4YJ3B

Crystal structure of tubulin bound to compound 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj3B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj3B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj3B01
1TUBB 5LYJA 5J2TA 4X1YB 3HKDA 4U39A 3WGJA 3M8KA 5BMVA 3E22A 4O4LA 5ITZB 2RHHA 4EB6A 3VOBA 3JARA 4FFBB 5LA6B 2VAPA 5EIBC 5BMVB 5IJ9B 4HNAB 4O4LB 5ITZA 4TUYA 5CA0B 4O2BB 4EI7A 5IJ9A 3JATB 1OFUA 1Z5VA 3RYIA 3HKEB 1TUBA 5LP6C 4X1YA 4HNAA 3WGKA 4IIJB 1W59A 4YJ3B 3VOAA 3C8LA 3JATA 5CA1B 4E6EA 3M89A 2BTOA 4EB6B 3HKBB 4FFBA 3JARB 5LA6A 5GONA 1W581 3WGLA 5MN6A 1W5AA 4I4TA 2R751 5M7EA 4LNUA 4X20B 4O2BA 5EZYB 3JAKA 3RYCB 3HKBA 2R6R1 5GONB 2RHLA 3RYIB 3JASA 3HKEA 1FSZA 5IYZB 3UT5A 4I4TB 4IIJA 2VAWA 1RLUA 4YJ3A 3JAKB 4ZI7A 5CA1A 4ZOLA 1W5EA 5IYZA 5FNVA 1JFFA 5JCOC 4ZI7B 2RHOA 5IJ0B 2Q1YA 4LNUB 4X20A 4I50A 5EZYA 3RYCA 3VPAA 1RQ7A 4ZOLB 1W5FA 3JASB 5JH7B 1JFFB 4TV8B 4O4JB 4KWEA 3N2GA 4O4HB 2BTQB 3UT5B 4I50B 5JCOA 1W5BA 5KMGB 4IHJB 3RYHA 4DXDA 4B46A 5JH7A 3RYFB 4TV8A 4O4JA 3HKCB 5MN5A 2BTQA 3N2GB 4WBNA 2XKBA 5FNVB 5KMGA 5LOVA 5IJ0A 3RYFA 5C8YA 3HKCA 3R4VA 3ZIDA 3JAWA 5CB4B 4XCQA 4EI8A 4O4HA 5JVDB 5LP6B 5EIBD 3N2KB 4X1IA 5JQGB 2RHJA 5C8YB 4IHJA 3RYHB 4I55B 2Q1XA 5LXTB 3JAWB 5CB4A 4O2AA 1FFXA 4WBNB 5KX5B 4X1IB 3N2KA 3JALA 4F6RB 5JQGA 3V3TA 4ZHQB 5LOVB 4B45A 4I55A 5LXTA 3RB8A 4O4IB 2XKAA 4TV9B 3WGMA 4YJ2A 3VO9A 3JALB 4F6RA 2VAMA 5J2UA 5JVDA 1TVKA 1Z5WA 5LP6A 5LYJB 5J2TB 3ZBQA 4TV9A 4DRXB 4EI9A 3VO8A 4YJ2B 4O2AB 3E22B 5MN4A 1FFXB 5KX5A 1TVKB 1SA0A 4U3JA 5EYPA 1RQ2A 4ZHQA 4X1KA 4DRXA 3WGNA 2VXYA 4O4IA 4M8IA 3ZBPA 3HKDB 1SA0B 4U3JB 4TUYB 5EYPB 5CA0A 5J2UB 3CB2A 2GVIA 4X1KB
chains in the Genus database with same CATH superfamily
4TWBA 1VECA 1W0KA 2QSJA 3JQ8A 4Q4HB 1TAGA 4X1YB 1AXEA 4N1AA 3D54A 3M8KA 4PDLA 3VJKA 2VBCA 1PNTA 2O8EA 4HDNA 3ZEAA 4HUTA 5DM4A 2R6FA 4V03A 2HCJB 5REQA 5BSKA 4CN9A 3N53A 2ARKA 2Q8PA 3L7MA 4BNDB 3O65A 4RHEA 2E21A 2EZ8A 3TZBA 3DOFA 4HN2A 4E88A 4FHDA 2ETVA 2ZRNA 3B8NA 4UJ3A 1VQNF 4P54A 2HPZA 2WYHA 3MQWA 3I2YX 4MS1A 3UG6A 4B3CA 4YMLA 5EXDA 2I29A 2Z8XA 3FHTA 3T2MA 1X8JA 3IT1A 1LBHA 3T61A 1NS1A 3RU9A 1XJWA 1ZMOA 4FLYA 5D5PA 3AR4A 4BFTA 4Q1FA 1JU4A 5IFLA 1YE8A 3HB0A 3I3OA 3KYCA 4CMHA 3L8HA 4LRYA 2I1VB 2BFBB 1G5TA 2FPOA 2VQDA 2NYVA 3EFOB 1N8RW 1G1MA 1UK9A 1WIWA 5I4IA 3H18A 1HE5A 1K63A 2ATXA 3CZQA 3O9MA 3D31A 5AOAA 5ER9A 4LHZA 4X91A 5C8YF 1RLIA 1WB9A 3P9PA 1VL8A 3H86A 4JB8A 4GGOA 3H01A 4DV6O 4RIFA 1WCV1 2BKEA 2JA2A 2Y76A 3C15C 4MVCA 4ZD6A 4EA6A 4BEJA 3D4LA 2DFNA 1NBMG 3ROZA 3AEKA 1MO5A 2NU6A 3JRNA 1KWKA 2O8CA 2IYXA 1KP3A 4PZYA 2WJHA 3DOHA 1NQVA 1I4LD 3EPKA 3V8BA 4P7JA 4K1LA 4GPIB 4MIKA 1SCQA 4DLSA 4PN7A 4GLFA 5BN5B 2B35A 3GA0A 1ADCA 2IXGA 1T8UA 2ONJA 2JW5A 1OZ0A 4CKWB 3LDTA 3W05A 3EY9A 2C9DA 2CLCX 3A9RA 2OYCA 1PVOA 2HHHB 1DNPA 2E6UX 3WZ2A 4DCPA 2V9PA 1OC2A 2F2TA 2JFHA 3HXQA 1GOTA 1WZEA 2HVJC 2RH8A 3LW7A 3R5SA 2CL7X 2R8RA 4KUEA 3NCTA 4URYR 5IF9A 3GVHA 4LRSB 1KZ9A 3LRPA 4WAUA 3OOJA 4YX9A 2CH7A 1TF7A 3LUFA 4GX2A 1O8CA 4J7ZA 3OX3A 1JHQA 2SKDA 2XUHA 5EE5B 3ZU6A 2Y27A 3WBFA 3T3NA 1NGSA 1YIAA 1FNSA 2N9UA 1I1NA 4HYOA 1LLFA 1JS1X 2WMYA 1EB9A 3VR4D 1JLLB 1BMQA 2JBHA 2LVBA 4X65B 2O3SA 3PGXA 4CU2A 1APBA 2BEJA 3TCKA 5FXMA 3HYLA 1ESMA 1IEVA 4LV5B 4Z8YA 5IT4A 3S3TA 2YN4A 3IPRA 3CEMA 2P30A 1BGWA 2Z3YA 1I7NA 2G71A 2PMEA 4II7A 2AUMA 3B38A 1Q22A 1ZHHA 1R3KC 3L6UA 1INLA 2V3CC 3HY3A 3K5WA 2OT3B 1QK4A 4WPGA 3VO8A 1F8UA 1N6OA 3BQ9A 1OVMA 4RKWA 3P52A 1LPAB 2C77A 3IJRA 3JD4A 4OYRA 3SC4A 2B0CA 4MROA 5EPEA 1UUFA 1RWPA 2PD6A 4B0PA 1XD9A 1I7LA 2HWUA 5FOXA 3WDSA 4ZAYA 4EECA 2XNKA 3WTBA 5ED4A 5IT0A 3NS7A 2IE0A 1MRSA 3FD6A 2JFNA 1R3UA 3NRJA 1JWBB 3E7FA 3ZZNA 4KFUA 4BQOA 1T4CB 4GICA 2RG7A 5IZ4A 2UYJA 1CUZA 2NZ2A 2KTVA 2RAVA 3DZJA 3E1KA 4RZHA 4Y2YA 3WRYC 1JA0A 3M1AA 5F78A 1F7YA 2GCOA 2JDID 2Y68A 4QOJA 2D3WA 2GFQA 3W4JA 4C7OA 5FPYA 1EGMB 1EFDN 1Q95A 4O4LB 3N28A 2OBBA 5K3FB 4ZGBA 3ZMZA 5G4KB 1IJEA 1NLZA 1DQNA 2FW8A 4IL5A 5ETJA 4C4RA 1GKYA 3F2VA 3THSA 1X87A 1EWYA 3BKXA 3A3OA 2IIVA 3NTRA 3UT6A 4WJLA 1DIBA 1VFPA 1ZRMA 1R16A 3UZUA 3L4BC 4B3IA 5JD4A 3V1TC 2Q0AA 4UW9A 1VC2A 3LAWA 3QKIA 4JL6A 3E3OA 3PNOA 3NAMA 2OLEA 2PJDA 4JFAA 2V9YA 4JX9A 5AK5A 3FOCA 5LZ2A 1EKXA 4M7RA 5CJJA 4ZDIA 3ADBA 5AICA 4RTKA 3BVOA 3H1KH 1AUOA 4U2BA 4F96A 2CVLA 13PKA 2IRWA 1F8GA 4X54A 3SNKA 1R3JC 3EOBI 3KV3O 3GFFA 2CK3A 4R8RA 5AD1A 2R7AA 1A5SB 1N8TA 1JB9A 1T2NA 2ATVA 5CAEB 1SB9A 4B44A 3TCXB 4J7CA 1W0CA 3HJBA 3U60B 3GRYA 2FGYA 2WEKA 3IRVA 3UC9A 1HP8A 2HQSC 1JJBA 2VAXA 5C0OE 1SVNA 3O2JA 4R83A 4RXUA 5C80A 1XPUA 4KVGA 1BROA 2P5YA 4HRVA 3EGDB 3G49A 1HFEL 1EJ6A 3ZK7A 2XB9A 1QVWA 5HOQA 4I0XA 1R6NA 3ESCA 3R6LA 2DPMA 4RKYA 3W5IA 4X88A 1MAUA 1U0SY 2BFWA 4ZCIA 1S4QA 3DONA 1L5HA 5KNCH 2H00A 4B09A 4B4OA 1JIKA 1FSSA 2ZULA 4FCWA 4M8KA 5D85A 5K3SA 3TQOA 2O0MA 1NV8A 2JLBA 2GD0A 3IJPA 4OQ4A 4DIOA 5LVAA 2YXNA 4MO9A 5DMHA 4RHCA 5IAOA 2IF0A 1Y8QB 3I56F 3EG9B 2WSYB 4YIPA 4S12A 1E32A 3OTWA 1H9AA 3MQ2A 1CTQA 2W11A 4DMCA 1X70A 4XOUA 1L5OA 5B8FA 2GN9A 3PEVA 1STOA 3FTDA 2B78A 1ACMA 1T6XA 2EG9A 4XR9A 3A2MA 3LDUA 4LYHA 2R00A 5CBGA 2JVIA 4P35A 3WJ1A 4CR6A 5AW5A 2F1MA 5LL6P 5IUJC 1TD9A 3LSUA 1G3RA 1NLYA 2YBDA 4BR6A 3IP5A 1T1RA 4UBKA 2CSXA 2PWBA 3E4DA 1P1BA 2XTZA 3IAM1 1FTQA 3GOQA 5A2QA 2QT1A 3DUFB 3ASNB 2IBZH 3F8WA 5EAIA 3EFHA 1NRWA 1SY7A 1SOAA 2FUEA 4HZUB 1UFRA 2CLIB 3GIDA 3JRXA 1WCXA 5AK3A 4XFJA 1PT9A 1SO8A 1YDMA 3GC6A 3GUVA 3QVLA 2YXLA 5B1IA 4CTMA 2L42A 1MHPA 1YCGA 1KFCB 2HSDA 2ANBA 3NTLA 5BT8A 2ZM6O 2OCKA 4B3RO 4FWTA 1S3JA 4WH0A 1PD1A 1VPVA 3EARA 4WFEA 1I4WA 3K5HA 4MDYA 3T12A 4AG3A 5C7IO 1B23P 2BFNA 1V11B 3C4JA 1AA9A 4GQIA 4AJIA 4RMIA 3TLGB 2FW9A 3I39X 1E1QG 1EM8A 1Z6AA 1KC3A 3I32A 3T8YA 4HAOA 2VJYA 3LL7A 2Z1NA 3BE6A 1H38A 3FMFA 4YJGB 1EU1A 3VMMA 4YS6A 3O3NB 2GVNA 2PV7A 1JG3A 4WK4B 1JKMA 1SG9A 3AOEC 3RTBA 5K3FA 3QX9A 1JN1A 1T2AA 3S0WA 1Z13A 2JBAB 3RE1A 5J2TA 4PGFA 2YS8A 2YJNA 1OKKD 2D7JA 4CEHA 2HP0B 4LBVA 3NFRA 1YE5A 3NASA 1NLFA 3PNMA 3SXUA 4UHJA 1C7IA 3HBFA 5JDCC 4RWZA 2KG7A 5CBKA 2HXGA 4ZREA 1K68A 4Y2QA 4AAYA 2PUTA 2PD3A 2XIQA 4LBEC 4U9IS 1OA1A 4B31A 3BWCA 2HI0A 3QG1A 4LKOA 1RJWA 1X7YA 3HACA 1X1SA 2ACWA 4PAOA 3GUHA 3RSSA 4AHCA 3K1AA 4TMYA 4MYCA 3BRWD 4J1QA 2XYQA 2D1TA 4MEBA 4WK0B 2EJRA 3RKRA 1QIHA 1P6UA 4MGEA 4H3VA 5EERA 2EATA 4NMMA 2FYUH 1YASA 3ORSA 3RWBA 1KI8A 3S8YA 2Z6UA 3RAEC 2F90A 2PX3A 4AJJA 3MCAA 3ZLJA 2ID4A 4AIRA 4I6GA 4DV0O 4EJ0A 5KQGA 2EZOA 2OV3A 1IVNA 5JY6A 1A95A 2B2CA 3ITNA 3QTCA 1CBUA 1RAGA 1OIVA 1VQKF 2RJOA 3LUDA 2QX6A 4B6PA 5BY1A 3UK1A 3NTUA 3D0RA 4WECA 4UOZA 1Q7YW 1XKTA 3TAUA 4PSCA 2NZWA 1DV1A 3CCMF 2NX2A 1XK6A 5HWEA 1NW3A 1VKRA 4PZDA 3IQFA 1NZDA 1I3KA 4GPTA 1J8QA 4WVLA 1AO0A 5BOSB 3IESA 1F17A 2AEMA 2ZSBA 1V3TA 1DAEA 2CLFB 2EYUA 3O75A 3U3OA 1I6WA 1U96A 1BQZA 2R11A 4PU0A 3SDSA 4G2TA 5EJ4A 1SJ9A 1XTBA 2C8KA 4J7JA 4P2ZA 2JLRA 4D0LB 1WQ1R 4E5NA 4BGDA 1HFWA 1I2MA 4OBEA 1GPNA 2J87A 4XJTA 4IIVA 1V54B 2PUSA 1TEVA 4DJ5X 5F2VO 3QBVA 2BZ1A 4QYMA 4UFPA 2HR1A 3BXPA 4IILA 5IT9M 4C7JA 5KYNA 3IIEA 2WUEA 4DADA 4YMHA 1Z2GA 4DIDA 1VCHA 4YT2A 4J16A 1DCKA 1IOWA 4RZSA 4EH1A 1L4YA 5DSTA 5AESA 5BVGB 1QSGA 5HF6A 2HA7A 2XWSA 3LPDA 2FK8A 1VLQA 2OFXA 3MINA 2O0KA 2X2EA 3BGIA 4EJ6A 2EGUA 3GELA 4NULA 4FUQA 4Z0HO 3WP1B 4FJ1A 5IM4A 1SBHA 3HVHA 4P9PA 3FVQA 4M6WA 5HYVA 1SXJC 1GRVA 1NOKA 1Y7TA 2LQTA 1FQWA 1G98A 4C1NA 2BEWB 1QH9A 4UHDA 5DZSA 5J59A 4FSXA 3W4IA 4UOEA 1BE3H 3SSOA 4LQCA 1GUBA 1HLGA 5D8DA 5LL6Y 4PDRA 3N7AA 2VF8A 4R8CA 3L6CA 3KQSA 3M4SA 1ULZA 4MRNA 3SQMA 3UJNA 5D3KA 4MVJD 2XQIA 1PGOA 1HYEA 3FOBA 5LP6A 1Z7EA 1RWVA 1H69A 2C9BA 1ZD3A 2J0UB 3MFYA 2ON6A 1NX6A 2D0DA 2GM4A 5B64A 1H3FA 3I1YA 3L71H 1OBHA 4E14A 3SD7A 4EGJA 4S2EA 2YIJA 4FBLA 3BICA 1EBFA 3DDUA 1DG9A 1WBBA 1CZKA 4OQLA 2DBYA 2QKYA 1YQEA 1Z2NX 4M8IA 2DT5A 2PJUA 1T24A 4IF6A 1D1SA 4HVLA 1EAMA 1HSZA 5D6OA 3X1DA 3R41A 2G4CA 4XSGA 4C21A 5L3CA 2PT5A 3CISA 3MHHC 4LF6B 2JNBA 1QFYA 5AKHA 5LB4A 4IUDS 3W9BA 4YDQA 1JEYB 3AG3B 4REQA 2ZVQX 2J46A 3MA0A 3BTUA 1AO3A 3UENA 4WFQA 4A8HA 5A4FS 1K6MA 4BZQA 1A2OA 1P2TA 3ENZA 4PVCA 4OH1A 5D7BA 3K8QA 3IFSA 4GC9A 2BRUA 4Y2PA 2LCAA 1DRVA 3ZVLA 2FEMA 5D1HA 3LBIA 3IBYA 3L0OA 4RTJA 2QUHA 3L7YA 2QTHA 3AI3A 3GLUA 4KXYA 5FTMA 2OBNA 4DOMA 1L9KA 2C2BA 1E92A 3WBKA 1UBSB 2KE5A 2PSFA 3K0AB 2CVQA 2F9ZC 1ZXLA 2AGVA 1AR5A 4OUKX 3VV2A 4B81A 2ID8A 2JFPA 1XMQO 1Q8IA 1BHBA 3ZDQA 4RSGA 2Y1CA 3ELUA 3B82A 4EB6B 3DF7A 4PLYA 4JBNA 4Y2TA 4YRTA 4BFYA 2OFOA 1EHCA 3GAAA 5AW6A 1P62B 3SF8A 4MGYR 3K09A 2MWMA 2ZFUA 4MV0A 4RL4A 1TQ6A 5CAEA 3GJ0A 2FPGA 1LUWA 1IK4A 3E9QA 3PFCA 3FUVA 3E8MA 4KWHA 1E7RA 2QE7D 5KJEA 4X64B 1OXSC 5TQJA 3V7UA 4JC8A 4MT8A 1GZ7A 3JVVA 1NSFA 3E18A 1A3CA 2CHGA 3AG7A 4KAAA 4P4UA 1KAHA 2JLSA 4UDNA 3WGYA 5JD6A 3EMKA 4WZAE 4GLOA 5I9BA 3HYSA 2IDZA 4QLAA 3T3IA 1G42A 1QG6A 2R8PA 3LOPA 1ILEA 3U56A 4BVSA 5LIRA 4H33A 1XTQA 4J0JA 1V8PA 3KKMA 2R86A 3S1LA 1BOOA 1Y4ZA 3G2LA 1TEXA 1DAFA 3HL0A 3V9AA 4D3YA 1ETHA 4YACA 4GM1A 4W4KA 2J5QA 4TM7A 5IVIA 3TI7A 3X1ZA 3NETA 2REQB 3MJHA 4MWZA 4N76A 3I05A 3QTYA 2E37A 2J0EA 1VQ1A 4LXTA 2OHGA 1J8MF 3HJUA 1C9DB 2QP4A 1SPXA 3RLFA 2P4UA 1RS0A 3GBSA 3O4VA 4ZPJA 4ENSA 4NEQA 2IYAA 4N9QA 4A82A 1L4FA 2G9ZA 4AKEA 4N9WA 5B6JA 3WDKA 3AOGA 4QPCA 1MEOA 1I3MA 4WACA 1HT1E 1PYGA 3C8UA 3FNQA 3TRHA 4E5MA 4YALA 1OIXA 3L8FA 3R5TA 2ATIA 4NTYA 4HX9A 1PLJA 4IIFA 3SYKA 4ACBA 4D9FA 4B7AA 5FWNA 1C9NA 5AVMA 4QNMA 3WHIA 4PC2A 3N2KA 4ZYZA 1JTFA 4GT1A 3LVRE 1NTRA 1JVBA 3ZOZA 1JR2A 1GY8A 4ZDWA 4B2PA 1HBJA 2YHIA 4OUDA 4DCCA 1XMPA 1EG7A 1Z35A 1MNGA 1OLSB 2H4FA 4JJ7A 4UMVA 5AP9A 3KYIB 4PS1A 3V42A 3EBLA 1SNYA 2HRBA 5DYYA 5JJBA 4DK1A 4H7JA 2OGSA 1WF3A 4FFDA 4WINA 2ERYA 4B84A 4ZMSA 4ON9A 5D3ZA 4EI2A 4JYCA 3BDIA 3C4VA 3DGFC 1K92A 1N6RA 4KAFA 2NU9B 1JR6A 3H8JA 2BEUA 3MTQA 2IHBA 4URWR 3WYDA 4EB3A 1T9BA 3H1BA 4KDEA 4X6UA 4A0GA 2WB2A 3LF2A 4XM1A 4G5QA 4PPFA 3V8PA 1ZGCA 5E1MA 1YIDA 3MWEA 2HMAA 1T2EA 3WO1A 2EWCA 3D2CA 2X4LA 3F7OA 1I33A 3R6DA 1RDFA 1V9LA 2DU8A 2Z01A 4FOSA 4H7FA 3PFHA 4HDAA 4P22A 5FA8A 4EEXA 2MINB 2C2OA 4O5OA 2FPSA 3AU8A 5LA6B 3P94A 4PR0A 1VDMA 4YI5A 3ZPXA 3F0EA 1BSMA 3WI7A 2D3TA 5GMOA 3PYMA 3EQ9A 2QD4A 4R84A 3DFUA 2IBMA 4R40A 5FQNA 3KWFA 3LQFA 1ZC4A 4EAAA 4Q4LA 2RGGA 3VSBA 4RVGA 4M1SA 2LPMA 3CLRD 4YWHA 2NU7A 3FDFA 4ZT7A 3OQ1A 3QE0A 4LR3A 1Q7GA 4WLEA 2ZIXB 1K3EA 4R1UA 4TOIA 4A2QA 3E7WA 3H2GA 4R1QA 3L41A 3Q8WA 1E1CB 1E3IA 3GMTA 2CNNA 3QXJA 2YINC 1TIKA 4X8LA 1WY5A 3RLIA 4FFBA 3UIEA 4E5DA 2R7MA 1EZZA 4NBSA 3EDMA 3AFGA 2AHZA 1W47A 3DEJA 3Q8XB 4PG7A 4OLJA 3ZNNA 4ZQEA 2ONZA 1Y76A 1Y81A 2O9JA 1SIOA 3FB4A 4YAWA 4CQJA 1BA3A 3OT5A 4ND8A 4HFNA 1Z8DA 1NIPA 4QDUA 5F4BA 5FOUA 1CY7A 1LJUA 1XEXA 4RD2A 2VRZA 1U3DA 4Z2YA 3RH0A 3TZHA 2UXBB 2IJKA 1PR3A 1W46A 2COKA 1XTUA 2D1QA 4QXOA 5FTWA 2CDBA 1YA8A 1QU2A 4CL2A 3K0SA 2Y3IA 4GW3A 1CERA 2FZEA 2HAEA 5FV4A 3D3WB 4RKFA 3BE5A 2AYYA 1Q3KA 2EL9A 3WK5A 3QK7A 5JAQA 3ASOC 3FJOA 3JSNA 4RF4A 5AJVB 1PWHA 1DZIA 2V7QA 3H5OA 2X41A 3QY0A 4EPWA 3BSFA 3CRRA 4F93B 3HE3A 3HUUA 1M2OA 3CX3A 2C9YA 3WNBA 4J6FA 3MDSA 2JGMA 2VDPB 1L7EA 5BUZA 3GLGA 4RO2A 1F3OA 1XOIA 3KKQA 2XH8A 3URKA 2ZUDA 2CJFA 3IQHX 3SC3A 2CLKB 2BSXA 2O20A 2TMKA 3DM9B 1N6NA 3F1LA 3SBOA 5EJ5A 2DWUA 1NJSA 3E9YA 3CF6R 4KBYA 4R8KA 1UMBA 1G8AA 3L06A 4ZVUA 3ZX5A 2PYJA 4HAZA 2RK3A 2ECFA 1WQ4A 2FOXA 3MJSA 5KYVA 4BRZA 4D4JA 2GD2A 4JXJA 3DKRA 1JLLA 1FYXA 3AIKA 4P92A 5EESA 1Y4MA 1P9RA 2Q9CA 4WXRA 1Z07A 3MJCA 4C9BA 1G8MA 1PJ3A 1LKZA 2OXCA 4ZYLA 1SKQA 5EJ9A 1CDOA 5LJIA 4BVTA 1ML4A 1T36B 5C5DA 2R84A 1Q6HA 1GUFA 4GH5A 5LUBA 4NH0A 3VYUB 3ZNPA 4Q3EA 3Q7IA 3CYOA 1IEXA 5ICFA 1O95C 1XVLA 5CX4A 1SD1A 4NPCA 4EABA 1SC6A 5DM70 2CW5A 4LG1A 5E2AA 4AZSA 5GP1A 1ZUNB 4ERXA 3A6GA 4WESB 2WWFA 2I65A 4ENTA 3KUUA 5FIUA 2E48A 3OQPA 1AQ6A 2MIIA 1VKOA 1N6HA 3PUXA 3B4SA 3P9YA 1KP9A 3ZTTA 4WEQA 4ZU1X 1CY8A 5CDFE 1FJXA 5GTHZ 4CIXA 5FLYA 1P2FA 4IDPA 3I8OA 3CU5A 2GARA 4QBFA 1KYOF 2ZS7A 4LK2A 4NCKA 2XHEA 4Y8VA 1RQGA 3WHPA 3EWAA 2F43G 3LCJA 5ES3A 1K8QA 3K6RA 4DV4O 3G7NA 4LY6A 3O8LA 4P3XA 2Q4BA 2VDUE 3LSTA 1XCGB 1L5LA 2MU1A 1D7OA 4BO9A 4UPEA 1QOZA 3U4QA 1DDIA 2IYZA 2L26A 3EVAA 3P32A 3NT2A 4F97A 2UYOA 3FLBA 3RVMA 2DLCX 4X61A 4YFYA 2R1UA 1FP6A 2BFAA 1QBGA 4MCJA 1GCOA 5FBQB 5FWDA 3V1UA 2CTQA 1BDMA 1NVVR 3WG7C 1H22A 2AHRA 4G5FA 3D6NB 1KEVA 2AKYA 4NONA 5SY9A 3RVOA 3SQNA 3K08A 3FYUA 4MV8A 1ZISA 4MS4A 4XJXA 3WLKX 3NFYA 1C41A 1ZOSA 3VR1A 2C3OA 3T7SA 2XWQA 4CI0B 4AMVA 5JARA 2Q5ZA 2FFAA 4TKUB 5TPWA 4EUNA 5FPTA 2BYTA 1IXRC 5CFPA 3ZHRA 5ILOA 1W40A 2NOAA 2OC4A 2YH2A 3DEIA 3L92A 2JA1A 3VGPA 4DLZA 5BWNA 4MDFA 2HRDA 3W4KA 4HDSA 4KFRA 3Q0EA 3AIOA 1OC4A 2JH9A 1M34E 4YRDA 5I7WA 3JQAA 4GG1A 3ZP4A 1LGYA 3QWFA 3NOXA 1KJIA 3PHIA 4ZKEA 2WSLA 4QC2A 1R5BA 1SU6A 2N75A 1JDPA 3BD8A 1QE0A 1EX9A 1AI5A 1RAIA 1E6LA 4YCDA 1WA5A 1R4NA 3DVAA 4DYVA 2O1XA 3ESDA 2FP4B 4MP3A 1JG6A 2EKBA 1NVUQ 1QPBA 1DBVO 5CW2A 3WIDA 4KX5A 1K8AH 1EDOA 4LWQA 4DXAA 2JGRA 3E82A 4JXXA 4CEJB 1SUWA 3KEQA 4BV9A 1E2NA 1TMKA 1W88A 2NPOA 1VP7A 4PA9A 2CLMB 2ECPA 2F67A 3MRTA 3QLUC 5T3UA 3RS9A 3VTKA 4R2HA 3ONNA 3ZWBA 1V96A 4F92B 3PWKA 4XQCA 4KN9S 4YO7A 1XP5A 4CDRA 1T25A 4JH0A 5EUCA 3KKLA 2BH2A 3GHHA 4QD3A 1SZJG 1XYVA 3OGCC 3PCTA 4ZAVA 2H1SA 1XROA 1R0ZA 4TMZA 4YRQA 1A4IA 3PC6A 5CNKA 1YJNV 1QHSA 5JAOA 4G1UC 2H5IA 1UZMA 3FCXA 1R1MA 4LXQA 3PWTA 4M98A 4MKZA 3TRFA 1IN8A 3GRRA 4CG0A 1NP6A 2A5DA 2EZ4A 2ZM5A 3ZV5A 4MTOA 3FJYA 1SU7A 2PZBA 2R1VB 3KP1A 5CB4B 3RS7A 2UVPA 1PTKA 1KARA 2HB6A 4LJLA 3K2XA 1QCCA 1GQ2A 3FDJA 3TVYA 4HVAA 1UANA 1NYRA 1ZOPA 2F1IA 3LZ6A 4YRGA 1L7PA 2TMDA 3LWVC 2WPDG 2QHXA 1NRIA 2QYSA 5IUNC 4Y67A 3SE7A 2CC2A 3M6MD 1JMYA 3P0JA 4D0NA 1CCWA 3CNNA 5T67A 2IJGX 4PS0A 1YQWA 1ZEMA 2O3UA 2PCLA 5ARBA 2GUZA 5J3JA 1JDTA 1RSOA 3CNQS 1GADO 2P2ZA 4QVIA 3UA3A 4HB3A 2R72A 5DB4A 4P3NA 5ALFA 4ZVQA 3ZWMA 3OT7A 1BMFG 4OKSA 1YVRA 2B98A 1TZKA 3ETCA 1SQ6A 2EZ9A 3T3MB 5TPZD 2AG8A 3FHJA 1P31A 3OJWA 4MLDA 4GVPA 1KORA 1E0DA 3BGVA 1S1MA 2Q9AA 4D43A 4W1PA 3CJRA 1FXSA 2OLJA 1BCRA 4XKJA 3VKVA 1LPSA 3NIGB 1N5KA 1DTWA 3LQYA 3NDBB 5CVVA 4F2PA 5HP4A 1JQ5A 1I36A 2QV0A 5IJ9B 3BYQA 1DIOB 4EKWA 1DTEA 1GPDG 1K27A 4LZWA 4R1LA 2VJQA 2Q6OA 5KHLB 5B1BB 3BGSA 1J5EO 4DLRA 3HUFA 1N3LA 3BVPA 1FTSA 4Y18A 1QUEA 4FMPA 3N74A 4JI6O 1PG5A 4M1WA 2ZWPA 2ZT9B 1WPXA 3QKWA 4C6SA 1VG1A 2WG1A 3HU5A 2E9SA 4WXHA 3TRIA 4Z3DA 2GILA 2ZJ1A 2WLKA 1NQXA 1YULA 4Q3NA 3RTDA 2PMDA 3LPLA 1NQTA 3R7WA 3QKRB 4BP3A 3D9QX 1K86A 4Y9SA 2J45A 1JG1A 2FY8A 3DVLA 3QVMA 4AIIA 1HDRA 1IY8A 1DPFA 1OTHA 2JAUA 4IIXA 1R18A 2IE8A 5I9SA 5HKOA 3H1TA 2I2CA 4REMA 2I3GA 4JJ6A 3OCZA 1UBMS 3SGIA 4ED9A 2PQ0A 4YR7A 1KERA 1IDSA 1B14A 1UDRA 3CEPB 1XQVA 3NOOA 3IE1A 5EOVA 3Q10A 3L49A 2RGXA 1QHYA 1UBCA 3MK31 4LXGA 1QRSA 4M9QA 4HRAA 2YYSA 4X1OA 3EC2A 1T9ZA 4UAGA 1KD1H 1WKBA 3D36A 1YL5A 3HUDA 4O1HA 3MCQA 3BFJA 5AM5A 2GBCA 2P3LA 4QUIA 4A0SA 4CM9D 2ZIVB 1Z7YA 5H9WA 1N4DA 3ILYA 3N2IA 3UWPA 5LQDA 3IP1A 4XFKA 3F7YC 1IJFA 3ZHUA 2EQ5A 2AMTA 2BFCA 1W2BU 2OBMA 4LJKA 3EW7A 3QYJA 3VPCA 4AWXA 4O2RA 4X41A 1J0AA 3CXHF 1A96A 1JR3A 1K98A 3AKDA 2ZSIA 1VJCA 2YZKA 1JR9A 2RI6A 1FFAA 5K0LA 2HHLA 6REQB 5EP3A 2IY8A 1WLEA 2HH9A 5AWFC 3BL6A 5B58C 3CVUA 1YQTA 3E9ZA 1OCCB 2QWOB 1Q12A 3PKZA 1K34A 1UQRA 4LQ4A 2GTHA 3F6YA 1U7OA 4HGOA 1BCSA 4G9GA 3M4XA 4HADA 5BR1A 3ICEA 5ICEA 1HL7A 1N25A 4RYLA 1DE0A 1DBRA 1ZQ1A 2OC9A 4IQ8A 2B5WA 3JQ9C 1DT3A 2AW3A 3IAS1 2QL5A 2X7XA 4HEA1 2VHVA 3GGCA 3W7VA 4AY4A 4YRMA 5JJLA 1EMDA 3K73O 1ZRHA 4YAUA 4IGFA 3AI2A 3KJHA 1TRKA 2QZSA 4WA7A 5I9TA 1F2UA 3WB0A 5CM2Z 2IXAA 1QH8A 5CK4A 3A11A 3R3VA 1BQ4A 5E6RA 2RAPA 3U3RA 4EYEA 2EEZA 2PBFA 3H0KA 1BJRE 3CC8A 1DIHA 4RAOA 5I5EA 1MJ5A 2RH5A 3QYPA 2B82A 2WF9A 4PCUA 1OT3A 3GLTA 1N0HA 4J7AA 4BQSA 3AZOA 3GB7C 4FX2A 3DZIA 3GF4A 1PW7A 5EXTA 3ZZ0A 1I2ZA 3OIUA 1J4AA 3GT7A 4KVAA 4PIMA 4DWJA 3VZBA 2IU3A 2ODEA 5EMMA 5CLLA 4RNCA 3HDQA 3CPSA 3FLEA 3L1KA 3ZBQA 3ZGVA 4GWLA 3E3LA 3UOGA 2GNPA 3GLIE 1ZO8A 4NU6A 5EZYF 4RKQA 4O2LA 4JLDA 3WQQA 3K1TA 1EVZA 3QPUA 4YP1A 2HRQA 3IYLW 2LXNA 5HDBB 2I6RA 3MT8A 4X66O 1RPZA 5EC2C 4FLFA 3LX4A 4J3JA 1C8BA 4NCXA 1Z29A 2PPVA 3EA4A 5DBEX 4DNOA 2BBWA 2VP5A 2Q07A 421PA 4C89A 4A15A 3AI7A 2FL4A 4URUR 2Q0OC 3T4DA 2BF4A 2JGIA 4JZ2A 1KPHA 2YBEA 4HB4A 4JJKA 1H66A 1E0AA 3TLGA 1NJ6A 1Q82H 3UCSC 2IP4A 4N0PA 3VO1A 2DQZA 1ESDA 2XQGA 4PIPA 2DY0A 2C88A 5EA2A 3ADKA 1O58A 5AJWA 3E20B 5FPOA 3IVMA 2JANA 1VQ5F 1N3BA 3FYSA 3WXBA 3AY0A 3QSGA 4U5XA 3BAZA 2Q1UA 4D9HA 4ZO8A 3OM1A 2YXBA 2EGHA 2ZJAA 1KS2A 1Z4KA 3OPQA 1XJCA 4HRYA 3DTUB 3ZH2A 1N2BA 1SKYB 2IUYA 5CYFA 5KYWA 2JS5A 4PCVA 4JJ8A 4AMZA 2A88A 2E0IA 4N3BA 1NLMA 4ZXPA 5K3BA 3JARB 1P1KA 1NG1A 3A6PC 3LHFA 2D2EA 4DV0B 2FG7C 2J5XA 2OQIA 1QJCA 1E3LA 4O2AF 2ZRPA 2EFCB 5CLGA 3UHOA 4OL0A 2BP7B 5HKLA 2GHIA 3FHLA 3G1WA 1ZONA 5LC1A 2FRVA 5C4MA 4ABTA 1Y9DA 1LC0A 1PX0A 3B52X 4ECEA 5FR2A 4WIAA 4DJDC 3FWPA 4EHKA 2YUIA 4CLOB 3CUYA 4MTLA 1NHWA 2ZAUA 4B4UA 1GG2A 1VMGA 2C2XA 1EWVA 1OCCC 2Z6QA 3HH8A 4J49A 4B85A 2OHVA 3KOOA 3FY4A 3PE3A 5JCZA 1XZQA 2F1RA 3BMQB 2AG0A 3G6KA 1JQKA 5EBLC 3EDCA 3OOWA 5G4UC 2PSEA 5ALRA 3L07A 2CHQA 2PLAA 4F04A 3NBZC 1Z74A 3LNNA 4RELA 3A0HZ 3QPAA 1U2GC 2HEIA 4EJFA 5A62A 1IBLB 4PFSA 2D8AA 2EFHB 4QOSA 4BU0A 3TJZA 3ABUA 1G8YA 2HA6A 2R7LA 2VNAA 2VHXA 2X9VA 2XODA 3AESA 3HCDA 2H92A 1SIBE 4H7PA 4GLXA 2HS4A 3MSCA 3PJFA 5ALLA 4F3KA 2Z9BA 2AL7A 2GPNA 4IV0A 3PP8A 4LE1A 4W7HA 4GNRA 3AR6A 1IZYA 4PBTA 3U9SA 3DKKA 4Q3CA 3DAFA 1MMMA 4YRCA 4XX0A 2J7KA 4F5EA 4XARA 3T1NA 4LYFA 4XE5A 3DNPA 1P1FA 3K1JA 1T9GR 3C16C 3WG9A 2WUDA 4RFSB 2QLMA 3S2SA 3U7FB 2VFAA 1G20B 1KO4A 1JPNA 5LXTB 3FPIA 3JAWB 1V7CA 2D2FA 2DUJA 3ESRA 3QEJA 2CK3G 2RGYA 1WXWA 4FGSA 3FDZA 4YHHO 2VF4X 4FYYA 1ISGA 4LMRA 5ALHA 5ALUA 1B6QA 4GWKA 3U4GA 3TK1A 2DE0X 5I48A 2ZXUA 1ENOA 2V0CA 4D3SA 4UHFA 2HFJA 1QHTA 1Y9JA 4H1TA 5KHGA 1YZQA 3HFGA 2XQJA 5DHRA 5BW6B 4N5DA 5JROA 4Z4QA 4Y2JA 4CLXA 1Y6RA 5JVDA 1AX9A 2HDHA 3SBXA 3AM4A 2GYWA 1S9HA 2EJVA 1ZLZA 3WBBA 4ZAFA 3H1PA 2WE7A 5LR6A 1ZNXA 1Y1RA 3H8VA 3LT1A 5TSDA 4ARUA 1TUIA 4R05A 4K46A 1H65A 3HB5X 4Q4JB 4NSNA 2EJ7A 2HDOA 2AK2A 3HJTA 4H3HB 2A94A 3NBFA 4HNSA 4IVNA 2ZRMA 4WD3A 5DTIA 2QZJA 4ZDKA 3D2AA 1YKGA 2F8LA 4IFTA 1O57A 4JOCA 1HI9A 4FLTA 2DT4A 4UJ5A 3HXPA 2XBMA 1QGOA 2CHSA 1M54A 2TSYB 4CS3A 1IBMO 4BLVA 1H1LB 2AWOA 4XSVA 3TRKA 1MKYA 3IUMA 1AHIA 3P2OA 2J85A 4DJFC 5BN3A 1T8WA 3NW9A 1KMNA 3GJTA 4C7UA 5I9MA 4BNLA 1EUZA 4P38A 4HNTA 1HETA 1NN0A 221PA 4QUAA 2IIQA 3KPVA 4GE0A 1VLHA 2C58A 3SU8A 4RTQA 1LW7A 1F51E 1A9SA 4Q1AA 3F4BA 1JDSA 3IIIA 4KKVA 1QR6A 3OE5A 5F2KA 3RKSA 4UD6A 3BPSA 4DR4O 3OZSA 3QLVA 4MAAA 1J1ZA 3I01A 2WLTA 3I4CA 5AI8A 3CLKA 2LKCA 2PUGA 4X9XA 1IOLA 1XZKA 1Y76B 3TH5A 3RT9A 3ABOB 1CC1S 1SETA 2A8YA 2G36A 4AJ2A 3D6HA 2AEJA 5EVCA 2X8JA 3ABMB 1MAVA 4EKEA 4PNZA 1XMVA 3H8WA 5B3SB 5IXJA 1DB3A 1VMDA 4I9NA 1KYZA 4LOLA 3JAKA 2ZREA 1Q7TA 1X2EA 3OMXA 4JBXA 4GR4A 4J9YB 1LSUA 2NO7A 2XAAA 2GI4A 2LR0A 3KHSA 5GV7A 1YZHA 2Y1OA 5GANK 4FJCC 4LJ5A 1M76A 4QKQA 1PJ8A 2Z43A 2VPWA 1MB3A 2QXUA 1N32B 3EXEA 3QOXA 5EK0A 5COQA 5C37A 1YZYA 3PQ5A 7GPBA 1VTKA 1XI1A 1M90W 1B6SA 5H59A 4V39A 5JSKA 4OI1A 2SKEA 3DDWA 3L2OB 3LT5A 1R2QA 3Q2IA 4GGMX 1J0XO 2PXCA 2PUDA 2WJYA 4ZI7B 4R01A 4QLBA 5HX7A 1UJNA 3G5TA 2V96A 5TISZ 1X7DA 3ES9A 3CUWA 1IXBA 3H2JA 3NPMA 4FDTA 4ZOEA 5CBFA 3H7IA 3ANXA 3MGAA 3WRXA 4TMKA 4ARVA 1QM5A 4F8YA 2QTMA 3P9KA 1TUEB 2WIBA 4O4HF 3KDPA 2A4MA 1VKNA 3E8SA 3IV6A 4XEUA 2Q7DA 4CG2A 1FXKA 3L74H 2FI1A 2ZJ5A 3N86A 3ZLBA 1ZG3A 2QZPA 2PMKA 2CNWA 1ZIPA 2NUPB 1BFKA 2ZRDA 4H15A 1EFLA 1SKVA 1J23A 2RB4A 2O8CB 2IU0A 4YP5A 4BMOB 1EJ2A 3WLEA 1E5XA 1EWKA 5JWHA 4AX8A 3BXGA 1MR3F 2FX2A 1GRRA 4KE9A 4QDZA 1BVRA 4U6QA 2R70A 4UBJA 1WTCA 2ZQ5A 1M7HA 3AVYA 3LHIA 1RW4A 1GGVA 3BRCA 2P2DA 3FROA 3NWEA 1U31A 1HRDA 2GD1O 1TQHA 1V55B 3B7GA 4MPTA 3VH2A 3U7EB 4UTVA 4WJZA 4AB1A 3JVHA 1KE2A 3BMCB 1IXYA 1K8XB 4G24A 2LCIA 4NENA 4PJ0Z 2VJOA 4J1TC 4RTOA 3JVDA 3QXHA 4FHFA 4PO9A 3IJEB 4TS4A 1WAMA 5DKFA 2G9QA 3O8QA 2DTEA 3K9LA 4MKRA 3DDCA 5A6SA 5BUSA 4JYZA 4O4IB 3PXXA 3D4PA 2X8WA 3R5XA 4BLPA 3R9XA 2QVZX 2EIMB 1AH2A 2VF7A 2J3HA 4YJ3F 2VATA 3DQPA 2Q45A 3U3MA 3WIOA 1G18A 1COWG 1T3ZA 1B3QA 2PD4A 4DLXA 1XMXA 1G6OA 2OILA 4A5OA 3ZXIA 4PTYA 4YJ2F 4BATA 2CBGA 1YNOA 4L27A 4EY8A 2V4DA 3I5UA 4PFJA 4D9JA 1B0UA 1W2WB 3VAZA 4J0DA 4KMOA 1XVTA 4HLCA 4LI3X 5SZHB 3KBOA 1UPCA 3OQIB 1H2NA 2DHDA 5K2OA 3IVRA 4KHPO 1J70A 2YDYA 5CLFA 4OP3A 4EDHA 2Z1EA 2C1XA 3FPAA 5GOTA 3UHPA 1GKIA 5IXSA 3G0HA 5LHHA 3PXCX 1W41A 1YXBA 3QUWA 1DKLA 1ZLXA 2GLUA 2Y9MB 5EG5A 2W37A 3KALA 2JFOA 3S02A 1J2TA 1YDWA 4MTGA 1W48A 1I4DD 1H2LA 2JHGA 2QZZA 5NLLA 5A4AA 2CNOA 1WNTA 3KYCB 4KO2S 5DGIA 2I6XA 1T43A 2NU9A 3F6SA 4NFHA 4Y6SA 5JWRA 4ALMA 1PI3A 2H2DA 3EFOA 3FB5C 3F6RA 4TV8F 3BF8A 3CR3C 2R6GA 1OWPA 1R88A 3AKYA 4TWAA 3CX8A 5THQA 2F66C 1IV3A 2CXSA 2YN2A 1H0RA 4I9FA 4ZCSA 4DVJA 3Q8HA 1SVSA 3IP9A 4MR9A 3N0RA 4TLMB 2IQ5A 3FZNA 3K53A 3VYUC 2VHJA 2A5LA 3GU3A 3E8BA 2Y71A 4BXOA 3O8DA 4FGUA 1FNBA 3UA4A 4C6RA 4L51A 1GFIA 4HEA6 1L7VC 4JZYA 4D9NA 3I72A 4E11A 2NV0A 2EWMA 1PV0A 1G2QA 1VF5B 1R4NB 2C2ZA 1JSCA 1VQMV 2YXZA 3OD5A 4HEQA 5KAPA 1VI6A 2C04A 3FWYA 4DE5A 4BYMA 4L7QA 1OX5A 3FGPA 4LJ7A 2YHAA 3JPYA 2F9LA 2NAFA 1DKRA 2H7CA 4OK6A 1KYIA 3DT9A 4NEHB 2QTVB 2GBOA 3AVOA 5EB1B 2GQ0A 3HVJA 4GMGA 1K75A 4D9EA 3FWHA 1X86B 3VZDA 2JLAA 3CR7A 3E9DA 1W5EA 3DYIA 3RHTA 3BWMA 4BFVA 4OGFA 5ICMA 3H5NA 1RXUA 3EJWA 4J0QA 3VMFB 2P9QA 2VBGA 2XTAA 1X1RA 1FYDA 1VPLA 2DZDA 1IM5A 3GIWA 3ITDA 4D5EA 1XILA 1RI4A 3ZZTA 4E32A 4LA4A 5KTTA 1ADYA 1U3TA 1YHYA 2XOKD 1QRRA 2HJHA 4DQKA 1L5MA 1Y1TA 1OI2A 1JT9A 2OCPA 5EMJA 5C18A 2GEUA 2P2LA 2Z5LA 2A35A 2WJAA 5AIAA 3SPIA 1V47A 3FYUC 3KQPA 3WLFA 1JH9A 2ZVZA 1I3LA 5F64A 5FJJA 5KYUB 1JTVA 1KI9A 3D6JA 1Z45A 4WN9B 1XUQA 1QQBA 2UYHA 4HY3A 4MW8A 4GLBA 4FM1A 3HCAA 2KSQA 4OHUA 4ESHA 1L8LA 5EXSA 3DTVD 3IUJA 3SBEA 2Y05A 2E18A 2JJ2A 3GAFA 3S40A 3MOSA 3GLIA 3PS9A 4U0KA 2XUJA 2OHJA 3MUEA 3QEOA 4WBNB 3WL4A 4KR3A 2HJFC 1QMGA 3PQ7A 3CMEF 9ATCA 2UZ4A 3CPHA 2ATKC 4G8BA 4MIEA 1DHRA 4DQVA 1H2SB 3CZCA 1AGNA 4IV5A 4N3NA 3U0BA 2HBRA 1KQGA 2OCCC 3LLCA 3FNBA 5LPNA 1UC4B 3UMJA 4ZZ0A 3TIGA 5CMLA 1BE8A 1VMAA 1Z8FA 3P5SA 2HCFA 1RSOB 1XE3A 3TTVA 5LQRA 2G9VA 1TADA 3C8DA 3MGBA 4BAZA 3E9RA 1P4HA 1IDN1 2WJGA 1M5TA 3O1IC 1QH1A 1TU4A 1QLEC 4KLZA 4YVFA 5F1OA 5ERXA 3G0OA 4BVHA 2FWBA 3C3BA 2V7BA 2FWJA 3I2HA 4GOMD 5KB3A 4HDNB 2YDEA 3K4QA 1D8AA 2EBUA 2L82A 4GZ3A 2E85A 3W6ZA 4UNSA 1OH6A 3C7TA 2XYHA 2AW5A 2KB1A 5FT9A 4Z1MG 3C9RA 3RSCA 3ZJ4A 5K1XA 4QUJA 1QDLB 2FWPA 5SYAA 1T2UA 2O0LA 4LFCB 1I5YA 2QTRA 5P21A 2VQSA 1R6KA 4ZC1A 1D2CA 3Q0IA 2P1ZA 4PC3A 3DHWC 3NGLA 3ZS8A 4J9UE 3U5ZB 1OH5A 1VJ1A 3W2FA 4CDGA 1KAGA 4LJRA 4Z1OA 2JLXA 4FGJA 3DHYA 3GA7A 1CQJB 3DO5A 3M4NA 1KYTA 1YO6A 2HV9A 4P31A 3UWOA 4CIWA 4UXNA 4Y2RA 4I3FA 3T9DA 4CG3A 3RQSA 2Q3FA 3E3NA 3MEQA 3WGLA 2XIJA 3I3FA 3CO0S 5AHOA 4E4TA 2P9GA 3ROKA 4M9RA 3K16A 3H65A 1UKBA 2GR9A 3EN0A 3TW4A 4BAYA 4Q9LA 5KSPA 1PD3A 1I3NA 2Q0SA 4BUZA 3RJMA 3EB9A 4Y6PA 5E4FA 2WU1A 4QO7A 4TVOA 1KKUA 2CMDA 2QRHA 2X4DA 3INNA 1B43A 2H6LA 2VEOA 1PNLA 3KYBA 4Q3AA 5K2MA 1FFDA 2R8BA 1OYYA 3KVVA 2IZ0A 2H2WA 2FZKA 4MQ4A 2ZXWC 1TA4A 4WCFC 3G59A 1ZS9A 3VC1A 2CNWD 1LPBB 5JAIA 1I14A 1EFVA 4D3DA 4CMEA 4ZEOA 4UUMA 4CKWA 5TARA 3B1VA 1EESA 4NXMB 3FZGA 1LQUA 5JH7B 3EQ8A 4FEYA 1LB1B 4JR0A 3UGKA 5LQMA 4QGFA 2B6NA 2VHZA 4FR0A 5KJ1A 4AK9A 2P3QA 1AB3A 2QN1A 2WHRA 1EGVB 3C24A 3NUZA 4KLAA 2GPBA 4KQFA 3X2QC 3OZDA 4RQAA 4N0QA 2VA8A 1GNPA 2MSNA 4GVXA 1JX6A 4H08A 4TKVB 5JFTA 5K0GA 4EG6A 4JMPA 2ZXWB 3AWDA 2IEIA 2XNJA 2Z5GA 3T7KA 2FB9A 1TYBE 2R6ZA 2J31A 3C41J 4QTXA 1VLVA 3BZUA 3N0VA 3FGZA 5B1YA 1VL2A 2PZMA 5JXHA 2DCUA 5DLDA 2CLSA 3I9V6 5TQ0A 3PC8A 5FV7A 2G9UA 2F9FA 2GF0A 3IIMA 3IVAA 4B7KA 1OXKB 1PE0A 1NMUB 3G02A 4KRYA 3FB8C 5EE3A 2Z08A 5J4VA 1JKIA 5GIOC 3RG2A 4QQNA 1DXYA 2PRZA 2LCFA 2OHXA 1CNMA 2CLHB 1HRKA 3IIKA 4DR7O 1N2CA 4PC1A 2G09A 4J2OA 4B3DA 1ZSPA 1PGNA 1Z0JA 3FWNA 3GEDA 3WB1A 3SYPA 1GAWA 3D36C 2OHOA 3TW0A 1LSSA 2NW6A 4R7TA 3O7MA 2PM8A 2R9IA 4PZPA 2CNLA 1NUPA 4G4GA 2O2JA 4EATA 1YZKA 5LQUA 3F97A 3LYLA 5KOYA 4K3AA 2QRPA 5JRDS 1WPQA 5E6SB 1Q7BA 4QHTA 4FIZA 5CBHA 1LH0A 1I4TD 1ONNA 1QQ6A 2HO5A 2OUIA 4GOND 4P08A 2WFMA 3OPYA 2Q73A 4K6GA 3HDJA 1VP9A 1UJCA 1KP2A 1H1DA 5J63A 1UXGA 4MVRA 4FD2A 1IU9A 2VSOA 3RF6A 2YJ4A 3B2EA 4R2IA 3QV1A 4GIBA 4LZZA 1A8PA 1W0KG 4PGMA 2FMKA 2Q6TA 3ORYA 1QKIA 2ZB8A 1W2GA 2O2CA 2EV9A 1ZJ4A 5HE9A 2I3BA 2ORED 5K4AA 3RS3A 5JVDF 2AF3C 1ZH6A 1J24A 2VXCA 3MCVA 4JVMA 1KNJA 1AGPA 3ZIUA 5L6MB 4GKKB 2UUCB 1IWOA 3HMKA 3MCAB 3AHEA 3QX7A 4V0ME 5K03A 1HNZO 2P75A 1YQUA 3Q3CA 3KSMA 5FRDA 3T7AA 3RFVA 4F4IA 5KS2A 3H11A 2BHNA 1CVIA 4L72A 4W82A 1U8ZA 3L4KA 1C1DA 4LYAA 4QE3A 3STLC 3RSGA 3C9TA 1YBFA 4Z6KA 1RRCA 1PNVA 3KWMA 2G6TA 3FFWA 1XZLA 4E2LA 1NNI1 1PQ4A 2JFBA 4MYDA 5K0SA 4L8LA 3LP5A 2FSVA 2P4QA 3ZWDA 3N8GA 4HNGA 2EKPA 2AR7A 3D3WA 3LBNA 1L8DA 1U5BA 3NKVA 3OE7G 4K0RA 3ROPA 4C2AA 1DO0A 3G8AA 3O4FA 4IY1A 5FUBA 3E1GA 3ZY3A 2HD4A 2B7LA 3PB3A 1P2VA 2ZPAA 3KR9A 4KRFA 2H8EA 3C90A 4P81A 3JCUZ 2EU8A 4YIOA 4GYKA 1K73W 4UCUA 3K57A 1Z6QA 1VQ8V 1LA2A 3ANLA 4PX5A 5ES4B 1Y3IA 4HNRA 4ROTA 1EPUA 2OCHA 2Y0IA 2R4QA 4LF4B 2VZ0A 3ANNA 3P19A 4MR8B 4NZOA 5EXXA 4G8DA 4GI1A 4DV1O 2CB0A 2H9YA 2K2WA 2QRJA 2REBA 2FEOA 3AV0B 3DMYA 3IPCA 2LWIA 1KH3A 3HLTA 3QWHA 4FOOA 4MRRA 3ZRWB 2FJ0A 1Y66A 5CT9A 5ESXA 5EZYA 3VU3A 3OBWA 2VZEA 3THRA 5DHSA 2H1VA 4AO7A 5EWMB 4N49A 1QHNA 3UQ8A 4CC6A 1O2DA 2PCJA 2E1RA 2OV8A 3RUFA 3TQSA 5HVNA 4PD4F 3FBGA 2CFTA 3ZWKA 1EK6A 3WHKA 2H16A 1YIJV 1TZBA 2YWXA 4ZGGA 1ZKMA 2XEDA 3MOIA 4HQKA 2A0YA 4LECA 4OV6B 4C3VA 3B1FA 3ZO8A 3B1JA 3L3BA 1YB7A 1F5NA 1MC5A 1ISFA 2OPBA 1T4BA 2R47A 2X42A 3BULA 3LDGA 1FS0G 1TF2A 4JCOA 3TLKA 5BR8O 5L6LB 2NP7A 1QQ5A 1Z4QA 4MYRA 2LDXA 2VP2A 5EPOA 5AVKA 5TMEA 3CVJA 3IUPA 1Y7LA 3UJ6A 4J43A 4KUGA 4BFLA 4R54A 5BSWA 2QOEA 1YHZA 2ZWAA 2J9YB 2XT9A 5LP6B 1M2GA 2G08A 3DMDA 2VHCA 1QR9A 3NIFB 1SOVA 2JCGA 3NYWA 4NQRA 4PZ9A 4TYQA 1R50A 3NHFA 3FB6C 3DG9A 1A32A 4ZPXA 4EYSA 2BR3A 4W99A 2ZETA 3ICPA 4XEHA 5A04A 2O4UX 2YW2A 1XL1A 1NVPB 2AE2A 2CVHA 3PUKA 1S5PA 4B45A 3GMIA 4GM0A 5SY4A 1TTTA 1P7PA 3BHMA 4YP9A 3E6AA 2A84A 3FSGD 1LTQA 1X1TA 3A4LA 1XHEA 5K6AC 4BS9A 1IHOA 4NLLA 3Q3VA 2TS1A 4EF6A 5EQDA 5LYJB 1PL0A 1EM6A 1MVOA 2OO5C 4JB0A 4LOAA 1B0PA 4ZAXA 5HG0A 3QKSB 4DW8A 5I01A 1ZU5A 3GVPA 5KNCA 1S3IA 4P2GA 4E70A 5ELXA 1T5EA 1J8DA 2YOGA 4ZBMA 1NBMA 2BUAA 2JI8A 2RHTA 2JD0A 1BIFA 4GKVA 3P0EA 4UEKA 3I04M 2Y66A 1EE9A 3OOSA 2Z30A 2HN9A 4IS3A 2PH1A 3BMNA 1OYVA 2W2LA 5FP0A 1BWQA 4MWGA 4U2DA 1SWWA 3TNYA 1YRYE 1A8HA 3I8XA 1S2MA 1JJFA 3E5RA 3EISA 2AR9A 3MWYW 5FNZA 1JECA 4OP1A 5COBA 3WQHA 1HX7A 1BCCH 4IDDA 4UNIA 4ZZ2A 4KXXA 1QKKA 2P65A 3QEMB 2C7BA 3EIHA 2JFVA 3ER6A 3IJ5A 4EKNB 4WLUA 1UBHS 2FN3A 2X77A 2ZM6B 2V98A 2YFHA 5DM60 3CLRC 4EYQA 2AI3A 3P0HA 1KEWA 2AKAB 5DPMA 2BDEA 3SXUB 3GARA 5CVDA 2H5EA 1TCUA 3LT2A 2A3QA 3H5VA 3UYLA 1ZM3A 3T5AA 2BGLA 1U4OA 4DMRA 4N03A 3KRTA 3TLJA 1PP9H 2H4ZA 3DF9A 1Z6GA 3PNQA 2C78A 1NFRA 3IBCA 1VSVA 3FPEA 3O73A 3CLTD 2FAXA 2G5GX 4CMJA 4Q66C 4E4EA 1MQ9A 3AHDA 1EN5A 1V8DA 3GZJA 2M6YA 4L3VA 3OEHA 3PWSA 4XVQA 3G2MA 1K89A 3P9IA 1AR4A 2Y4UA 5FTLA 5B1NA 3ZYCA 1M6VB 1HDCA 3F73A 4L6AA 3BK1A 1ZYUA 4OHMA 1KJ9A 2D5IA 4HXEB 1UKAA 1N9GB 3GFRA 4M3NA 5K6TA 1GL9B 4OHZA 4TTQA 1U0GA 1QXSA 3QXSA 4NQZA 3U4AA 5IWCA 1CRQA 1KMIZ 2AQKA 1MOFA 4DSOA 5AKZA 3SJZA 3BG5A 3W79A 1Q0PA 1J42A 1PT5A 4B6QA 1YQXA 5G0VA 4JI0B 3BCRA 4UTRA 1N6PA 2Z57A 1E79G 3NUGA 3ABLC 3P0RA 4GSLA 4GWGA 5JC1A 3L8EA 1NVVQ 3DFMA 1M9NA 3ZCQA 3J80A 2M6LA 2QIOA 2YZGA 2HMVA 1CK4A 4GSYA 4WOBA 4XQEA 1EQAA 4LP8A 4DMUB 4D98A 1YUNA 3W3AD 4DV3O 2G3YA 4OHPA 5LM3A 4Z9YA 3SPXA 4D02A 2WPDA 3WGGA 4YI3A 1U2PA 3MINB 2QL7A 4X63A 2JGNA 1JKXA 3ZKAA 4B6SA 5DTJA 3VR5D 4DCTA 2WWRA 2ZTUA 1PFQA 3CGWA 3A2FA 2V8OA 3L7IA 3QLVC 3V2GA 2AS0A 4B7XA 2J08A 1DTOA 1ORRA 1WUYA 1MB2A 2W93A 2BGWA 1I7DA 6GPBA 1I6KA 4L5CA 3V4FA 4YN3A 2O1WA 3LL4A 3E03A 4Z4CA 1NVDA 5K05A 4YHHB 2QR2A 1Z56C 3QF4A 1Z36A 2IPLA 3L7NA 2XMRA 3Q85A 3TE6A 1MDFA 6ABPA 1WUTA 4UD2A 2QLBA 1E1QD 3K12A 4MVSA 3AY7A 1KRWA 4X3PA 5PNTA 5DEOA 4QGPA 4QX6A 4KAJA 4UEQA 2Z2JA 1EQUA 3ZWCA 4B7UA 5LU9A 2KTUA 1UH5A 3DWEX 2ROQA 4D82A 3OLVA 4OG2A 5HSGA 3MJEA 4RZQA 3AVXA 3M5DA 1ZCFA 1AUVA 3GBVA 4TLEA 2GCPA 4WLVA 3NALA 3L84A 4PLVA 2PGAA 1V7QA 2XWJI 2FXIA 1Q84A 1XZ8A 2Z0AA 2Z83A 4XJSA 3SIRA 3O1LA 3Q2KA 2PL1A 3U1VA 3BMOB 3TSAA 1OBFO 4OFWA 1ZSYA 4B4VA 1VHLA 2E4WA 5FAXA 2GPJA 4TSFA 5DF1A 3BPZA 2WMNB 4HXYA 1Y98A 3NT5A 4A6PA 3VR2A 2HJGA 4E0BA 4PX2A 4R4JA 2IYOA 3C8MA 3SC6A 3ZGLA 4PHFA 1BX3A 2TECE 4QPDA 1DIAA 3QKRA 2IPMA 1OHHA 3ZCVA 2VXBA 1N8NA 5KHHA 2XGMA 4DBLE 4H2DA 1EXWA 1GPH1 1ISJA 4MQUA 1SQ5A 1DQSA 1DFHA 1TD1A 4J11A 4CQNA 5EKDA 3QMMA 3ZGYA 3SHOA 4C03A 4WXMA 4UU0A 3D6VA 3H3FA 2CMHA 4CRWB 2NVWA 2FRXA 3ZG6A 3LDCA 2CW4A 1YMQA 2RJNA 3AERA 3I12A 3BX1A 2X0EA 3VR0A 3FLMA 4PYJA 4F8JA 2HRRA 1VPEA 2IK8A 3VR6A 3LWOC 2JS3A 3VUFA 2WALA 2H59A 4BEWA 4YBZA 2QQEA 2RGDA 2ZYRA 5LN1A 2Z58A 1MGPA 3RSLA 1TE2A 3EEBA 4YQEA 4AP6A 1SVWA 2DLDA 5AW1A 1QIMA 5L3BA 2G1AA 4TT3D 3AKZA 4JJIA 1T9GS 5IT9N 2WKRA 3F78A 4N54A 2PZJA 3AF0A 4V0KA 5TIIA 5CCXA 1TMOA 3O9OA 4ZEMA 3DLIA 2HRYA 1GO2A 1A8QA 1E18A 2R6AA 2ATEA 3A3NA 3ZLVA 4UQLA 1IAQA 5MDHA 2JCVA 1TEHA 3W5AA 4M38A 2VSQA 2INGX 1LK0A 2HMWA 1XJ0A 3BWDD 4LBWA 4D9IA 2FSIA 4YJ3A 2PGNA 2N05A 3SXPA 1TVCA 2PNFA 4LJYA 1SQQH 3PTAA 1XCOA 3U9TA 4FZVA 1NG9A 3ERCA 4PFQA 4R2LA 2GEDA 2J4FA 1SUDA 2QGZA 2XUOA 2Y4OA 3H75A 3WOVA 4D9CA 9GPBA 1FLVA 3AB7A 3ESXA 1F8YA 4Y2XA 1Z28A 2VYND 3EXIA 4DUYB 1JL3A 2BKAA 2C97A 3CCCA 4CU5A 5LDDC 1JQJC 4A3SA 1P45A 2X58A 4FGWA 4DHEA 5I51A 2N0SA 1Z0IA 1UJ2A 1V5WA 4FYPA 1V45E 1BDHA 1S2GA 1V1MA 3ELBA 1IDOA 3NBQA 4FVMA 1Z4IA 1GO0A 3VSEA 1HW7A 4JI1O 1ADGA 1LD3A 1J90A 1PFVA 3KQMA 3OQ6A 4GEGA 1RCTE 3OQHA 2PKXA 2Y0BA 1ST2A 2DBVO 1M5IA 3OAAG 1I30A 1FKAO 4PTLA 4DV7B 4YMGA 5L40A 4MLPA 4AZ0B 2O59A 4XCQA 3FSGA 5DBFA 1MUUA 2PN1A 3PUYA 4AJPA 4ZU3A 3W34A 2RGAA 3F0TA 2OZEA 4NY1A 1AK9A 3EQ6A 4NMHA 1Q6YA 1PZEA 3N8DA 5CJ2A 5HK8A 4C76A 1FTGA 1ZJ5A 2I2WA 3OTFA 3M4JA 3PRJA 2FR1A 3TXXA 3UUEA 1Q86W 1Q14A 2E7ZA 3DKVA 4JI5B 1SWVA 3OZAA 4IVRA 3F5WC 3RRFA 4I55A 3TB6A 4LVOA 5LIPA 4GR5A 4W5WA 2D5LA 3PJRA 1AKVA 3QU4A 1MCZA 4ZCTA 4Q00A 2G1PA 1OLXB 2IQQA 1WZUA 1UFYA 1Q1ZA 3DMHA 3NM6B 2VGNA 3AEIA 4TV9A 1U3LA 1ZD2P 3DBHA 1KDVA 2HNBA 4NARA 4BIMA 4G56A 3UQZA 3MAJA 2OZBA 5C34B 1SA0A 1FP4A 5U9CA 3P96A 1TIPA 1E0KA 3FTCA 5K7SA 2E4ZA 1WP4A 2EKDA 1BYIA 2GZHA 5BSTA 1U4SA 3I64A 1A27A 4JC5A 3QFRA 3HEBA 2VF5X 4OKIA 1G1XB 2PRJA 3NEPX 3C39A 3FRJA 3GN1A 3RV3A 5LP1A 3A14A 1FNJA 1YZ3A 1EVEA 1NAIA 2ZBFA 1WR8A 2GVIA 2MINA 1HLDA 4X1KB 1WMFA 2P9YA 1OHHG 5BRJA 3EVZA 4OB8A 4WFKA 2DHCA 2IW3A 2BGUA 4FUTA 4CNBA 5LMUB 1WXFA 2C2YA 3BYZA 2EILB 1X3SA 3EA0A 3L8ZA 2EW8A 1T2FA 1ZN8A 4FBMA 3SKYA 2FLWA 4BIIA 5C81A 1T1JA 2JKVA 3FTPA 2D6FA 1UBRS 3AHIA 4EA7A 1ARZA 2F3PA 3TZQA 4R2JA 4OYLA 4AM8A 4O4LF 4KZKA 4R16A 2RMKB 4DR1O 2WY2D 3VPSA 2LE0A 2OUKA 1I6LA 3BCSA 3EVFA 1BVHA 4PNHA 4LWOA 2QUZA 4Q19A 1OBOA 1YZFA 4OFBA 3VDQA 4L9SA 2HGZA 2J3EA 5B3AA 1SOUA 2XZLA 1W0JG 4JLAA 3QSYA 1LNSA 1AVMA 2QQ0A 2X6RA 1DC5A 1YNSA 2Q8NA 1GN9A 4YP7A 5AVVA 3U6KA 3H0EA 4Z5XA 4BFUA 1QOQB 1OB5A 1VQ8F 2GF2A 3LA6A 4U7PB 4C3OB 2JLCA 1HE4A 3EUEA 4IEFB 2EHJA 3TUJC 1P0IA 1FVXA 3M8AA 1YOVA 1R00A 1L4HA 5LMZA 1JQ3A 3QPBA 2EINB 1ZP6A 3OZWA 4ZO4A 4B3SO 3E58A 3W90A 4DZZA 3BM5A 1FYWA 2V7PA 2HIGA 1T34A 2EXXA 5E1AC 1H4TA 2E3JA 3L0SA 3NI2A 4KQWA 3PNSA 1VCNA 1Y42X 3M1YA 4O63O 5JSZA 1D2GA 2IF2A 1S72F 3PQ4A 5DWVA 3TKAA 4QBKA 4Z1MA 3V4DA 4ONEA 5IAAA 2EJCA 1NX9A 1EFRG 3CD6V 2H9IA 4NATA 5BN5A 3D3KA 1O1YA 4LNUB 1OQAA 3H97A 3IVGA 4X71A 3K94A 4DMFA 4BWFB 1A1SA 3CCBA 2Z56A 1LF0A 2O4CA 1KSFX 2BTQB 3OAAD 3DV0A 3KYJB 3C8ZA 4U7JA 1RZRD 3PDJA 1O96B 5DGTA 1G19A 1ULAA 3AVVA 2ZATA 4TM8A 1EZVH 4BMDA 4BW9A 1ODJA 1I5EA 4LHVA 2C7OA 4OX9Y 1TYZA 1RD4A 2QB5A 1XZDA 2HA2A 5BXQC 2Y0PA 1KUQA 4BW0B 1QP7A 2G72A 2DSNA 1ID1A 1ZN9A 2C5HA 4W4TA 1NQ3A 4KMSA 4AILC 1HQCA 4YY3O 4WFGA 2NZVG 4GYWA 3M7MX 1XZIA 1ULHA 2ZUCA 1CF2O 2OOSA 3H9EO 3ITEA 2JGDA 3ADPA 4JBWA 2WIGA 4M8SA 3PR1A 2QT0A 4OM8A 4OHWA 4AS2A 4MKXA 3GLFB 2QSYA 3LPNA 4A5UB 5IE9A 1GO1A 4XIFA 3E8HA 4NICA 3K20A 4ETWA 2DQ4A 4PEVA 3FH0A 1OI4A 2W2NA 3DEFA 3EK2A 3R0JA 3TX6A 3LT0A 1P19A 2SNIE 3SQXA 5HFJA 1FP7A 4MVXA 4BE9A 5KDOA 1K8AW 3X2EA 1VSUA 5H80A 1JHYA 1X1EA 4FE7A 2XDAA 2M6KA 3HVRA 3G79A 4DEVA 3HN6A 3IV9A 4IQFA 5DNYB 5G0WA 1R66A 4HWTA 1X7WA 1MV5A 1RCFA 3EJ6A 1OHHD 3E22B 3A37A 3NNDA 1O08A 1PJCA 2MR5A 2W6JA 3LX5A 3NHSA 4DDKA 1T5DX 2O8EB 2AOUB 1LU9A 3FFTA 1Y8AA 1G0NA 2YEVA 1CEEA 4EGCB 2GSMB 4WDQA 2ZR2A 3B12A 5DOVA 4CDMA 4EG1A 2J9FB 4ZICA 8ABPA 3B20A 5F23A 1GTZA 2GOYA 5DXFA 3ZIAG 3K04A 4RY9A 5CD1A 1OCZC 2PX2A 4MP8A 3DC6A 4QODA 2WZDA 4AD8A 1E2GA 3FMOB 4K26A 1YSCA 2VDWA 3DMNA 2A5JA 4CIBA 4EPRA 1WW2A 3TOCA 3BRWA 2UYPA 2HMYB 4LFCO 4E1AA 1P0FA 1H2ZA 1TJ3A 1QVFF 4N8SA 4DBZA 2HWYA 5GZ6A 2VTEA 4CT4B 1PP4A 4CZZA 1GPMA 4ESEA 2I3ZA 5LLDA 1Q0TA 2H31A 4P9OA 3L8DA 1OH7A 2J0SA 2GKOA 2ZRQA 1NM5A 4XIYA 5U4QA 4DT1A 3ZDYB 1W3EX 1XRSB 3L70H 4X95A 4FM9A 4M1QA 2P27A 4Y9RA 4EQZA 1V2HE 1FCJA 1FXHA 4WOCA 4TKUA 2AR0A 2QV7A 2ZRBA 4C87A 4LSGA 3KJIA 3DQQA 1VQPF 3TD4A 1AUQA 4KO4S 1N2OA 3OEYA 1NVGA 5H82A 1PRYA 2VJKA 3O95A 1FS4A 1DX6A 2AFIA 2BFEA 2HU2A 3G9XA 1TZ2A 1WDTA 2PE5A 5GONB 3PLAC 1THGA 1KL7A 1ZNQO 2ESRA 3A0RB 3KLMX 3PX3A 4XXHA 1M10A 1Y7IA 2GPYA 2SCUB 3I9LA 1K0FA 3D5EA 3NM4A 2ZIXA 3PC4A 4JLKA 4BVJA 4DQUA 1C2YA 1W88B 4M0DA 1OFGA 5FL7D 4S0ZA 5L95A 1TCBA 3T1QA 1ZHOA 2Z4TA 3CRAA 5J47A 3MYYA 2H0AA 2PZAA 4QDOA 1YUBA 2LBPA 1XQYA 4RGQA 1JFFA 4UCOA 1PV2A 1E3WA 2QJFA 3H5WA 3BWYA 5DYGA 4B9EA 3P30A 3RIXA 4I50A 2OCLA 2NO6A 3TSCA 1DQZA 1FSGA 3JASB 1ZUHA 2QL6A 2LW7A 5FPSA 1FRZA 1X8LA 1YU9A 1HE2A 3A0UA 2VC2B 3ACBA 3M6UA 4AL4A 4ZCMA 1VIBA 1RI2A 4EHJA 2P9JA 4I50F 5JV5A 4GI2A 4AMBA 1MEJA 3I2IA 4LDNA 5BW4A 4QSMA 2Z8YA 5GVSA 1VIVA 3GRUA 3RSHA 4AKIA 1JHUA 3FB1A 2Q7HA 1IE3A 2QRLA 4H13B 3GYGA 4FNGA 4O59O 8GPBA 4GOKA 5E9QA 2NUTA 4DR7B 4F2DA 4DO2A 5TPZA 1SXJB 3K9NA 4B48A 1L5QA 3MUOA 2ZGVA 1G5QA 4G8JA 4FGZA 4IFEA 4RU1A 1JDJA 4TLBA 3FPJA 5IJXA 6PFKA 4WLFA 5DU2A 5EPUA 3IMPA 3FYIB 3CT6A 3O9ZA 4IAOA 4F3NA 2X2OA 1NP3A 3KHTA 4J76A 2Y4NA 1RQPA 4I55B 2BFOA 3LQQA 4QTUB 4C0QC 1ECLA 2CJYA 4M9SA 5IYZF 1SCNE 3DYVA 3RANA 3TD6A 3SIVA 1FFHA 4I3GA 4EARA 2ALJA 3D8UA 4F6EA 5AJUA 4C0XA 1U43A 3U48A 2PANA 3P0FA 2J9XB 1F4LA 1SU4A 3IHTA 1KC8H 4JDUA 3K5MA 6LDHA 5EN4A 5CK5A 3FRHA 1C3VA 3C6MA 3R0PA 1I32A 1LXCA 4D25A 3ME5A 1WXQA 1GAQA 3K2EA 1GL7A 4R7ZA 2Q69A 3K14A 2AI1A 4AI6A 5ALIA 5BR8B 1OLUB 2VJLA 4GZLA 3TOVA 4OQPA 1R6UA 5JSUA 3KB8A 3FUXA 4J29A 4Z9AA 2CHTA 1A9XB 2G80A 1ODFA 1CN7A 2R2GA 4MVJF 2ZTVA 3WWYA 3QHQA 4EUEA 4EZBA 2W42A 5HTOA 1RC8A 2RJ3A 2IVFA 3B36A 2UUCO 1ZD5A 1ZY2A 3MRSA 4JLUA 4LWPA 4E12A 1HNZB 2JGKA 2CD9A 1UPUA 3GFOA 4GI5A 1BN7A 2CGOA 1O94D 4MPJA 3NHMA 3EW9A 3CWQA 4UTPA 5F1PA 5KBYA 4OO3A 4U39A 4BNDA 4E2ZA 2WF5A 4IJKA 4R1NA 4CL3A 4NCHA 3ZV3A 5L7TA 2RMKA 3NBKA 1XLTC 1NDHA 4EB6A 4KR2A 1GCUA 4EVSA 2DP4E 1MEEA 3BK2A 5JMOA 1M8FA 3PFWO 2Q41A 3LDDA 3ZWNA 7AT1A 1QFJA 1K7YA 2X2PA 3KXKA 1XZPA 1A8IA 4CC5A 3M82A 3EDOA 4JLJA 3P4UA 2D2IA 1TGYA 2WAAA 1YTFB 2Q9UA 4QDKA 1NKVA 3KLOA 3T1HO 4Q9IA 3RFUA 3U1TA 3PRKE 4G1CA 2WZCA 5D1NA 3W5HA 1I5XA 1LDMA 4IYIA 1KIMA 2F7SA 4OREX 4O3FA 5JAUA 5KTYA 1TF5A 1SEVA 1MW8X 2PT7A 1TC2A 2CL0X 3E84A 4EAQA 3LWRC 1U0OC 3CUEF 1XMJA 1DWOA 2C4NA 3CEJA 4QEKA 3TIXB 4I5DA 4ASUG 4FK8A 3VSAA 2CWJA 2OKGA 3FAVB 3GWGA 5AO9A 1ZW1A 5CDSA 2CZQA 2WT9A 4OGQB 5BV7A 3NAGA 3CCRF 4EEZA 1BS9A 2JIPA 2VSYA 4Q24A 4WERA 5SV2A 3VZQA 1P1JA 5D00A 5JD3A 5HUJA 1ZGJA 3FTEA 3CZPA 3H17A 1KTVA 2WJZB 5IG2A 2OCXA 5HQ3B 2JZOA 1I01A 1YJWV 2XDQA 3IPXA 4LZPA 2GT1A 3VDXA 3PTZA 4DC1A 5JYBA 1R3DA 2UZIR 2XVAA 3C5WP 1H7MA 1FX1A 1QH0A 4QREA 1WMAA 4LQLA 5KTNA 4HYEA 1WVGA 2YCLA 2ERCA 2WWHA 1HNXO 3KELA 4FR2A 5BXZA 3BC1A 1EK0A 1NOIA 3WDMA 2VP0A 3I5YA 4G0UA 1OYOA 2MDTA 1SS3A 2AMFA 5E95A 3N1UA 3I6YA 1LNQA 5LDHA 2V5UA 1JVSA 2HWXA 3ZS9A 1Z7BA 5B2ZA 3J7TA 5DK6A 5LQJA 4D8XA 2V4UA 5JNSA 1XQ6A 2XDWA 2Q99A 1RP7A 1BGYH 5EBWC 4DLPA 4C08A 4L2IA 2M98A 4CKZA 4C0LA 2R6JA 1RADA 3S5UA 2JEOA 3ZCPA 1E9SA 2F3RA 2PZSA 4FB4A 1M1YB 4CS4A 2ABWA 1VM6A 3HO6A 3DAHA 3LW8A 3KR0A 2WABA 1KO5A 2W48A 4JI4O 3QVXA 1DEXA 1XQ9A 4WGFA 3H1LH 4NNPA 3ZBTA 4ZDJA 4WADA 2GHRA 1RJEA 3EQ2A 1FUUA 3VHXB 1ZCJA 1W57A 1ILWA 2W98A 1VI2A 1ZNYA 2BEUB 2J0UA 1LLUA 3KT3A 1U3CA 1VHDA 4CM4B 2XA2A 4KREA 1N78A 4ZRDA 1J2UA 3UKDA 1IZ9A 1U2DC 4LTMA 5C1IA 2J67A 3GMSA 1OZAA 2CCKA 1DLIA 1QR8A 2Z4RA 4N0EA 5I7VA 1PVDA 1VYTA 3HI4A 2OK8A 5EIEA 1BU8A 2RONA 4OFZA 3PD0A 3DGEC 3HPQA 5HFLA 2A92A 4KEAA 4KQ9A 4N23A 1O0SA 2HBZA 2IYPA 2JFZA 1CB7A 2DR0A 3CGGA 4GP6A 2X1VA 3D5QA 2B5UA 3EY4A 3K5PA 1EVIA 4HFJA 4Y2UA 2AZDA 4I14A 1QAMA 2ZCJA 2J7PA 2P9CA 4K9PA 1MX5A 5GWXA 2W70A 5IEJA 2RD2A 5CVUA 2BFDB 1RKBA 5CUQA 1OLSA 2Z5VA 3CB2A 4M54A 4U6NA 4UBIA 2A5GA 4MUFA 5FFFA 4RYDA 3I56V 3NAZA 4G25A 4Q9JA 3A6KA 3MCWA 4RHAA 5JZOA 2LIPA 1E2EA 3F5SA 4K2HA 3M5PA 3I76A 4D56A 3H9BA 2WSSG 1XWIA 2FG5A 3I83A 1XHFA 2BGTA 2HOQA 4RCZA 1T4CA 4HGYA 1GK9A 1G1AA 3QNMA 4BCBA 3LFHA 2P2YA 4OGLA 5K3CA 1LQTA 4BV2A 3NHWA 2F8MA 5FL7G 2Z1UA 2RCNA 5DLPA 5GINC 3ST7A 4W5NA 4DS3A 3KLBA 1RC1A 3VH1A 4R9NA 2IP2A 3MT9A 1FSFA 2LFSA 1UBJS 1Y4SA 3MW8A 3MRXA 4AULA 3CE6A 2PG3A 4LGCA 3DVSX 4GXQA 4I1UA 4Z51A 1W0KD 1CZNA 3A0RA 5GONA 3LWPC 2EKLA 2E4AA 2KLHA 4E1BA 4QJFB 5H4GA 2R87A 4FX5A 3WAJA 2YVLA 2QZ9A 2YRWA 2MSCB 4ARIA 3RC8A 1XZEA 1DKMA 1M33A 1G5HA 1RRFA 4I2NA 4PA6A 1KQSU 1U3UA 1K5SA 4K6KA 3EGDA 4YRFA 3S2EA 5FA6A 2B4KA 4OOFA 1PQUA 3P4EA 3CH6A 3W3AA 4PLCA 2BMVA 1Q6ZA 2IX9A 3LPCA 2MYNA 4EJSC 1CETA 1PYOA 4IL6Z 4MVOA 3Q5GA 1JFRA 4G1VA 4G88A 1FFGA 4HDRA 1IFXA 3SJCC 4G1MB 2C4VA 1E3TA 2Y93A 1G7TA 2X2FA 3MCTA 1CEQA 4JI7B 1Z2OX 3NGMA 4GMXA 1GN4A 2I34A 2RAUA 3LUPA 1K5DA 3N8KA 4DLTA 3LUKA 5B12A 4MB6A 1EM1A 1IUOA 4Q7EA 2DX7A 5HKAA 1W5BA 4V0MA 4R8SA 5DM0A 1SBTA 4B8WA 4DDVA 3PRHA 3M6IA 3FGNA 4O4JA 1Z4OA 1FW8A 4KFCA 2BFCB 4AJHA 3RU3A 1R12A 4GDFA 4GNKA 3TJRA 2N3ZA 4LPSA 3TVDA 3DCIA 5JZMA 5T5QA 1I0HA 5DJ5A 1MN6A 2XAFA 1G7RA 1KZ4A 3TZ6A 4OMFG 1GEGA 4CHTA 2M6SA 1QIKA 2V7GA 3DXXA 4RSMA 3OZ7A 3GP3A 3MUFA 4K8ZA 2DPXA 3CCSF 3B6IA 4F9GA 3PRYA 1YT5A 3RYHB 2B1GA 2I6GA 3RTCA 2BBTA 1V16A 3HDYA 3MCZA 4FWIB 3R5KA 4M1OA 1L0LH 5FTJA 4EL5A 3GLGE 4OQFA 4DDTA 4AF6A 1SVOA 4FOTA 2G9IA 2O7QA 1XEWY 3NU1A 5LOVB 3PUWA 3R3UA 4IH1A 2ZB3A 4OJQA 4QJ4A 5E4JA 5LXTA 1COMA 1QFZA 2BZ0A 5TDHA 3MRVA 2XB2A 1SBIA 2DR2A 2Y2UA 2V55B 5I4KA 4G26A 1S7GA 4MVYA 5J2UA 1JVNA 4CXMA 4EY4A 5JXIA 3K06A 5GW7A 2D1FA 3U19A 3ND7A 2IEZA 4WFAV 1GIAA 4J7UA 2Y8EA 4DLVA 4EG5A 2CE2X 5TT1A 1Y34E 3BT7A 1JFLA 4BX9A 3EGWA 1P80A 1Q7EA 2RGEA 4A8JA 1N7JA 1UM9A 3L7AA 5EIXA 1TNDA 5ED0A 3HPLC 1CT9A 4MUHA 2B1IA 3F3KA 3IKTA 4B8YA 5DDIP 5ITVA 2DFKB 1KC8W 1KZGB 5SICE 1I2BA 1V11A 3VI3B 3VC7A 3TG2A 3D2BA 3H11B 3PV0A 2A0KA 3IBTA 4IUBS 1UOQA 4JLPA 4KQEA 4TXLA 1HZJA 1UJBA 1MZPA 3KQKA 3LDHA 3DNMA 3H4TA 1CXZA 2HLDA 3C5HA 4G9EA 2ZVJA 3H87A 4GP9A 3LFOA 4K9SA 4LCBA 1SUFA 4UM8B 1IN5A 4DCOA 4DM4A 4MPRA 3WHLA 1U7XA 3H6KA 3VSCA 1PT7A 5CDFA 1OCOC 2BJVA 2QUJA 1NN3A 1U5BB 1OU0A 2PXAA 4GBED 4LMPA 4RIHA 1M74A 5E7JA 1U3PA 2UV8A 4XLTA 1M4UA 1P6QA 1SUEA 2ZSUA 3I58A 3PD1A 1H93A 4UC0A 5JOQA 3BRQA 3ZE1B 2GN6A 1LBTA 3PQDA 2WDPA 5ALVA 1NI5A 5BQFA 1S5HC 2J30A 2R48A 2YWCA 5K99A 1NI3A 2H0RA 3MWJA 4JT4A 1PTJC 3UGTA 1KF0A 4QDTA 1USIA 5B66Z 2VCEA 1OJHA 4X7RA 2WD8A 3DP7A 1ZNWA 3AUKA 4HDMB 2OLKA 5ARCA 3FBTA 2Q3EA 3MBIA 1EUCB 5HY4A 1GCAA 2FN4A 1WW3A 3GDHA 4DA9A 4LC9A 2JIOA 1F20A 2Y6VA 3R8XA 2YTZA 3HEAA 5EXEA 3STVA 4Y9UA 2WFAA 2R6R1 1O5OA 3P8ZA 3PBKA 4Q21A 3U7RA 3QBDA 3G6EV 4IXMA 4GOOD 4QHSA 2EJBA 1NTKH 1BKDR 1UFIA 1ZCZA 1TLLA 5LZ5A 4X60A 2AXEA 3AR9A 1FSPA 2BI7A 4YPFA 1JLRA 4D9KA 2YICA 4LVCA 5ERGB 1GM9A 3TZLA 4QPKA 4PN3A 1WB4A 4PV1B 2J6CA 4AFNA 5EE9A 3ZLUA 4EZEA 1HL3A 3QMWA 3V4PB 5FUMA 1V9PA 2NT4A 3JX9A 1PVVA 4UM5A 4JTCB 2KSDA 4ZVNA 5ISMA 3N05A 2ODAA 4LRXA 2QXTA 3EXFA 4JI3O 4TSKA 2J3IA 4GUAA 3KKNA 2XAJA 3FIJA 4JHXA 2RB9A 1DAOA 3RR2A 1R10A 1J1UA 2PR7A 3BBLA 4D97A 4YRKA 5EWJB 2NSHA 3CRMA 4V0RA 4I08A 5CFRA 4UNNA 2FP4A 2R62A 2JJ1G 2QMZA 2FOIA 3IGFA 3KAJA 4QG3A 3NV7A 4KYTA 2ICAA 2VNKA 3JW8A 1AN0A 1L5SA 3IMFA 4BUCA 2BTQA 2QLLA 2R68A 3ETGA 1YCDA 3ZWWA 4BTVA 1K7FB 1ZIDA 3FVRA 1TO2E 1FE8A 3A6ZA 1N3YA 4MV4A 4AN1A 2Q21A 5TJ9A 1KGSA 2HV8A 4XDHA 2C31A 2VNHA 3NKLA 3E7XA 2IEGA 4DZRA 2WA4A 5KQLA 3GZNB 4YBRA 2FPIB 1E7QA 5AKXA 3QXXA 4I9WA 1IC6A 3VVCA 3LKZA 1Q6IA 2O0JA 2XEXA 4K6CA 4IF4A 5F98A 4JUCA 2VDJA 4AF8A 4PELA 3SZLA 3V6MA 3L1HA 2OYRA 4X1IB 1G3UA 1Z34A 3F9RA 1JNYA 3DTVB 4OXRA 4WCFA 3RYTC 2RKWA 1U9IC 5DNWA 3GFBA