UC5B 3GRRA 4INAA 2V5VA 1QVAA 3G2PA 2D2EA 1C80A 1OI4A 3DBHB 1HDCA 3MB8A 3EF0A 2WWVD 1Y4MA 1JG6A 5KHJA 4K9RA 3OD1A 1ZD8A 4OAOA 2FZVA 1TAUA 1S1CA 1WOMA 2DQYA 1XJQA 4CI0B 4WZ6A 5BSWA 4LVCA 5H81A 2FWIA 4OGLA 1JE0A 4X7PA 3J80M 2LUOA 2UXBO 1AQIA 3WDLA 1XOUA 2FB5A 4N40A 2EGHA 3H1IH 2ADPA 4M8KA 5FULA 3HUTA 1SWVA 2G6TA 1BWQA 4CKCB 3DG9A 2P5TB 1K4MA 4K2AA 3VQYA 1KKLA 4MYCA 4DV6O 4I5SA 4CKWA 4UTVA 3G6KA 1JWLA 5JSKA 4L4UA 5AXAA 2ZDGA 3E3OA 1Y4SA 4OL0A 4FYVA 2LTAA 4C4WC 2WTXA 3A1FA 5JECA 4IV8A 5A1JA 4RTPA 1QS0B 4WXPA 5JZSA 2R751 1UH5A 3EJ6A 1RWQA 4MVJP 2PLWA 1UJMA 3S8MA 2BEUB 5GZ6A 1RSOA 5LM3A 4GVXA 3ZV4A 3G8YA 2I6TA 4N0QA 4H4CA 3W77A 4WJKB 2IVFA 2A5FA 3FNHA 5DEOA 3K1AA 4BMOB 1K8AW 1JLSA 5EJGA 6AT1A 4PLHA 5BMVB 3JYPA 5ICMA 2C99A 1H42A 4FB4A 3L05A 5C8YF 4CTMA 2X42A 3CF6R 2CW4A 3N76A 3GWGA 2QMZA 3TGLA 2QRLA 5E2BA 3FZQA 4OM7A 1SUEA 2W7TA 4F8YA 2MMGA 2GJ9A 4JV5B 5BY1A 2P75A 4I50A 3B38A 4MQ6A 2RBKA 4G4ZA 2D1QA 4LGVA 4DRXA 3KLPX 1BKSB 3R75A 2F17A 2I65A 4DWJA 821PA 4S1OA 2OD7A 4PG8A 3PWTA 2D3OW 1AR5A 1GO3F 5H7XA 1UM9A 1KNKA 3BYZA 1P0QA 1CY8A 2P6MA 3QXJA 1H47A 4QYXA 4LXGA 1OU0A 4WFIA 1DMRA 4CM9A 2QTCA 1GUFA 3K0FA 2YIBD 4MWSA 4QNMA 1G6UA 1I80A 2OWDA 4UPEA 1P4JA 1NVAA 1ZIPA 3DTUB 1NVBA 2GI4A 3MQWA 3V7EA 3BB1A 1Q15A 3PR3A 4CKBB 1DUVG 4L5CA 1VA5A 2W8BA 2QTOA 1Z26A 2R8ZA 4I4IA 3N2GA 3I2HA 2XGSA 1NSYA 2F3UA 4HGPA 2REOA 1OXTA 1YR2A 3SU8A 2OL4A 1YDHA 2GN9A 3VOSA 5EYPB 3HLKA 1NOJA 1MO3A 2NGRA 3A9UA 3GJ3A 2WFZA 1AKNA 1MMMA 1Y7HA 4RTLA 4J91A 1QU2A 4R8RA 2ZULA 5LOVA 1TJ4A 3KT3A 4ZI7A 3L8HA 2JLZA 1XMSA 3H97A 3E35A 4NY1A 1G38A 4DCTA 6CHYA 2B1QA 3AETA 5M7EA 3GT7A 5JAUA 5KMGA 4H3VA 3RHSA 1LCIA 3RUCA 1N32O 3QVSA 3KOOA 4F92B 1HG1A 3G2NA 1RYFA 5LQDA 2WAYA 3L7LA 4LZOA 1FFGA 3MJCA 1BHQ1 1CPYA 2OT5A 4C82A 2ZQMA 2I8CA 1FBNA 3I45A 1KI1A 1L4KA 3VQXA 1M67A 3GH1A 2AN3A 3T3IA 4FOPA 4Q66C 4WHMA 4EF6A 5I9BA 4KWTA 4GMKA 2O6LA 3FJYA 3OZSA 5JMTA 2UZ0A 2GX6A 1YJBA 1R9MA 4WGFA 3VYSB 3I1JA 1U1EA 4DQUA 3HA3A 2HDOA 2Q7DA 4PPFA 2WLNA 3CH7A 2NZ8A 3L71H 4A8PA 1JQDA 2OBFA 4CF5A 4HYEA 5K0NA 1QIMA 3UB3A 3JR3A 4BW5A 3W79A 1IB6A 4HADA 3GJSA 3AV3A 3ZCPA 5LLDA 4WK0B 4DTIA 1U97A 3WX0A 2ZIAA 4BNMA 5GTIZ 3UMMA 1G8HA 2XXAB 3Q2KA 1GK9A 4KIJA 3LGXA 3GNLA 4IO0A 2Q9UA 2C84A 4B3GA 1II0A 2PGDA 1GO1A 4E12A 3LOPA 5B7PA 2QROA 4C0KA 1E0JA 1V6AA 4GEGA 5FUMA 3UT5A 1WXEA 4J1NA 4AQYO 4M9XA 3LCVB 5DRYA 5JNRA 3C16C 2Q2WA 4ERXA 4HZIA 4OI4A 2Q28A 3ON1A 1Y1RA 3AG3B 4JODA 2BOCC 2J3LA 1NSTA 3LH5A 5GANK 1FUYB 1VRVA 1ZUHA 1U3FA 3G02A 5ALKA 5CT9A 1KIFA 3WIEA 3NQ41 3TF5A 5J40A 3MTQA 3KB2A 3U5ZB 2X7RB 3G80A 1YB5A 4M3NA 1BQZA 1MIOA 4XD7D 4R1OA 1EZJA 3HG7A 6ABPA 3U39A 1AR4A 2NUBA 2UVPA 1EXVA 2ZJOA 3PXDA 5ICEA 1IB0A 4BQEA 3ZHBA 5C35A 1B3QA 2XUPA 5KNBD 4JSTA 3U10A 3WSTA 3B4SA 3IKTA 5B4TA 3PI7A 2JVDA 3ZDFA 1P84F 1OWNA 1JFTA 4FQ5A 2NSLA 1I4WA 4BGVA 3QW2A 4YBZA 2PMWB 3K2BA 1W5FA 3DMTC 4LF5O 1RSZA 2XDWA 5TV2A 3VZSA 3OWOA 4GSYA 1ICEA 3I56V 3W5UA 1E98A 4UZSA 2YV4A 1PTJA 3IS3A 3U3MA 1NVMB 4D81A 2QB5A 3HCBA 4ZV9A 5JJNB 2PX4A 1V11B 2G77B 2YV1A 3JQ6A 1SEVA 3V1LA 1TAGA 1UK9A 3V46A 1JRLA 5AUOB 4UHDA 3B2EE 1G9SA 2BM8A 2GJAA 3IP9A 5B1BC 2HDHA 1E58A 3CEAA 3RGBA 3K2IA 3VKVA 2B35A 5J2TB 1L7VC 2J9RA 5HKLA 3VDMA 2XH8A 2H4YA 2ZYSA 4FE4A 4PBSA 3ZXIA 4TXNA 3FGPA 2XOXA 1QLEC 2NU7B 1JEYA 4RCZA 1E99A 1CUUA 1J25A 4QGPA 1X15A 3P9SA 4WNCA 3LLUA 1CHDA 5DGIA 3RTAA 4LQDA 2P5SA 2QRZA 2RGBA 3W7TA 3CLRC 4M37A 5IASA 4GRIA 3PSAA 4I3FA 2LCAA 1F2UB 2HKIA 5MDHA 3CY6A 1GDDA 3RJTA 3RS2A 2VRZA 4PTYA 5ESRA 4POAA 1BXRA 3MJDA 2W6JA 1QQTA 4F93B 1QH8B 2AXPA 5MN6A 2JHAA 4O08A 3QWAA 4LMBA 1US8B 2A9PA 5LP6A 3OA2A 1YVWA 3TRFA 1OV6A 2QM8A 4C4YA 5KOHB 4EY4A 3KJKA 2ZIOA 4G4IA 1SA0A 2GPBA 1H2AS 1GLVA 1EWRA 2WG0A 3WYNA 2EBUA 1YRHA 3WB2A 3D6AA 1GPNA 4KZKA 4E5YA 3N0RA 4MQLA 1M8GA 4GLBA 2VK1A 2X5OA 5CHYA 3RTEA 2PWAA 2WNIA 4URWR 3W2IA 3DOCA 3OE5A 3S0WA 5B8FA 2JGKA 4X71A 4QD3A 4BIUA 3TK1A 1DRWA 1E2DA 2AUTA 3FD8A 1JA1A 3RSHA 1NIJA 1FFEA 5MHTA 4QYSA 3Q5GA 1OTYA 2Q0AA 2M6SA 1VI6A 1F7VA 1UWKA 2AXNA 1PF5A 4YJ3A 4HJRA 2FPSA 2CXTA 1NMQA 1H48A 3PC8A 5T4HA 3PUJA 2ZXEA 4XCXA 1CY2A 3G6WA 4L0CA 3BFPA 1IN4A 2VGNA 2ZSHA 3EA5A 1AI4A 3GAZA 5L3BA 1E7RA 5CW1A 1W46A 4LXXA 1OHHD 3OFJA 4YRLA 2ZBFA 5FTJA 2ZS7A 1EFTA 1XNRO 4OK5A 1O87A 2W11A 1CRQA 1JG3A 4JCOA 2D2IA 1XMQB 4G6ZA 5KVCA 4PYQA 3OIGA 1WW8A 4MW5A 5DLYA 2Q4DA 2QMQA 4I8IA 4R31A 1UWCA 3HJRA 1Q1NA 2BGWA 4K6MA 3CH5A 3VC7A 2P40A 2YRFA 4UHHA 5EWMB 2X8JB 5K8JB 3O8QB 4ZAWA 3KQOA 4D7SA 3PFWO 1NV8A 5BMOA 3EHEA 3EIXA 3RW9A 2GHQA 1H2FA 4B08A 3M9WA 4Q9KA 3GUYA 1LBHA 3SEAA 1U65A 1LJUA 1OCZC 1PV0A 5MN5A 2XE4A 1L8DA 5SV2A 4K1XA 1NBHA 3VYVA 5DXAA 2B82A 1PYGA 4CGZA 3T3OA 3CLHA 4EA6A 3OHSX 4M53A 1G6KA 1CUYA 4ZZ1A 1LSUA 2OYQA 1LDYA 3UFXB 2NSJA 3WE7A 1SS3A 3L1KA 4HNVA 3RSQA 2O8EA 3LPCA 4N76A 1K1EA 2DWQA 2RCVA 3QG1A 2EIJB 3F0GA 2ORIA 1KAHA 3G82C 4GOJA 1VQOV 4BEBA 2I66A 3WLKX 1BMFA 1RXWA 4B74A 5EHIA 2FYUH 2HRCA 5ALGA 3BH6A 1XVLA 4GKKO 1UPBA 3LT5A 4LY6A 1Q83A 3K0BA 2P4HX 5T4FA 3W2EA 3EDMA 5DV9A 2M6LA 1CUHA 4ZCPA 3AOEA 4TV8F 1QH1B 2Z3WA 1AU9A 1TD9A 1U0TA 4BX0A 2X6QA 4LFCB 4CM4A 2ZW9A 4RETA 1FX1A 4EWLA 4BFTA 1OFGA 4BFSA 2HRQA 4OU5A 4J16A 3ZHZA 2FUKA 2AFIB 2WHEA 5A4DA 1N1EA 4A0HA 4D46A 3REFA 1DAFA 2BKXA 4N12A 3L01A 4P4UA 2IGBA 1LVGA 5JFOA 2GM3A 3KR9A 1TKRA 2G83A 2JIZA 1U04A 3JQGB 5IKOA 1YZQA 3AWIA 5JNLA 1W6RA 4MLCA 4E08A 1NKSA 2WUEA 4IWXA 5H9WA 5JY6A 1CY1A 1IN6A 1GGHA 2O48X 4F5YA 1TVCA 5DT2A 5GIOE 1ISRA 5JXJA 3IQWA 4BYGA 5FKJA 1Z0FA 3QEOA 5K8LA 4F91B 4FVTA 4X94A 4N54A 2VIIA 4NEQA 1KARA 2F9MA 4J9YB 2J9FB 3IPXA 5AM2A 3GVIA 3WVNA 1IBSA 3VI6A 3J7TA 1TQHA 3AQIA 2C7VA 1IAQA 3HJNA 1AM4D 3DWFA 5EJMA 2B5UA 3DJYA 3EISA 3R0VA 3F6EX 2QD3A 4CU2A 5BW6B 4H37A 1TW3A 3KCYA 3IQEA 1GDTA 3IVRA 2PJUA 3SPJA 1ACMA 4Q24A 2V6FA 1UBNA 4BT4A 1VRWA 4ARSA 2X1LA 2V3WA 1Z7EA 1E3IA 1QK3A 3HCOA 1J00A 4WV3A 3LHSA 3K70C 2V5UA 2I2DA 2CSXA 3FWYA 4MUYA 4Q16A 1LVHA 2OXCA 4B7CA 1SWWA 2VH2A 1FNCA 2FJ0A 1PSDA 3RANA 2H4XA 4H31A 3UHAA 5L7WA 4NMMA 2AX4A 1EK0A 1A9RA 1CUEA 5TVKA 3T34A 2EIMB 1YMQA 5CAEB 2IEGA 2XOKG 4MWEA 2P9HA 3ISTA 4KXXA 3KTFA 3M99B 1X8JA 1GO2A 4QPJC 4EPTA 5AI6A 4YRKA 3QUBA 4QFBA 3F96A 4OXYA 2ZWOA 3ZWBA 3DV0A 1RPZA 2ZWIA 1PS0A 1QKKA 3SCZA 2I29A 3GP5A 2Y27A 2YQ4A 4HX9A 2X86A 1M9NA 4MRVA 1WA8A 5CXSA 3S29A 2H7XA 1JJAA 2E85A 4HLUC 1DC6A 4UAVA 3HV2A 3G0HA 1KQGA 3KAQA 2GCOA 4KP7A 1UINA 1VB3A 1DRKA 1ZUNB 3TGWA 4OJMX 2HPHA 1O54A 3NOOA 1UKYA 4UVIA 2WSYB 2QORA 5WRFA 5CRIA 4KNYA 3AO0B 3PTZA 1GO0A 3UUWA 2JA2A 4IJKA 2ONZA 2B98A 2JFUA 1FXUA 4CIXA 3BE8A 3G9TA 2HGZA 5HOEA 3UYLA 2IBTA 2QTNA 4BX9A 4K6HA 2VT7A 1YU6A 2AOUA 3RFUA 4MMZB 3TVDA 3VVBA 3V8BA 1S72V 3VZCA 3ABUA 4G37A 3Q7SA 5JEEA 3C4JA 4UFNA 1IXSB 2BDUA 3DYIA 2QL5A 4X54A 1YRAA 1L8QA 4UEKA 3IP5A 3V8EA 3LDGA 3KQVA 3AXTA 4ABMA 2D5LA 3R76A 1GGNA 2W0MA 3TBKA 3NG1A 3UJNA 2WKPA 4OQLA 2BHNA 1GLNA 4YB8A 4BLRA 1FFXB 1NZ6A 4BAZA 3DDSA 3HCRA 5EGSA 4JR2A 3O9MA 1QB8A 1N6KA 3TNDA 5KYUA 2VK4A 2QZJA 4HDMB 2WSLA 4JFRA 5CNMA 2ECFA 3M1YA 4YIHA 4N3GA 4QPZA 4ZGWA 1Y5NA 1GWNA 3THWA 4CLRA 4DR6B 4QOHA 2YHBA 3E2PA 1EUDA 4B6GA 2YJNA 2CMHA 4DNFA 4KFMA 1A8QA 2C2YA 1AKMA 1XU4A 3CFYA 2IOFK 2KLHA 2GDSA 3QTCA 2GZ3A 3IAAA 3A28A 4E03A 5C81A 2ZRFA 2RHHA 1UEXC 4LXUA 4JXZA 1XMIA 3I2IA 3EVTA 2FSIA 1UP6A 2RHMA 4ZODA 4FBMA 1E32A 1G4AE 1XROA 3UGTA 5DBEX 3D6JA 1P18A 5LIRA 2Y1OA 3R3ZA 2NXWA 1GTG1 5L3EA 4EW1A 4L85A 2GVIA 5FWYA 3CLRD 4ZVOA 4UUQA 1V8BA 2PK3A 1KP9A 4RJJA 3X1JA 5LQNA 3ZE2B 1AR1B 3Q40A 3ZVLA 3MUOA 1YWGO 4B48A 4Z1MD 5TY0A 3NALA 5H5JA 3S2SA 4MUKA 2P4UA 2J3KA 3HDTA 3HVIA 2PL1A 2IHVA 4KIGA 4KFRA 3AF4A 3IEQA 1TTTA 3E7FA 5B58T 1MAHA 3WK9A 2LP7A 4BLVA 3DAOA 4QTXA 3UICA 1EA5A 3D5EA 5KPDA 1YK1A 4UJ5A 5DHSA 2E5LO 3AYXB 5C8VA 1H4SA 1AZWA 4PO3X 3Q3EA 2I1VB 1PR9A 3DE0X 3EXHB 4R9UC 3A6FA 4Y6RA 3UXHA 1AI7A 1F9AA 3COSA 2M32A 1LBIA 2NMVA 3TECE 1JIXA 3IP8A 5J4LA 3T5MA 1D0VA 2Y93A 3WGNA 3GJ4A 2ODMA 4AU1A 3P2IA 5KVSA 3D01A 5CA1F 1ECGA 4H7DA 1XVIA 4L28A 3DKRA 3CCSF 1W2HA 3UO2A 3FY4A 1RLJA 2XVAA 1OREA 3E18A 4RVGA 4MR9B 2UZ4A 3FNFA 3TE6A 4NESA 4U2GA 3CXRA 1ZH2A 3RE3A 4BGDA 3KXIA 1L5ZA 3NUZA 1IXZA 3KU1A 3FI9A 3PKZA 2ZVQX 2WJHA 2G8NA 1WY5A 1X52A 1ZI6A 3TSCA 5HF8A 3A4TA 3IEIA 4KHPB 3WLTA 4E1AA 3DBOB 1E1NA 1OROA 1HPLA 2GDZA 3HP7A 5B57C 4C7XA 1G0NA 4FDAA 1JEQA 2JEZA 3NM4A 4LBVA 1X19A 5CK4A 2VG8A 4OUDB 1N0JA 2HO5A 5KINB 5E6SA 2BKEA 1IVYA 1U7ZA 4D3FA 3KB6A 2X23A 3DDWA 1EGQA 1UPXA 2WLIA 5ALXA 3IBTA 4ZVKA 1YVEI 3WL3A 5SZKB 3L82B 3P20A 5BOVA 4ZGGA 1D8TA 2FLVA 1GD1O 4RKRA 4PINA 3BXXA 1PM9A 1JR9A 1KYTA 3T99A 1E5LA 4NC9A 4YH1A 5EG5A 2XTJA 5TGZA 2OAQ1 2J6CA 3DONA 5HQTA 3M6AA 3T9EA 1P3Y1 2FFBA 3KLMX 4QPNA 2IUTA 4Q3OA 5LWHA 3USCS 3FUCA 4UVHA 1U31A 4H33A 1DEHA 1TTHA 5A03A 2QR4A 4DR6O 3RAJA 2IY7A 2ZBQA 1K27A 3ICWA 3BD7A 3L73H 1U9IC 5KCZA 4BRUA 3GYBA 4MQFA 1GEEA 1QE0A 1QOZA 3QX3A 1XZBA 4Q7QA 2OCAA 5CLJA 4EG8A 3VTZA 1EEXB 1CUBA 5DM2A 1QQ6A 1UXIA 5LQJA 4YJ2A 2IAFA 1ZUQA 1Z18A 4D7TA 4CC5A 3WS7A 2AZMA 1MRZA 3QHPA 4Q3AA 3OWXA 1TO6A 3CCCA 1A9ZA 2IOYA 1DSSG 3UWDA 3BF7A 1PD3A 4DGQA 3ANYB 3Q0EA 4EY8A 1UMCB 2QTPA 2UZAA 3HJFA 1WZ2A 1YUBA 2GEVA 1OI7A 1IZ7A 5GOTA 1JU3A 1LU9A 1OF1A 1SQFA 1AK2A 1ZIDA 1U7HA 3C4QA 2F2TA 3CX8A 1T4GA 2DUMA 3DSRA 2H92A 2CZGA 4L4ZA 3JWEA 4MUGA 5CB4F 3NC1C 1W6UA 5LGUA 3H4MA 2GVZC 4M7RA 3EYWA 5AOBA 1YZGA 4JASA 3ZYCA 2PVPA 2JFZA 3CVOA 3P4YA 2Q9BA 1XAHA 3SXUA 4W1SA 4ZDWA 3IOMA 2BY4A 1SXIA 9ABPA 3U56A 3ND6A 2CL5A 4BVLA 2R9IA 4GM0A 5H3CA 1CYDA 1WKCA 2WPDA 1N2GA 2YSUB 1F5NA 4C0XA 3ZOKA 4LI3X 3VKHA 1RBZA 4HSGA 1YH3A 3DDHA 2I7VA 2QE7D 5ELXA 4YYZA 1KMCA 4W8GA 2ISCA 4UTPA 1WEKA 3Q5DA 1MRNA 3E15A 4Q0MA 2Q4OA 1F2TA 4XM1A 2DCMA 5KBYA 3AVVA 3RSLA 4CM8B 4BRWA 2Y9MB 1PWXA 4LOKA 2E74B 3P94A 1GV1A 1B2LA 4LSZA 1AA9A 3WIDA 4US2R 1ULBA 1ZWIC 3VOTA 5JVDF 2CGEA 2ZJYA 5JPDA 4XR4A 4LWQA 2ZD9A 2R8BA 2B5OA 1ATIA 5KNDA 5EJ2A 1P7BA 1RPJA 2P67A 4GPBA 3C74A 1V8ZA 2QKSA 2J3MA 4G4YA 1XJ5A 1NM5A 4FWBA 5EWLB 3C3PA 4DK1A 3DLBA 5BPHA 5D3ZA 2J87A 4JQZA 4BKPA 1JH9A 4Z0HO 1A8HA 4HC4A 3EC2A 1EUCB 1KYQA 3K70D 1U3LA 5H59A 5EGNA 3H2HA 2ZUTA 4WLVA 2FW7A 2XQVA 1NWCA 2HKOA 3UJDA 4J0IA 2VJNA 2RGCA 3TSOA 3TOZA 4MV1A 3T06B 4LE2A 4HNQA 1HWYA 2X7XA 3FOBA 5LBQA 4C78A 4MVJF 4K3AA 1RJWA 3LDUA 3EXEA 2RNBA 4HK4A 4RSGA 2HHAA 2IZ0A 3OCYA 4L87A 5B6PA 1E1QD 3WBFA 1FLDA 1M6WA 4X8AA 2CYAA 3ZLVA 4DNXA 5B3SB 3JATA 4E5SA 1J1ZA 1YITF 2C2GA 1T5OA 5KHLB 4MLZA 1WSAA 2HP8A 1I32A 4KN9S 3RC1A 3JCZA 2ZRDA 4EB8A 2ZBUA 1ZNXA 4GBJA 1KAQA 3BA8A 1NMEA 1WVIA 1FXKB 5IVKA 4XD2A 3VOAA 1CVLA 3T80A 3DSQA 4EG4A 5HJ2A 5U4XA 2RHWA 1Y5MA 4E3WA 5GZ3A 4UARA 2PFSA 1GT91 3CSSA 3ZC3A 2B4RO 3QJ5A 4N5LA 4PZYA 2BFMA 1IOLA 1Q5OA 1KORA 1PJBA 3O8LA 5LMCA 1R4NB 3CRZA 3ICCA 4B45A 2QI2A 3COYA 5FPTA 3GAMA 2QEXV 3GA5A 1H2KA 2NU8B 3RTDA 5LMNB 5B6JA 2HRZA 4DR1O 3ZNPA 3TLAA 4G3XA 1XA0A 3AKCA 5D01A 3QX9A 3E9EA 1USUA 4GOKA 2MINB 2R2GA 1J0BA 1NMUB 3OKPA 2PRJA 4B4DA 1YFKA 2BMAA 3ZO8A 1ZGHA 2BGTA 4B76A 1H6BA 1KO4A 1SCAA 2P8SA 2WJZB 2YICA 4N4AA 4ND8A 3UAYA 2EIKC 2O3UA 4BMNA 3SP1A 2AJBA 3HRKA 2V9ZA 3FUXA 2H17A 2GHTA 3GMSA 3KLBA 4MS4B 3WNCA 1ISIA 1I24A 5ECYA 4JUBA 4WFBV 2QM0A 5JNUA 3L0IB 1A82A 1OC2A 4WJLA 3NM5A 3T2MA 1RWVA 3IUBA 1II8A 4GC5A 2CLMB 2O07A 5EZQA 2V65A 1Z62A 1NONA 4NXMB 2JHGA 4JI5O 4MUJA 3IOEA 2B9EA 2Q7XA 5JRZA 4P86A 4EQZA 3M2TA 2AZXA 2FGKA 3S99A 1NMXA 5EPOA 2C1ZA 3VR3A 5AIAA 1LI4A 3V2GA 3EXIA 1ZUIA 4QYIB 2VYFA 3TLGA 3ZUGA 2HFKA 5JJLA 2P06A 2VK2A 3GJ5A 4NOJA 1T8YA 1QNFA 2QMYA 3RFVA 1KF0A 4JYAO 4B1FA 4AD8A 5F5XA 1KXJA 2CJYA 3D7LA 1PR4A 1JZTA 5INTA 1N33B 2J07A 3TZKA 2ZR9A 2CF5A 3AY3A 5YASA 1QX3A 4ZO6A 5BW8A 2PUBA 5FPOA 4GKBA 1QR8A 4RHTA 3CF4G 1SBZA 3TRHA 4EG3A 1DG1G 1J2JA 1P7GA 1BOOA 3KVRA 3O4VA 2QN3A 5A6SA 1DLIA 4EKEA 2VVTA 1SQ6A 5HM8A 3ZOPA 5TEWA 3OA0A 5IT4A 1DOZA 1OV9A 1YVRA 4ESVA 1NXXA 5TDHA 3O2QB 3O90A 3T1TA 3V55A 2A58A 4YCBA 3OZCA 3H5AA 4XYLA 3G0GA 3HUEA 3LD9A 1IATA 3NHJA 3ST7A 5AW2A 5M29A 3R23A 3G49A 2JHCA 2HHHB 2HIHA 5HX7A 4RTQA 1J1UA 5GAPK 2VC2B 2PGOA 1DO0A 2YXDA 4EQ6B 3KKMA 3I72A 4IGGA 3SF8A 4EFMA 2Q4TA 1BTOA 2CCJA 1T4BA 2I6QA 2CNNA 5AJXA 3O8BA 3T94A 3A4NA 3LC7O 4R51A 3GEEA 1C5KA 2HJSA 2OLJA 2XEXA 5C5CA 2PUVA 3MRTA 1DBWA 2CHQA 4UVEA 1L7RA 4Y7CA 4MCHA 4ZTBA 3QJYA 2QNRA 2PYJA 2IELA 3FDFA 2PS0A 4JL8A 3RHZA 2F62A 3Q7PA 1P5HA 3ZHCA 1V8PA 1B6TA 1B6QA 5B1NA 4TL7A 1XDWA 2MU1A 2VNHA 4DVGA 2A88A 4DUYO 3UM7A 4E09A 3MINA 4OPMA 3IV9A 1VH8A 2XB8A 4WDRA 3VC1A 1X7ZA 1E60A 1DXQA 2H54A 3VMFA 2DGDA 4ESHA 4P53A 1PVOA 1DAKA 4RTJA 3ETDA 2YL2A 1C8KA 2FY8A 7ABPA 4PE5B 3TW4A 5JCJA 4G1VA 1NKVA 2FMLA 3C85A 5AQEA 4E6PA 3EG9A 2OLEA 2IUYA 4JR0A 4D8TA 3BSSA 3H2BA 1JG7A 4TWJA 3P2MA 2PANA 1JHDA 4ZALA 3OFNA 1F7YA 4RTSA 3BABA 5ALEA 2O7SA 3UV3A 4PTZA 2OVBA 1KZ9A 4RVSA 3U1BA 3CKYA 3NWBA 1P77A 2BGJA 3W8RA 1H9CA 5C7LO 4Y2YA 4Q9AA 1TEVA 1U0BB 2HF9A 2PVCA 3RVJA 1C7JA 1KI2A 3LUJA 1GCGA 3UG6A 3VXKA 2FGYA 4CETA 4HGYA 1W5BA 3Q8XB 4LF7O 4C21A 2WQ6A 2IPOA 1YQWA 4C04A 5DWVA 1UODA 4QXQA 3LWVC 3N8NA 2B4TO 1NF2A 2BMJA 2VPQA 3ZTYA 2MQEA 3V4FA 1RQPA 1B26A 4TSFD 3AQ4A 2GMWA 1RLTA 3PUXA 8ABPA 1YUNA 4Y67A 1EN5A 3VR4H 2DM6A 3IA7A 5CCEA 2G36A 1XCGB 5E9JA 3THXB 5JLAA 5IWCA 1Y42X 3NUQA 2W6CX 1V8OA 4RJLA 1R3UA 4JLUA 4I1SA 8ATCA 1BD3A 1WD7A 1PZHA 3QOYA 2QX9A 3WBJA 4D4GA 1IM5A 2FPRA 2WWRA 1YFZA 4ER6A 4R9VA 1IRXA 1ZOLA 2BPOA 4BLUA 3EGOA 4UMDA 4LYJA 4ZJUA 1KUQA 2J0QA 1X7XA 4NOMA 2OLKA 2EAUA 3KQQA 3OJFA 1L4EA 2PJRA 1EP3B 5EQFA 4PGMA 2Y0DA 1PUIA 3PB3A 1CDDA 3FRJA 3R5JA 3GJQA 4JYBA 3INGA 2FKAA 2CTWA 3LU1A 4XAQA 1ESMA 3S2UA 2ZCEA 3EEQA 3W8DA 3ESJA 5JOQA 4Y2JA 5ECWA 1H2HA 1VQNF 5J4YA 1QO0D 2ZNJA 3U4GA 1GN3A 2XZDA 2Z5VA 3E7XA 4MK4A 3EE6A 4MW2A 1PFUA 5FTWA 1COWG 4FBLA 1XDZA 5KTYA 3W4IA 1M75A 4UKDA 4Q9DA 3KJNA 5HBRA 1ZONA 3DZKA 4LY3A 2R00A 3G7UA 4ZD6A 4HAMA 1O89A 3NTOA 4F45A 1WULS 2PX5A 3OZTA 4NCBA 4C5AA 1WDTA 2CV0A 2DHDA 1WZUA 2J7PD 3AVWA 4KQCA 1VQPV 4B83A 3AK3A 2FETA 1Q16A 1HY3A 1OXSC 5AM4A 2AIRA 3OM1A 4P3KA 1T5EA 1B41A 1LI5A 4BNDB 4PF1A 1HNZO 2C7OA 2V6IA 1X70A 1S01A 4NICA 3SJAC 1TF5A 4P4NA 2YIMA 2NZ2A 4BZPA 2EINC 2FK8A 3RS9A 1GAWA 4HKTA 5FWNA 2BFCA 2CHSA 2IKQA 1H8HD 3ZHXA 2HHCA 3WMGA 3UHOA 2B8WA 3FVQA 3UJ7A 4MPTA 1OILA 2XF2A 3MJSA 2VK8A 2RJZA 4YCNA 2ETVA 5FORA 2VDLB 5H5NA 3ZP7A 3TUJC 3CHYA 3G1WA 1IY2A 4DAOA 2BTQA 3PRYA 3ITDA 1YAJA 2Q5HA 2PD3A 5KTPA 2VHTA 1XKTA 1CUDA 2HIGA 2AX3A 3U1VA 5HIIA 1S76D 8AT1A 3BA9A 4UW9A 1Z0ZA 1YJ5A 1KMIZ 1D7AA 5BXQC 2ZTSA 5DGXA 3WRYC 2X1VA 1U1FA 3RV3A 2A14A 5EJAA 5TPZD 2R7AA 5G0TA 5L3GA 2VH5R 3DM9B 3EOBI 4IXWA 3ASNB 2XCUA 5BQ3A 3FFTA 5C5IA 3PC4A 1GCOA 2O8BB 4RDXA 4QBIA 3ZTTA 2IXTA 4FYYA 2ATKC 4DWVA 2LBTA 1RFYA 5CEJA 4P31A 4KQ2A 3SIVA 3ZRVA 3HN6A 1VECA 3ZKWA 3T1VA 5JJBA 5F2OA 4N8EA 1XKLA 1I2DA 1UANA 4G0PA 4NCXA 4Z49A 3IULA 2GF0A 4LSWA 1X0VA 1VF5B 3I5MA 1IC6A 1EM8A 3NH9A 5TJ9A 4MVRA 3BYQA 5CTAA 2RGAA 1JIIA 3FZYA 5A4JA 5TQ0A 3K0CC 2CNLA 3Q0TA 1U5AA 2BFFB 2FQQA 1FFTB 3EAFA 1R6NA 4LRWA 2H6LA 2QLTA 3P10A 5JROA 3BH7A 4EFKA 4YV2A 5CIWA 4W9NA 2HMTA 2C96A 3JYCA 2OHFA 4HZGA 1POWA 3WAKA 4P82A 1H2RS 2ZIEA 1O6BA 1P2SA 3ZZ0A 1N0WA 3M7IA 3EF3A 1L0BA 1JHVA 2IE0A 3URKA 1J06A 5EE5B 4GH5A 3WFJA 1ZMRA 2WE7A 4CT5A 1Z36A 3LDDA 3QEBZ 1QG2A 1J70A 4CI9A 2ODQA 1F0NA 1EUQA 5EIHA 1Y82A 1XV2A 4EF4A 2ZJZA 3VQWA 1M1YB 1TT5B 5KNCA 3AINA 3RRMA 4ZIBA 1SG9A 2OZLB 4ZK6A 1FF9A 2YXYA 1XQYA 1DDGA 3RK1A 2JFNA 2PLFA 1QLNA 1YE3A 2IHNA 4YCJA 3NAMA 5EZYB 2P3SA 3LDAA 4MUAA 1YZBA 3E9RA 2LW7A 3IAUA 1X3SA 4RAIA 2ROQA 5A4IS 2W2PA 1BMQA 3QE4A 1I3LA 5DF1A 2C4VA 2ZSAA 4J0GA 3KKOA 2GLXA 1WKVA 1N9KA 4RENA 3ZGYA 5CU7A 4L2IA 5IDJA 4MVWA 2PR7A 1A50B 2OFFA 2GF2A 5KC9A 3MBKA 3CJHA 1I6WA 3ET4A 3WYGA 1RC8A 2VQSA 4FNAA 1ZINA 4IQGA 1NBAA 1G1MA 3BSFA 1B74A 1XBLA 2FNAA 3AEZA 5DN9A 4ZHQA 3SDLA 1F4VA 3BZBA 1JH8A 4AP9A 1OGIA 1WMEA 2YHIA 4LI0A 3CEJA 4DZRA 3SQMA 3EY4A 2AEFA 2JEYA 1SZTA 1EX6A 1XSEA 3HACA 4Z51A 4OIFA 1RYZA 3KCNA 1OZAA 2O1XA 2VPIA 4P98A 3QVJA 1RXSA 13PKA 4N5NA 4HHEA 4NR1A 1Z17A 3VPCA 3GUVA 1OCRB 2Y0PA 1B15A 4ZYLA 3VU1A 1ZAUA 3W0LB 3OE7A 2OO3A 5KWIA 4KEAA 4Q02A 2J0UA 2FEWB 4TMWA 2QSAA 3GFBA 3ZIAD 3MDOA 2RKBA 3L04A 3LSUA 4U02A 4LHEA 4ZKIA 4FFNA 4MCIA 4RTKA 3S2IA 5EC1C 1RMQA 2Y2UA 2A67A 1N9ZA 3DR3A 4AY3A 1RCFA 2IYOA 4M1SA 2R8XA 4ZO4A 4UEQA 5DIZA 2P2ZA 2OCLA 2WLMA 1NXPA 1KI6A 4M1YA 4HNGA 1OKKD 3HO1A 4L8JA 4GSLA 5EKDA 4X64B 1IHDA 1S4QA 2LIVA 4GWKA 4Y98A 1RLOA 4V38A 3M7MX 5JDIC 4OHPA 3AIMA 1L5OA 2XDYA 4NHOA 5B5SA 2FQWA 2C2MA 4E14A 1EESA 3N74A 1BSVA 3F78A 1PL7A 3RVNA 1UMBA 1YKGA 4BL5A 1HM5A 3GEHA 5A04A 2FW0A 2WTBA 5A6VA 2JLVA 3ZDQA 1M76A 2C61A 4BZQA 5HEKA 2I80A 1BDBA 3OM9A 7AT1A 2CL0X 1HQKA 4A6DA 3SM9A 2QT0A 4OO3A 2JS7A 3K9FC 1Z35A 1TVKA 5CB0A 1THZA 1XTIA 2JIMA 1TEHA 2X0EA 1FUKA 3DL2A 1KVUA 4JV5O 4RVCA 3D5TA 1E2LA 2IZOA 4QGGA 3I04A 1SHJA 1FIUA 3G2OA 4FOTA 2A84A 1CR0A 4MEBA 2GJ4A 1YJCA 5KU1A 5HTKA 5K4AA 1JI0A 4KO3S 4WLFA 2XTAA 2WLLB 2I2WA 2VP6A 4TRRA 4ZAXA 2UV8A 1XIVA 1DAGA 5DO9A 1K86A 5E9QA 3RBZA 3T5GA 2QWQB 3TOXA 3K72B 1GSOA 1RQXA 1QCDA 4LOHA 2QZ4A 1P2TA 4BKUA 2ZSBA 4HN9A 5DYNA 4UBMA 3FBGA 4ESOA 1PYDA 1WDMA 1FZTA 2VBCA 2VAVA 1M93A 1XX6A 3CNEA 1EFRG 2OG2A 1IPHA 4IKPA 2ILVA 4RH3A 2FDCA 3WRXC 4UBIA 3KYDB 4MR8A 2FRXA 3WLPA 5A3JA 4AW9A 1EFVB 2CE7A 1CEYA 4RTMA 2P9QA 2D6FA 1YRLA 1G7SA 1ZOIA 4YXWA 2QTWB 2FP4A 1GUAA 1SC1A 3TXQA 1Q3HA 5LBTA 5FJJA 1P2FA 2YZGA 1GQQA 2XCQA 3LLMA 2R8YA 1XFDA 3FB1A 2JNBA 4MS1A 3WO1A 4QBTA 2CN1A 3OMWA 1MX9A 5JU6A 1QQCA 2BLLA 2H16A 2FRDC 2JFVA 1PF7E 2PR2A 2EJUA 3PVCA 3AJ8A 3WRVA 2XKAA 2UYNA 3FM9A 1RD4A 1NLMA 3L8YA 4C7MA 3UANA 1WZCA 3HKBB 1S5JA 5GINC 2IEBA 1UK7A 1GSHA 1A8PA 1H2GA 4V0OA 4WXYB 4RDHA 4ZT4A 3PJFA 3DHEA 1A9SA 2ALEA 4Q47A 1L4FA 3GTZA 1SQ5A 3Q72A 3RTGA 1BFDA 1BU8A 1UFQA 2XHZA 1NQOA 2EOAA 1N2IA 4RGYA 4CZ2A 3WPXA 3DEYX 4FLYA 3CCVV 1Y8CA 1ZQ9A 2R1VB 3PE4A 4FD3A 3FWPA 4KYIB 2VJCA 5LXTF 4QOFA 4HY3A 2WG1A 4UMVA 4JT8A 4JBNA 3LL4A 1KYZA 1SFRA 2L2QA 2V3CC 1IQUA 1QRAA 3NBUA 2NYUA 2HX0A 3HUDA 3DEKA 1IWOA 3Q3JB 2F3RA 1YU9A 3R3XA 4EBFA 3B13B 4FZRA 2ZAUA 5F5NA 2VPYA 3M9LA 4ZAYA 2KTUA 1FUEA 4E4TA 3RF7A 2LBXA 1R8SA 2QDKA 3ZCQA 3S8YA 3BTVA 1NG1A 2PNJA 5HY4A 4KCGA 1ZU4A 3VR5D 4LRYA 3LBHA 2XQFA 3FOWA 3WLLA 3C5HA 1QO9A 4JR1A 3CO5A 2IU4A 3G0BA 1QLJA 1KEEB 3LG2A 3IHLA 2PH1A 1JVSA 2GB4A 1MB3A 3O7MA 3N4YA 1GPLA 3WDMA 4IEFB 4RKYA 1FD9A 1KTVA 4LZLA 4UULA 1F20A 4CXMA 4JGIA 4JTDB 1O8BA 1XRQA 4W1PA 3FOCA 1L5HB 1ULZA 5KX5F 4YACA 4B3DA 4K0KB 5B1AC 2RFLA 4LXYA 3LCRA 3OPQA 2QT9A 3OTHA 1HDYA 3MRVA 4HQLA 2J0SA 2W0SA 4YS6A 1NXTA 2O8FB 3KTAA 4FZJA 2F8SA 4N03A 2JJ1A 2EFHB 4DMCA 3BBLA 2AC7A 1DAOA 3TG2A 4RVDA 4BZXA 2JCGA 3TJMA 4IDFA 1K9MW 5DHPA 4PNEA 2AQKA 1KO8A 4NKRA 2O2GA 2RHGB 4KHZA 5DHFA 4CKZA 5H6QA 5I7AA 1A97A 3FR8A 3W5IA 4LV5B 4AI6A 1XTUA 4B8ZA 3D8BA 2OR3A 1N0IA 2X40A 3FSGD 5ALUA 1XCLA 3PWSA 4QDUA 4MWCA 3NHPA 1B42A 3NR7A 2HTFA 1CF9A 5HK9A 3R3HA 5GJBA 1D5NA 1ZWZA 1M2OB 4MT8A 5DTMA 4ZEXA 1PG2A 1O95C 1BW9B 4F3RA 2WDZA 4DS3A 4CIBA 1DC8A 3PBKA 1G8GA 2Y48A 3E22A 3W8FA 1Z2OX 1WXDA 5HQ3A 2IWHA 3F0EA 3GOQA 3TQOA 4N0EA 3G71V 1RIIA 2FN4A 1S02A 2QWNB 2LDBA 4N7BA 1KDOA 3FCSB 4OA5A 2KG7B 3U1TA 3F9CA 3MWDB 2H6EA 4ZTUB 1NYQA 2G4VA 3VVCA 1N57A 4QODA 2DCUA 3UK6A 1SETA 1RWMA 4LRQA 1PVDA 2E1RA 2R0QC 2R65A 1XGKA 1YA4A 1USWA 5LLSA 3KAKA 5H2FZ 2CBGA 3DULA 3NBQA 5LL6P 2AKYA 2GLUA 4IGIA 5IMBA 1BS2A 1QVRA 3AFMA 3KZOA 4LY9A 3U4QA 5IUNC 3DBLB 4TV9F 2VTBA 1E18A 3WWPA 2FN9A 3N0WA 4XFDA 2JFGA 3T3DA 1Z8DA 2VF2A 1A04A 1KD1H 4O2BB 3K09A 4KN6A 4IT5A 3K16A 1LXCA 3MT0A 1QTRA 3L7YA 2FQXA 3BXHA 3GFOA 4AMVA 2OCGA 4OLJA 1D4OA 5FRDA 1HT3A 5K6RA 3GGDA 4JZ2A 3WGOA 3J7AC 4BX8A 2QLMA 4DMHA 5IJZA 1AH2A 1ZZGA 1R73A 2DYSB 1K2VN 3HDQA 4ED9A 4PLFA 2HEGA 1EJ2A 5THXA 2XAQA 4IUYA 2R66A 2HJGA 2RAVA 3X1MA 1L3CA 1KAOA 1YRQA 3G9XA 4UCWA 1XMQO 2QNBA 1TLFA 2ZREA 2A1UA 2W83A 1T34A 2ZJ2A 1LPOA 4QNNA 4OGWA 3KJJA 2GSWA 1HE1C 2XODA 4E5MA 1NP7A 3I0ZA 4L4SA 3TD6A 1ABEA 3OIVA 1OCCB 3DKIA 2HQSC 2IYFA 1H65A 1RCTE 3S3TA 4AL4A 4IX1A 4DVJA 1USIA 1FVXA 1OXXK 3FWZA 3EHBB 1SCJA 3PX7A 4ENQA 1XT6A 2B7LA 3MILA 3QE0A 2R7LA 5K0EA 3NBYC 3VNRA 1GZDA 2RI1A 3RSFA 3FTPA 1E1KA 4L16A 1W34A 1GNSA 4NB5A 5B37A 1Z0AA 1ZJZA 2HREA 3GLRA 4C3UA 5FLEX 1VPWA 2ZIXA 2OHOA 1I0ZA 3NYIA 1FQKA 1UDWA 3IO3A 1FFBA 5C4IA 1ORTA 4NJOA 4IHQA 1PL4A 2Z5GA 5IY5C 2EFDB 2LP4Y 1QHEA 2NV2B 5L3FA 3SBXA 5JZ9A 1FQWA 3QF4B 1XA3A 1P81A 2VXOA 4JZKA 4BRSA 4V1CI 3QIVA 4F6RA 3VSAA 1EGHA 1ESDA 3MQ2A 4F2WA 4JC0A 3AK4A 3A32A 5DHQA 5LD2C 3HR7A 2DPYA 4B4WA 3WHPA 2WJIA 5KYTA 1E9SA 4DPKA 4HFNA 3V4LA 4A2QA 5AG2A 4IDDA 1YZLA 1MG0A 4LFCO 2Y1WA 2OMEA 1IUNA 3LGSA 3FGZA 2YC0A 2FDXA 4O8ZA 2X6BA 1RI2A 1PKEA 4OQXA 5CGZA 1RTTA 3HXKA 5HHTA 4YJFA 2ZKIA 1QRRA 3E8GA 4HQ6A 2FUEA 3K9NA 4AJ2A 5HILA 1TF7A 3ZK7A 3OETA 3H9GA 4WZAB 2H29A 5TPWA 1L4YA 1TD1A 1YDMA 1SVNA 2WM8A 3IEPA 4GLJA 4EJ2A 3K5OA 2H1OA 1C1DB 2H07A 3L7MA 1SQGA 3B8MA 5AW6A 5JZOA 5IC6A 5FPYA 3LWNA 4GECA 4ETWA 1JLHA 2HV8A 2UYPA 2NVUA 4G4WA 3U4IA 5CBPA 1JPUA 4LDZA 1ABFA 1SBIA 4RFSA 1JLRA 4FKZA 2AK3A 1YCGA 1RLIA 3AXSA 4W4LA 4RZHA 1ODIA 4TMVA 5JAPA 2A9VA 5DM6V 1KVQA 2BM1A 1J7HA 1FFWA 2R25B 5AXBA 1FNDA 3LPAA 5A9SA 3PAFA 3TGPA 3TVYA 2VTKA 1W0KA 2REQB 1MGPA 1Z0JA 3NV9A 5LDGA 5A9RA 1ZRNA 1OFUA 4R0MA 3JZMA 3THYB 1JQBA 1N6OA