4YJ3B

Crystal structure of tubulin bound to compound 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 153
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj3B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj3B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj3B01
3JATA 4TUYB 3VOBA 4ZOLB 1W5EA 5LYJA 4X1YB 5LA6A 5JVDA 4ZI7B 2GVIA 5IJ0B 4O4HB 4EI9A 3HKEB 5LP6A 3HKDB 4U3JA 4O4LA 4B46A 5JQGA 3RYHB 4O4JA 4I55A 5IYZB 5KX5B 4YJ2B 5LOVA 4X20B 4TV9A 3VO8A 4EI8A 3JASA 2VAPA 3JALB 4F6RA 1TUBA 2Q1XA 3N2GB 5MN6A 3RYIB 4O4IA 4X1IB 4HNAB 4O2BA 3WGNA 4I50B 2VAWA 4TV8B 5FNVB 3VPAA 2BTQA 3HKBB 3JARB 5IJ9A 5J2UA 5BMVB 3WGMA 4E6EA 5KMGB 1JFFB 3ZBQA 3HKCA 3RYFB 4TUYA 3RYCB 4DXDA 5EZYB 5CB4B 4ZOLA 4WBNB 5ITZB 4B45A 2XKAA 4X1YA 3VO9A 4ZI7A 1W59A 4O4HA 4IHJB 3HKEA 2RHLA 4ZHQB 3HKDA 3ZIDA 2VXYA 2RHOA 3CB2A 1FSZA 3R4VA 5IYZA 5KX5A 4YJ2A 5EIBD 4X20A 1RQ2A 3JALA 4XCQA 1RLUA 5MN4A 3N2GA 1Z5VA 5EYPB 3UT5B 5MN5A 3RYIA 4X1IA 4HNAA 4LNUB 5CA1B 5JH7B 1FFXB 3ZBPA 3C8LA 3RB8A 4I50A 2VAMA 5LP6B 3E22B 5FNVA 4EB6B 3HKBA 3RYHA 5BMVA 1Z5WA 4O2AB 3N2KB 1JFFA 4FFBB 5KMGA 1TVKB 2Q1YA 4YJ3B 3RYFA 3RYCA 4IIJB 5EZYA 4DRXB 5CB4A 5JCOC 4WBNA 1SA0B 5IJ0A 5ITZA 5M7EA 2RHJA 5GONB 3JAKB 4O4IB 1W5AA 4IHJA 4X1KB 5CA0B 4ZHQA 5LXTB 3WGLA 4I4TB 5C8YB 5J2TB 3JAWB 3JATB 2R751 4KWEA 2R6R1 3HKCB 5LP6C 5LA6B 5JVDB 5LYJB 3UT5A 5EYPA 3WGKA 4LNUA 5CA1A 4U3JB 5JH7A 1FFXA 4O4LB 4TV8A 3M8KA 5JQGB 2BTOA 3E22A 3JARA 1W5BA 1RQ7A 2RHHA 4O4JB 4I55B 4EB6A 4M8IA 5LOVB 1OFUA 4EI7A 3WGJA 4O2AA 4TV9B 3N2KA 3JASB 4FFBA 1TVKA 4F6RB 4YJ3A 1TUBB 4IIJA 4DRXA 3VOAA 1SA0A 4O2BB 2XKBA 3M89A 4U39A 5JCOA 5GONA 3JAKA 1W5FA 4X1KA 5CA0A 5LXTA 2BTQB 5IJ9B 5J2UB 4I4TA 5C8YA 5J2TA 3V3TA 1W581 5EIBC 3JAWA
chains in the Genus database with same CATH superfamily
3ET5A 3UJ7A 3TTTA 4TMVA 4OCZA 4BVFA 5HE8A 4WCEV 1IPFA 1VH8A 4J0DA 3QVLA 4KR3A 3ND5A 4PWZA 1QYRA 3C3AA 1AF4A 5JS6A 4V0NA 1CUSA 1E2QA 5GM2A 1PL0A 1K8XB 1QO7A 1X7XB 3UPTA 1Q86H 2RGAA 2GUZB 1AZLA 2BHLA 2XDWA 3HJTA 1VQ5F 5E2AA 5L53A 2VAMA 2CXHA 5EC2C 2QRVB 4YDSA 5HM8A 3OX3A 3IODA 2AE1A 1AKUA 5BR1A 3AL3A 3SJUA 3RVZA 2ZJ3A 4YMVA 3KTAA 4RJLA 2G17A 3OCZA 1EFTA 4ESVA 2GAIA 5E2BA 1FDTA 3QEMA 5LQCA 4UHBA 3ZEDA 3VZQA 4OK5A 1K68A 1DO0A 2PRYA 5KYXA 5GMOA 2HGSA 1Y6RA 2IT1A 3STWA 1CDOA 1NPYA 4I36A 4OQEA 4CCYB 5LYJA 2AUMA 2AZ0A 4OAPA 4BECA 4UFOA 3HB7A 4QD3A 3IEKA 4R0MA 4LJ4A 1S3FA 1DJQA 5KZMB 2Q27A 5A2QA 3CIOA 4AROA 2OVBA 2XQIA 3KEMA 2X0IA 3V6LA 2AQKA 3N4ZA 3QOYA 1RRVA 1FDWA 3O03A 1Q6ZA 3HFSA 5JWOA 2RAVA 1ML3A 4WKGA 4J1SA 2PUSA 4R5HA 1UFRA 1FA9A 4IGIA 5IUJC 1DELA 3VVMA 4AJEA 1RPJA 3CRW1 1N8RH 5K0EA 4OJNA 2XE8A 2HJVA 3H5AA 3MS4A 2B4QA 4H3HB 4FYWA 2B1JA 4FZ5A 4Q21A 1QJ4A 3VNRA 4MV3A 5DTIA 4ZO4A 2AUTA 4UV8A 4D9JA 3LFTA 3N75A 3VH2A 3AEQB 1BYIA 3OJEA 2N47A 4AQDA 3ME5A 2VDQB 2O4CA 4JVMA 5CXSA 2EU8A 2BGWA 5FPKA 2QNRA 3OAAA 4UEWA 4N7BA 1H3EA 2EULA 3DLCA 1XCBA 3BCSA 3A27A 2O8VA 2XY4A 2GJ9A 3PRJA 2FMUA 3RKUA 3WB1A 3F2IA 3H75A 3S8EA 3TL6A 1C3OA 4NU6A 1BU8A 4QKQA 1JQKA 1TJ3A 2QJRA 3RUCA 3K3PA 4QYSA 3KAKA 4AZWA 3EH2A 4HXEB 3EGDB 2CDBA 4Q9AA 2QSAA 3REFA 1DBFA 2PPLA 4KREA 1BQZA 4FU0A 4H17A 3NGXA 2TSYB 3RSHA 3BH7A 2QTOA 3OBBA 1OYOA 2BRUA 5BYJA 2Q73A 3ZMSA 3FGPA 4CXMA 2JAQA 4TV8A 1F23A 2PYIA 1U40A 1C1XB 3B2QA 1OFUA 1Z08A 4DK1A 4FHFA 1EBUA 5K9ZA 2Z09A 3AFNA 3MMNA 2WJ4A 5ITWA 1RLJA 2FZVA 4ERNA 1FXUA 3GZNB 1S8FA 1T3SA 1IV3A 5HRAA 2GWRA 4NBTA 3KSMA 2Q4EA 2QZZA 1CRZA 5FOTA 2D6FA 3ESDA 1R6TA 1CZUA 3HO1A 1WCIB 2IYNA 5BWBA 1B4DA 4GLLA 3PDUA 1G20E 1BSMA 2ZR8A 1XCJA 4PYKA 3ODGA 2GVNA 4MW4A 4QC2A 1TMOA 5EYPB 1PS8A 2CXQA 2C5EA 1I2DA 5EUQB 5CD1A 1QKJA 1LUVA 2GM9A 2Q7GA 4MYCA 3JWPA 4BO6A 2IEAA 3N7AA 3EGWA 1CPYA 3PQDA 1P1KA 3ADOA 3D3KA 2ZSKA 4HMOA 1CEXA 1YRYE 3EIOA 3KD2A 4I66A 4O4JB 3LBFA 3JQRA 3PC7A 1Z9BA 2X2PA 4RZ2A 1S5JA 4MUAA 5AOVA 4PGHA 3RYHB 3LSUA 3LWZA 1MOPA 3ESBA 3ZNOA 4RVNA 3RU9A 3SQDA 3CN7A 4TTQA 2P6UA 3F7VC 1SMKA 1CUWA 2VPYA 1ISFA 3IOEA 2RB5A 3PC6A 4FD3A 4M0LA 2BTQA 1Y3DE 1L4KA 4DLZA 2DKNA 3TSOA 3IKFA 1YUBA 4NR0A 4C89A 4GVLA 2OL4A 1ESZA 4Y9SA 1UPFA 3CR8A 5GINC 4MV0A 1SU4A 1OBCA 3GLKA 3KAPA 3WKBA 4DV2B 2OD2A 3G8BA 1GA6A 1M1ZA 4MV9A 1FY2A 1QP8A 2GCPA 3ZJUA 1QFZA 4LWZA 1ZX1A 5HVNA 2XMZA 1ZR2A 4ENVA 3GBSA 2OORC 5JVDB 1N3BA 5COAA 4ZV7A 3HZHA 1OIWA 2P67A 2PA3A 4C7OA 4EKNB 4YIPA 1S01A 3M1YA 4IJMA 1NP6A 2IX3A 5F7JA 4CM4A 2QX8A 2FWIA 2G7ZA 5CEEA 3Q6IA 5BSEA 2VQSA 1YJXA 2NZUG 2ZOSA 1ZESA 2K2QB 2ZIXB 2ZVZA 1UFIA 3IEPA 4LSGA 4AQYB 5DNDA 5DSXA 1WMDA 1VGRA 3FR7A 4XPZA 5JZVA 2C4KA 3RAPR 2GSDA 1XRSB 1BXRB 4DR5B 2H2HA 4U2EA 5D00A 3LVQE 1RSOB 5F5NA 3K14A 1RPNA 1Q2XA 1UK7A 2R96A 2Y66A 1CEZA 4IF6A 1XNQB 2KGWA 3LDCA 4YRMA 3IDAA 3ICEA 5EPEA 1YF3A 2DOSA 2P0YA 2O7VA 2COUA 4ALIA 3JATB 3R5JA 3TOSA 3H2HA 1OROA 2AF3C 3I72A 1KU9A 4ZT3A 1BE6A 4DZRA 4J0GA 4U7JA 5CFOA 4YASA 5EHZA 2QHXA 2HVYD 3ILYA 1NVBA 2X8BA 4FR5A 1ZUNB 4UVHA 3ZXXA 5F9HA 1VQLF 4MTOA 3AVYA 2XCLA 4D79A 3L6DA 1W29A 2QTSA 2LV8A 4XWYA 5DYWA 4CLDA 1W73A 4DPKA 3OZSA 4GDFA 1VQ4V 2OZLA 3ZCVA 1OCZB 1RWWA 2Q46A 5HNKA 1F0NA 3K9WA 2SKEA 2F3QA 3P4EA 2Y0EA 4L27A 2B1RA 4XZ3A 4HGQA 1T4MA 5EESA 2J4DA 3PWTA 3I4FA 2C88A 2ZE6A 4INAA 7MDHA 4CIAA 5JBNA 1XI2A 1DINA 1GDDA 4PYJA 1GZ3A 4TQFA 1EXVA 4HJRA 9LDTA 2Q6IA 2DJVA 2QUIA 1NULA 3F67A 2B94A 3WQHA 1U5BA 1NFRA 4CL3A 2NU7A 2VDNB 5CX1B 3C7CB 1GTL1 4I8IA 1NNUA 4WFHA 1UAYA 3AYZB 3N2ZB 2A1TR 4OMCA 1N2SA 4BFUA 2AOUB 1FS5A 4AO7A 4AZ0B 4MS3B 3C6KA 1JR3E 1VKZA 5M34A 1RXCA 1OAPA 3EY9A 5B2FA 4HAIA 1GKUB 3ZV7A 3QVTA 1T25A 4U2DA 2VP4A 3QVWA 1KK1A 3VO9A 3Q2KA 5SZKB 5FH9A 4YJ2A 4MWSA 3RWMB 4Z7OB 2HQSC 5KYYA 3OHMA 4LNUB 3M6WA 3OMNB 5KYVA 3MLBA 3LJKA 4AS3A 2BM0A 4M49A 4YC7A 1HR0O 2UXCB 1TEXA 3Q8XB 2JI8A 3KJJA 1SBYA 4G9GA 3VOTA 4FI3C 2V45A 4RLSA 5JV5A 4JOBA 4DHWA 1XCOA 3G6WA 1VL8A 2JLCA 3FHTA 4ASUD 2XNDG 3HU3A 4KWHA 3TZHA 3S06A 4CKBB 2WM2A 3QKSB 1LVGA 4M46A 4NYMR 3V8PA 4MDEA 3O83A 2FUEA 2JEYA 3TBFA 6ADHA 4O33A 3DUWA 3DYIA 2AX3A 3NUGA 3IKJA 2EBHX 3EORA 1Q7BA 1ZCBA 4GM1A 4DA8A 5HEKA 3U81A 3OR6C 1YOVA 3R20A 1XN4A 3UK6A 1W41A 4HYTA 2C7PA 4YXWG 1DX6A 4UQPA 4GYKA 3ONEA 3VNQA 1XL0A 3PX2A 3RIMA 2CLCX 2VRNA 3EEFA 1FTWA 5ITZA 1ZFNA 5I5EA 1P17A 1MT3A 3PFHA 2G7MC 1AZWA 1K06A 2P2CA 2A0YA 1XK6A 4LVCA 4YAWA 3E9NA 3JZAA 4ZYYA 1L5VA 4MYSA 1WS6A 5LMUO 3ZW7A 2GJ4A 1QRDA 4M98A 1UJMA 2OZVA 3S02A 3ITNA 4R6ZA 1PX2A 2UYJA 3O75A 4DB2A 4G5GA 4BV8A 1Z3IX 3EK2A 5ECYA 2GK3A 2BFFA 2BKVA 3B40A 1LUAA 4DR1B 4PSCA 4XSVA 5T5QA 2ZJAA 5ARCA 3CC2F 4EW1A 3MT0A 4MPRA 3OECA 3AVOA 1H3NA 3T7SA 4LOJA 2FB9A 5CEJA 3BXZA 5LD2B 3KJKA 1Q3HA 3SE0A 4WZZA 5EB1B 4BAZA 2VTBA 3TIGA 1CS0A 1BFDA 3TW8A 4QTTB 1QR9A 3G5AA 4XX1A 3V2IA 5K1PA 4PHTA 4FT2A 1X52A 3STXA 1GGFA 2B69A 1H94A 2Y1CA 1KDOA 4U6NA 3FHLA 1WCWA 2JCBA 4DRYA 1Z73A 5D1NA 4XQ0A 1EG7A 3PTZA 5JPIA 1CY7A 2Y0CA 1V7CA 4UE3S 1P7BA 3IE0A 3T4UA 5SY4A 3WB9A 4EHIA 2HRUA 4Q4HA 2OA0A 1OKKD 2ZUBA 4I1UA 8ADHA 1P77A 2LR0A 3VR2A 1CLEA 4OYLA 1CE8B 4U63A 1FX0A 4CM8A 4ENUA 4Q7LA 4ZGGA 3TRKA 3PN1A 1MH1A 1Y4AE 4XQ9A 1KYZA 4N76A 1CJMA 3DBRA 1TZCA 1KZ9A 1ZKDA 4CV2A 4QTZA 3PHHA 1WHTA 2KG4A 2QZPA 3ORQA 3S5JA 1CLUA 4OQNA 1LDYA 3RU2A 2WNIA 4LTMA 3PE4A 4F84A 3TDKA 4C8GA 4N7RA 3ECCA 3TPFA 4JY7A 4AKTA 5ALNA 3IFSA 1G4YB 3MTQA 3RFTA 1ORTA 3GFGA 2XWJI 5LC1A 3IRVA 4YQYA 1YL7A 4DW8A 3KSZO 2DG2A 1RADA 4F5DA 3AONB 1VJTA 2V7TA 5HDQA 4WFGA 4UEJA 4B6PA 1UDAA 1YDWA 2DR2A 4QE9A 3QLEA 1FNNA 2WB4A 4I50F 3K6SB 2ZUSA 1JKMA 2ATXA 4OAQA 3R0XA 2RH9B 1JFVA 3R5KA 4FZRA 3RR2A 1MC8A 4JVOA 3QK7A 4PSKA 3HKCA 4FYYA 3SI7A 4XYEA 2XTNA 3V8NA 4D8UA 1N9GB 1XTZA 4CT0A 1G291 2OCBA 3HPQA 4NQZA 4QE3A 3VO1A 4W8HA 5FKJA 4TQDA 4XWOA 2OY0A 2G4VA 4MPTA 3ZWWA 4M9QA 2NV2B 1QUEA 2KJQA 4X61A 1E1QG 4U9UA 4L85A 2BR4A 4KV9A 3U10A 2VYCA 4UXJA 2KG7A 4V2UA 3O3NB 3J80A 1AXRA 5B36A 5FI0B 1PJ3A 1GPDG 3LY8A 1K7SN 4TRRA 1PT8A 1X9IA 2I6TA 1FFCA 2OO7A 4URFA 4ZQHA 1U9CA 4BL5A 2H7XA 4EVQA 3GX1A 1OWNA 3MCAA 4IIHA 1WB6A 1YIAA 2WG0A 5CVDA 3LLUA 1ZGGA 5FIUA 4EPRA 4FYJA 1PJCA 1X74A 1Z4NA 4JD5A 1M34B 4BXOA 1AKWA 2WHRA 3VI6A 2ECOA 3I9KA 4U7NA 5B2EA 1CFZA 3KL4A 4JBNA 1N3IA 2QWPB 4ZXFA 4XE5A 1WETA 4JYYA 3SJCA 4R4JA 5HF5A 2XRFA 2LGQA 3KHUA 4J0FA 5GWXA 3DZDA 3CH6A 2VHZA 2GDSA 3NXSA 2BFDB 4BN5A 1T9BA 5ED0A 4DMRA 3X1ZA 5KDDA 3AKDA 4CQMD 4R31A 1WP9A 2PLRA 4NYMQ 4RGQA 4RVFA 1QFJA 2HNBA 2QT9A 1K7FB 1Z4JA 3MWFA 3JTEA 4XUEA 4EYEA 1QV6A 3BREA 3COWA 2ITDC 5I9SA 1P19A 2ZB7A 1M1UA 3SIWA 1KDTA 3ZU3A 4B71A 4K3AA 5F1KA 1RI5A 3D3JA 2M6LA 3B53X 1W88A 1QB8A 4GR4A 2ZR2A 5IWAB 1CS4C 3FMVA 1JEQA 3FLMA 4YRFA 1F8UA 1ANKA 1R1MA 3KSUA 1E7RA 4FFRA 4ARIA 3N70A 5CCDA 2I80A 3AGQA 1LKZA 1KSFX 3M4ZA 2GSWA 3P2KA 1OX5A 4M60A 3DFZA 4XDJA 1M67A 2W2MA 4EQZA 2NP7A 1Z35A 1GAQA 4BFCA 1DF5A 3QXJA 1P6UA 4MWTA 2EL7A 4BYMA 1X19A 3N2EA 4KK4A 1GR0A 4IXWA 1NKSA 4CMGA 4KRFA 4BNDB 1L4BA 4FFPA 4Y2QA 4PTLA 2W2LD 3AR8A 3A1TA 1LI5A 1XTKA 4FGKA 4LIPD 4QATA 1PJ8A 5L7YA 3L8CA 3MAQA 3QELA 3IDFA 5HSGA 2FEWB 1NR1A 4J0QA 4DEYA 3H5VA 2G5PA 1EIWA 3EZ9A 3GCDA 3JYOA 1SZQA 2AC7A 3HYRA 4Z8XA 3HLYA 3I3SR 3DVRX 1CXZB 1R4NA 4AJ9A 4GMKA 4DLSA 5AVSA 4D4KA 2EZ8A 3DDUA 4FGJA 3R0JA 2JRLA 3UJPA 3VSAA 1FTQA 3AWIA 3QF7A 5I7FA 4B8ZA 3P27A 3FCOA 1SG9A 4ZKDA 3R7DA 3DB1A 4OJMX 4GSYA 3DG9A 3Q85A 4BT3A 4NECA 2BGMA 3M6IA 2C7BA 1V43A 3TIIA 1WPXA 1M0EA 5LJLA 1HNWO 3HY6A 2VNHA 2W6JG 4EPXA 4MIYA 3PQ8A 5HP7A 3VPGA 3L0DA 3AIMA 2KBFA 1GGEA 4PSUA 3H16A 5LQUA 3ELYA 3SF0A 1AS2A 5JJLA 2GLZA 4D6YA 3L6CA 4LV6A 1U8CB 5PNTA 3QFHA 3F74A 3RT7A 1G64A 2VJDA 3T2MA 2H3HA 2X0DA 3G6EF 2I9KA 1J0CA 5HUJA 1K7EB 2UVPB 1EA7A 1BTOA 1K27A 1E9RA 2MSKA 3ZV4A 3CVVA 4ZHQF 5LNK1 2IJJA 1E8NA 2I2FA 1RP1A 4MQUA 5DISB 4AFNA 5JXIA 3QU9A 5H8WA 3HKEA 1BQ0A 1REQA 3U11A 4C3UA 4M1WA 5KTTA 2DPXA 4UE2A 5DK6A 4YCJA 1GZ7A 2Z2YA 3EXEA 1NU1H 3OKCA 3JR7A 2HP3A 1LF5A 1U3VA 2O5VA 2YJ4A 2DYRB 2PSFA 1I6KA 1R9JA 1PWZA 1KMCA 4Z9XA 5D5PA 2QW8A 1TZKA 1J4AA 5CDFA 1OA0A 3GHHA 1A7UA 3WRXA 4PLYA 1X2BA 4KQ6A 4LJ6A 4Q66C 3IAS1 5ADVA 1Q0UA 4BQFA 2IGBA 4NH0A 1WKVA 1G5RA 2J87A 2RH5A 2X0LA 3NASA 2XRYA 1VCOA 1FFYA 5C35A 3U09A 1DGSA 2NPFA 1X7ZB 2WFMA 3N0WA 2W0FC 3EYAA 2HF9A 1XMQO 1SZPA 1IXSB 3ZI0A 3FSRA 4REMA 1KAHA 1V54C 3IOCA 3OQMA 5EY5B 1WXGA 3WHPA 1X80B 3BGDA 4LTDA 2JDIA 3TKAA 3H5IA 4L9SA 1CT9A 5LDDC 2F9MA 1RLUA 3HFGA 1Z4IA 2PWBA 1QP0A 4LXXA 1Q19A 1RWOA 2QRZA 5CT6A 1PSDA 1GKYA 4X85A 1W5AA 2X7XA 1DTOA 3CHYA 3EQ2A 2O52A 4TL8A 1WF6A 4MAAA 3AJ9A 1ZI6A 4V3BA 3BMCA 1X9GA 1QZUA 4P53A 1AN0A 4V38A 2BGKA 3PL1A 4FZ0A 3A4YA 1DHTA 1Q12A 5FBLB 3IT2A 2XA1A 3NMUC 3WL6A 2HK8A 2OQ2A 3H5WA 3AERB 2OKCA 3A1VA 2W00A 2EZUA 2ZJZA 1WBDA 2IOFK 3ZYZA 3BGIA 1BD4A 4RANA 3J80N 3Q3VA 1ZCJA 1JXMA 1S76D 1AG9A 1XJQA 3N59A 2NAPA 1RJDA 3CMAF 3HI4A 4BBAA 5AI6A 1VDZA 1M5TA 2I22A 2WM9B 3EOBI 4J49A 3OX2A 4ZQBA 3H5OA 3O6VA 4BZXA 3A2MA 5EIBD 8GPBA 4RTRA 2GOYA 2DBYA 5EKTA 2UYGA 4ILKA 3RTDA 3AR5A 1RMTA 5BVHB 4IHKA 1BS9A 5IKMA 3EMDA 4FMPA 1IHUA 4NHEA 4EKGA 2I6QA 3X2SA 2Y1WA 3I2IA 1VE6A 3HSYA 3BMQB 4TQAA 3AF0A 4FM9A 5HW0A 2CJWA 3D7LA 3EXG1 4HNSA 3PQ6A 1Z8HA 4N1AA 4OY3A 4NCBA 4ITRC 2OBFA 3WLKX 1VSQA 3I30X 1OYYA 2MWMA 3JS5A 4BNKA 4BWYA 3DE6X 2QKAA 2P9CA 3DQQA 3D6AA 3HUEA 1DC3A 1Q81H 2ZUTA 1B06A 2VDPB 4KFTA 1E6UA 4IIBA 5AW8A 4M22A 2P11A 2EFHB 3KKEA 1Y7TA 4R5MA 1TM4E 5EMKA 2XYQA 1U11A 2GETA 3QEJA 3QPBA 3GNSA 2Q62A 1QQAA 2OCHA 2OTJF 1ORVA 1LNQA 4UHFA 4AP9A 2FFQA 4I6GA 3K53A 4B6QA 1YT5A 4RH0A 5JARA 4YP1A 2EF1A 3ABIA 2GILA 1Y9ZA 1EK1A 2FLVA 5DM70 1DIGA 4ZVSA 1QMGA 2JIQA 4F5WA 1JH9A 1GFWA 5F78A 1J2JA 1WDWB 1KR2A 1ZOPA 4F5ZA 2QN2A 4DDHA 4PAWA 1NWCA 1W93A 3NM5A 1NC1A 1LSOA 3TNLA 1X13A 3TNFA 2HIMA 2XH8A 2VBFA 3EZGA 1HT3A 5JSYA 2QTPA 1Q7TA 4XGIA 5J2TA 3VR5H 4RWEA 2FGJA 4HTFB 2YC2C 5F3WB 4EJSC 1I2CA 2P3OA 1UCFA 2D00A 1XZLA 3P0FA 3SM3A 2EXXA 2Z56A 4MX8A 4TLBA 1UKBA 2QMOA 3E9CA 4FLEA 2W0MA 4G0NA 4D0RA 3W4KA 2ZETA 1SETA 3RC2A 3ZY2A 4WY5A 3A28A 4P34A 5K0NA 1SC5B 1G5HA 4YMWA 1MH9A 1HDOA 4CL2A 3ZV6A 4FZJA 2IHZA 1JYFA 1WU7A 1FKAO 3VR5A 3ILHA 1KJJA 5G41A 4TWZA 5GONB 3LUAA 4IXMA 3I4CA 3TEJA 3R66A 5TEVA 3JQDA 3D54A 1YDGA 1V3VA 4J1TA 1UL1X 4G63A 4WECA 1JFLA 3TCXB 3UNXA 3T1YB 2I29A 1SQ6A 1Q90D 3L8HA 3F98A 2Q5EA 3DH0A 1BH6A 2PF4E 1TYEB 3K6JA 1ZN2A 3TIFA 1U2TA 1L4GA 1QRTA 4ARAA 2NSJA 4DCNA 1D09A 2I0FA 2P5SA 3NX4A 1TAGA 3NFRA 1NR5A 4CH3A 2JKZA 2DZDA 5FV7A 4NMWA 2WPNA 3KNZA 5GAJA 2GCIA 3CMCO 4DV0B 3PPIA 3F47A 3TOVA 3BZWA 1TUEA 1QOQB 3EVCA 4IHJB 4EKIA 4FONA 3HJNA 5J63A 4JN6B 3KOXA 4OOFA 5AJVB 5DDIP 3EVNA 1TKBA 2HMTA 4EO4A 1M4UA 4NG5A 221PA 3RB8A 3K0BA 3VUFA 1T4DA 2HMVA 3CYOA 6ABPA 2RHTA 3DO6A 1KDVA 3TZLA 1OHHD 1YRHA 3JYCA 4MRVA 3PICA 1VC2A 3H17A 1P9WA 4UM5A 4EG7A 4XQCA 4YS6A 5HRUA 3OKFA 5E4JA 5J4KA 3I9JA 4H16A 4BVKA 4BN0A 1DZIA 5CITA 4OXKA 1Z0ZA 3K0KA 5K6AA 2W42A 2R1TA 5IVHA 1V1RA 4YRDA 3T3MB 4RVCA 4XWAA 1RP3B 1YZUA 4G8CA 4EF5A 4JT4A 3H65A 2PUDA 3R0IA 2EJUA 5BO5A 4RFSB 3W8DA 3T1QA 1EEXB 2OC4A 1P1FA 4WE3A 1APBA 1J21A 5HJ2A 3CRVA 2HADA 2QRMA 1RZRA 3HJGA 1F51A 4OJQA 2R8YA 5L3BA 1GV0A 2MINB 2QGZA 3UB4A 4CNBA 3R5FA 4MQ5A 5HCUA 1XQVA 1O8CA 5CA0B 5ALYA 2IS4A 4EA6A 4WZBE 1XRMA 5DF1A 1X3LA 4LC9A 3KSDO 2DLDA 3F97A 1GZ4A 2YJGA 4DCGA 5HS4A 3KZMA 5TX7A 4J76A 1LW6E 5DHRA 4LPKA 4D4LA 3SJBC 3K4HA 1RTKA 3WK9A 1SQ5A 1R0CA 521PA 3AG2B 2OV4A 3SZLA 5C4IA 2B6NA 2HN9A 3ZX5A 2O2IA 4LYJA 2A9RA 3PC8C 1I7DA 3RIGA 4D9FA 1QVFU 1JTVA 5DYNA 1KDYA 1U0OC 4EJFA 2V0GA 1XK7A 3MT8A 5E1OA 2H8PC 1SB9A 3GEHA 2BSQA 4A0RA 1IOWA 1ABBA 2EHJA 3PQ5A 3HXKA 1NE2A 2F17A 3HJBA 2I4TA 1CQIB 3A3NA 1YITV 1RWXA 3AY6A 1EGAA 1P4GA 5BPHA 3I9NA 2NUPA 3WO1A 2ZJOA 3TLYA 2WINI 4NC9A 2QTMA 3VYTB 1XT6A 1TE2A 3UF0A 3GAMA 5C5EA 4PLWA 3E1SA 3E22A 1V5FA 4E2WA 1XJWA 2A9OA 3LWQC 3FUWA 1VMDA 1ZWIC 4CL8A 4YRBA 1BCSA 1LC0A 2OHIA 2IBSA 2EP8A 3EYWA 4U5XA 2L19A 3AUAA 3K6KA 3CE9A 4E14A 4KLAA 1UDBA 4YAFA 1R12A 1HK7A 4FMDF 5JNUA 5IYZB 3Q0EA 1IVNA 3FE2A 2QVLA 2X9VA 2H7CA 1SUSA 2Y9MB 1E9AA 3K9SA 1JIUA 5IAJA 2O8DA 2W8BC 3BL5A 2ZYHA 4YNBA 2XDQA 5H59A 4NCAA 1M2HA 2FN4A 1T15A 1LK7A 3TAHA 1DEAA 3UPDA 3PQ4A 3UMGA 4EHAA 1EIZA 1EE9A 4JT2A 5FNVA 3H2KA 4DM7A 1CEQA 2NU8A 1BMFD 1IOVA 1TYBE 1XZAA 4AB1A 1R0KA 2XNKA 4PXYA 1JDUA 3T7RA 4W5QA 3QNMA 1JFSA 4YLYA 2IYQA 1OXVA 3TM4A 2QZSA 1GL9B 3GJ0A 1D0IA 3JCZA 2Q1TA 1P60A 5F2VO 1HQCA 3NHJA 3C3EA 4HCJA 3P9YA 4FOLA 4XIIA 5C52B 4N7JA 4KPYA 3IOMA 1T0JB 1YXMA 3NP9A 1JYEA 2DX7A 4WOCA 1UBEA 4LWPA 1JE0A 2IYWA 3UB3A 2LKCA 1N5OX 2X1MA 1S72F 5JYDA 1Q1GA 1Z28A 1T5EA 4KV7A 5LQAA 4AJ1A 2OTMA 2BHNA 1AQLA 4ZQFA 2NIPA 1N1GA 2O23A 2PT7A 1YFZA 5FOUA 1M2NA 1K3EA 4JSRA 2B9VA 4OXNA 1WDTA 3P26A 4QRHA 2XB2A 3E84A 4BIOA 3APOA 4B6SA 2CXSA 2PDAA 5YASA 3NHLA 1CP2A 2IY9A 1TYZA 1Y8ZA 5CR9A 1JZTA 1ORHA 3DTNA 3R5SA 4JB8A 2F3SA 1ABFA 2VSNA 1FUUA 2HO5A 3IA2A 4ZA2A 3SICE 2P69A 1WW8A 1TFRA 1XTSA 2IYFA 4QTYA 5K99A 4F11A 1ZCFA 1CDEA 4X1OA 2ONCA 1FP4A 1FDOA 3ZLVA 1Q3TA 4S3MA 4FFSA 2YV5A 3F6RA 5FQNA 2PKEA 1FVOA 1ISRA 4KYIB 3GEGA 2LJ2A 4PGGA 5EMHA 4KB5A 2C3PA 3WR5A 5IM5A 5ALEA 4I2VA 4A73A 3F6MA 4RK1A 4KGVA 1I3LA 1FU4A 1DF4A 2LDBA 2GCNA 4LR3A 2AFIA 4DR3O 2J5RA 3CCUF 2AK2A 1WA8B 3BGSA 4TTVA 3UT5A 2OVFA 3EULA 1U0EA 1EGMB 1OGIA 5JPDA 3KKKA 2P30A 2E75B 3MSCA 2QAGC 4OOEA 5AQEA 1X0VA 2O8CB 5GGXA 2DU8A 1THTA 2K1EA 3W5UA 4PY2A 2O50A 3TLGA 3I01A 1KIMA 1G5PA 1V35A 3BE4A 1PP9H 3T5TA 3UHJA 1XQ6A 3ETJA 4KPUA 1Y6FA 4NE9A 5CB4F 5BV7A 1OPRA 3C74A 4LF5O 1QCYA 1L5LA 2AG0A 4MNTA 5F73A 2HRCA 3TX2A 1W19A 4ZT7A 1XEWX 4LJ7A 4RTSA 1X59A 5BQ3A 4ZCIA 3ZDZB 3PDIB 2HSEA 5AKJA 1NLFA 3S3TA 3MMPA 5H1YA 1A9TA 2VRWA 5IT9M 3W7AA 1VL6A 1M5IA 3A6LA 2V9PA 1SPXA 2QROA 5JBQA 3WZ2A 4J94A 1IHXA 1RW4A 3EDYA 3OEEG 1EK0A 2WF5A 3BT7A 3MS2A 3KLPX 1P5HA 4ZYVA 2OIGA 2I66A 4BKPA 4ANFA 1R5NA 4TLCA 1LQ2A 1K6EA 3ZRWA 5JJCA 2FK7A 1Q0QA 3P4XA 5EIBC 4GEKA 1EUDA 2QXYA 2JASA 2Y9PB 1U8ZA 1WNFA 4E5KA 5B7PA 3HA2A 5BSWA 3T4ZA 2WJIA 1HE4A 1C50A 1DEKA 4KXFB 5G40A 1GQRA 5FEUA 1PG2A 1KFCB 3URMA 3QPWA 5CVUA 2O2GA 2OBLA 4E5MA 3CBQA 2CKMA 2FR1A 1F4NA 4QLOA 1F2TB 5CJJA 1BE3H 1O2DA 3T0FA 4Q1VA 1DRVA 2HMUA 2FN8A 4UJ5A 3RT1A 4EA9A 1BEUB 3KL2A 2AFHB 1AKQA 1OZAA 1QZXA 1U1GA 3HJRA 4W5TA 1DBIA 2JH8A 1I10A 1WZNA 1W4AA 3CCEF 1QD9A 1NBEA 1GA1A 4EFLA 1P4RA 2VQEO 3TFQA 1CRWG 1JPJA 3TAXA 5E7IA 4CM3A 2RSLA 1CZHA 2WE7A 3RA6A 3V5NA 5C4MA 5KNLA 3OIYA 4HFNA 1TUBB 4G0QA 3T3OA 1IHDA 3NAQA 4KQGA 3J81N 4FFDA 5KAFZ 1TOAA 5BN4A 3O8QA 2J7PD 4KTTE 5GZ3A 4AILC 3UHAA 4TV9A 3U3XA 4L8FA 5AKLA 2D5LA 4QX6A 3MW8A 1P7WA 5I48A 4R9RA 1BDHA 3UATA 1Y1SA 4NS1A 4Y0VA 1P80A 2W2KA 3ZWYA 4XVQA 2RG1A 2WJ6A 3CLTC 4FK8A 5KNBD 4JLMA 3ANYB 3BPSA 2CVQA 5KEIA 2P4KA 1OXTA 4O2AB 3DLHA 3Q3GE 4ZAFA 1S02A 2RGUA 4JAAA 5EZYA 3FOFC 2JI9A 1EDEA 3PA8A 3KETA 3WHLA 3LSSA 2YMMA 4OJTA 4GP9A 3ZDEA 4CHGA 2Q8VA 1W85A 1PS0A 5CMLA 4U3JB 3UANA 5C5CA 4DCTA 4MHTA 4ZO9A 2WABA 4I81A 3PNYA 1FFHA 3CLKA 4CTOA 5KC9A 1RXEA 1AQJA 2WG2A 1YB4A 3AK1A 3NEPX 2WTBA 1S4MA 1KI8A 5BVGB 2O1SA 4FWTA 2CBXA 2J3JA 1R9GA 2FL4A 1XMVA 4DQXA 5KJFA 3CZAA 2QIOA 1SY7A 3G6BA 3DMGA 1OCOB 5ER6A 4W1RA 4UBKA 2UUCO 1GILA 4L7QA 4ZZ0A 3DNPA 4JI0B 3REQB 4CIDA 2VRCA 3RRNA 3PIRA 4J80A 3GAZA 3X0DA 2A8YA 4WUVA 1CIJA 2OUIA 1QGUB 2GA9A 4BTEA 2PVSA 5EXDA 1W57A 1JSRA 3VTIC 3F3YA 5FB3A 2WYOA 1G6UA 2IIBA 1MG1A 4R2MA 4E5DA 3LCVB 3VKFA 3F96A 1AR1B 2DPYA 1P39A 1L7NA 2GN0A 3H3XA 1M1XB 1VA5A 3ADBA 3PUZA 1U2SA 1E9SA 3E7XA 4WW0A 4WMLA 4ZCSA 2XNHA 4KLZA 4F8JA 3MWKA 3CCQF 5LGNA 4RVGA 1ZH8A 2VP2A 3G85A 1UMCA 3N8KA 4CKZA 1B93A 3F6EX 4LFAB 5AW3A 5E79Z 5AM0A 1PHRA 1GHTA 2Q7DA 4KFCA 1QE5A 3OJLA 4KRYA 3MELA 3GJRA 1NVAA 4LW8A 1EB8A 1H66A 3P9CA 2PS9A 1IBMB 1IK4A 2O7QA 4DUPA 2IDMA 5JOQA 5CMUA 5BSFA 4NWIA 2XMSA 5DM4A 4TRMA 2B1IA 4M38A 1JOYA 1YXBA 4H33A 1OBHA 3A10A 1DIHA 2EKLA 1N0VC 1OWMA 3OZIA 1YA4A 3N7TA 4E2FA 2R72A 4PG8A 5A0FA 4Y2JA 3H9GA 5JSQA 3I5XA 4ZDWA 3AY0A 3HGTA 4QLBA 3FFXA 2EIKC 1YRWA 3ABSB 4JLUA 4C0SA 1UBMS 1LPNA 1N75A 3IPXA 1QUFA 4D43A 5E1AC 2RGNA 3SJZA 2Y77A 4DCCA 1QQTA 3KQPA 5DB4A 1DARA 2I3BA 1G8JA 1YGYA 4P4TA 1OKKA 3H7AA 1W48A 4KR2A 4ZBMA 3VR1A 1YZTA 3OMIB 4GSLA 4NMLA 1HYHA 1K66A 5EQFA 2QTWB 4ARUA 3BMOB 4QOGA 1LD3A 4BNGA 1SUFA 1KEKA 3ENVA 4TKMA 3IJRA 2H65A 2PT9A 3U3OA 1FDVA 1FYJA 2H9IA 1NRJB 1VJCA 4C6TA 4C7KA 1A69A 3A6ZA 3K0CC 2OWOA 4FEAA 1BGWA 4HWRA 2ERCA 1Q8IA 4W4TA 3K70D 4P9NA 1KRWA 3DZFA 4PD4F 3H9CA 3PQEA 1NWHA 1M72A 2CN1A 1PNRA 5ALPA 2GTPA 5EUBA 1Z15A 1LLCA 4V2IA 2ES4A 1A9ZA 2OBNA 1MJHA 4AX8A 1CJCA 4WAUA 4HBNA 3G2PA 1OU4A 4KR6A 4GBMA 4M7PA 2R65A 2QTFA 2UXDO 1MZEA 4MROA 1IU9A 7GPBA 5FEMA 1UAGA 1G2QA 3ZJ4A 5K2MA 4L5IA 1QOZA 4WKOA 3SVZA 1KMHB 2PMBA 1C7JA 4YALA 2BSAA 1DPGA 1HPLA 3HI6A 5G4KA 4B5LA 3CMEF 2CJFA 2OESA 4NEQA 2UUAO 3OTOB 2Q2VA 2HR1A 4Q4AB 1LSUA 1A2QA 1L0LH 4UBNA 4LJSA 2QQ0A 5KCZA 5DW3A 3SEQA 1E6MA 3H86A 4WNAB 2QPTA 2LW1A 3KVOA 4BU0A 3ASUA 1PE0A 3ZHXA 4UMDA 2IJGX 3WB2A 2J9GA 1ORIA 1ZJ5A 3JAMA 3GG2A 1F1JA 4YB8A 3HZRA 4L08A 4MA4A 1N9KA 4BO9A 3N5KA 1G63A 5AW6A 2GHRA 1JJBA 1K0FA 2I2XB 2X0FA 4A0HA 2QI9F 1NUUA 1AKTA 4NEHB 5D3MB 1E60A 5LIRA 5EWLA 3ZLJA 1K97A 5A71A 1AP5A 5EP3A 1ENZA 5BN5B 3DCNA 5CFQA 1Z5ZA 1UQTA 1J0DA 2DPLA 5AH0A 3UQ8A 1JKIA 3O7MA 2GYYA 1V96A 2P9BA 4X84A 2OFWA 2P4UA 1NOJA 5DTRA 2E48A 2Z3YA 5A2QN 1A04A 2ODNA 3CG4A 3DGFC 3SJBA 1A2KC 1FMTA 3DQZA 3GQVA 3FNRA 4RGYA 4CC6A 2BFEA 4KQHA 4WLOA 2YQ5A 3RA5A 1EMDA 1U1DA 3AL0C 3WMXA 4LMBA 3W7XA 1KNJA 1GEEA 1VG9B 2EGGA 4F2GA 1NHGA 1KI1A 4CQMA 2X77A 2PHNA 1URPA 3FPHA 3EIHA 1QHFA 1OXMA 2FP3A 1UXIA 3MJHA 4PA4A 3EGVA 5JCOA 4CQLA 3PJGA 5HZKA 2SICE 3WGZA 1Q3EA 3ELDA 1QKIA 4NZPA 3ZWQA 3VZRA 1BX0A 5TISZ 2VGNA 4O59O 4DQKA 2ZBRA 4QHTA 2MSEB 4DC9A 4H0LB 3ZZ1A 2QLBA 5C8XA 1H0RA 1WZUA 1TKRA 3HUUA 5EXTA 3KOYA 4HLCA 1KJ8A 1VKHA 2AR9A 4ZVTA 3RE1A 4COKA 4PI0A 1VARA 1FFSA 4DNPA 4DV6B 1LV8A 1W2HA 1MB3A 1BSVA 1XAIA 1O89A 1GG9A 1HE2A 4NTXA 5CEFA 1VCHA 4J29A 4LGCA 3VH4A 4UB8Z 5CLJA 1MKYA 5KMGA 2WYWA 4FBLA 4OLFA 3SDBA 1LLDA 2HA2A 2YMPA 4RSRA 4B3BA 1WQ3A 1JLLA 2BSKA 4GZRB 4A8JC 2W2LA 4TMYA 3ZLUA 4GI5A 1ZW1A 3JASB 6YASA 2MR6A 2PJZA 3ZXIA 2YRXA 5JECA 2YV1A 1P84F 1ABEA 1YF2A 4OQLA 3WO0A 4JPRA 2CDCA 4YRCA 4KPGA 4TLMB 3BF7A 1CUUA 1WCYA 1LA2A 1RKUA 2ZS7A 1O77A 4JYZA 1GZ6A 5IYDO 5A5VA 2R68A 4UPVA 3CX6A 4PZLA 2Q4PA 3EVTA 2EJCA 3IUMA 5E4TA 1C3LA 4MEAA 4LZPA 3DEYX 2RHDA 4RTNA 3X2FA 1Q6YA 4YDQA 1DG1G 1TA0A 2OGTA 2DYYA 5FWAA 3WB0A 3HVRA 1VL1A 4R40B 2VZ9A 2PRSA 1J39A 3FFQA 2EZPA 3NATA 4LRWA 2A0UA 3DAHA 5JYCA 4FXOA 1C4XA 2B8EA 1SVOA 4FFVA 4EUSA 2K1SA 5CH5A 1OX4B 4NCNA 3KOMA 1ISGA 4S1WA 2AWOA 3MSXA 4I3GA 1YJCA 4UAVA 4Q19A 1QPBA 1L4EA 4P4SA 3OLYA 1IJFA 1HDJA 1Q15A 2UAGA 5IY5C 5L4LA 1G17A 3BCHA 4RM2A 3RRYA 1MNAA 2PMWB 1UBJS 1DO8A 1NH2D 4TWJA 3I6MA 2BCGY 2WHPB 1N0IA 2G9IA 5AM4A 2QW0X 3RU7A 1PG0A 2V3CC 3FUTA 2WHXA 3EH1A 4OU5A 2O8EB 4DJDC 5J4YA 4ZVPA 4B4DA 4NLLA 4DTCA 2WUEA 2CNLA 3QVVA 1GPBA 2HD4A 2HCRA 1RAHA 1J8DA 1X25A 3RVOA 3W7BA 4O0MA 4OI4A 3X43A 5CNKA 4XYLA 3V7FA 3ABKC 1M6VB 4F4FA 1W6RA 4BEBA 1YB1A 2PL9A 4I4TF 2CTQA 1KO7A 1ZN7A 2PL3A 3OQHA 4W9NA 1JGTA 4XGKA 1MOFA 4FDAA 1E8MA 1N0WA 3K5OA 4IHQA 4G0ZA 2JARA 4AJNA 3U44A 4RDCA 3JV7A 4OFXA 2I55A 4AS1A 1SKYE 4NKGB 3P10A 4PX3A 4OBWA 3G5UA 3QVMA 5B5SA 5E7MA 1E0JA 5GANK 1T9CA 1QF6A 1WB8A 5LMCA 4S1PA 4A5SA 5ISMA 3E5RA 4DQVA 3MJTA 1VQOV 4TN5A 1Q1QA 4DBVO 2Y1EA 5JRJA 1XJ0A 5KUTA 1AP6A 3VXKA 4EMUA 8ABPA 2OFPA 1E6EA 5IHXA 1PX0A 5H4GA 3SYNA 2ZKIA 2JJ1G 1VLHA 2JRCA 1Q0ZA 2J59A 3C16C 1WOMA 2A0KA 1GSHA 1VMKA 4JJ7A 5ERGB 3M5CA 2BELA 1N6OA 4ZZIA 1FW6A 3BHNA 1DBWA 5FWDA 4CKYA 3HWRA 3C6XA 4UREA 4L4UA 4KTVE 2ONZA 2GBFA 3UUEA 4XTRA 2CZWA 3ZMUA 5JWPA 1Z37A 1Q6UA 2I3GA 4TSFD 5K0TA 1MIOA 3IDSA 3D7SA 4G3XA 2HW8A 3ZP7A 5FXMA 3F4LA 3TTSA 2FI1A 4UUQA 1E2IA 4BNTA 3MBKA 4I4CA 4IJ5A 1Z12A 2OXTA 2XKAA 1Y6ZA 1O0CA 3AF6A 1SHUX 4EGFA 4DAOA 3ZI4A 2IH5A 3JAMN 2J9XB 1O03A 1GDTA 1J09A 2BGGA 5AUOB 2IPMA 3C4JA 3I12A 3FPCA 1RJGA 1YR3A 5B3AA 2DHRA 4LWSA 1XCPA 1PGPA 4OBEA 1PJRA 2HXSA 1KWGA 5EP2A 3UC9A 4A6XA 5C8YB 4DS3A 4LGMA 1DQYA 1VYUA 3QKTA 3LPAA 4QGPA 4FDLA 4PHFA 2G63A 2P65A 4ARZB 2F3UA 2FE1A 3AILA 3VHXB 1OWPA 4JOQA 4IRUB 2XAUA 3D6MA 2AR0A 5IJ9B 2VTVA 3NC4A 3TZEA 1PZHA 3ODPA 3UUFA 1GTSA 2GH1A 4HGOA 3G9ZA 5DBEX 1DKNA 3GWOA 4NS4A 3L4KA 2XD4A 3RLIA 3WVNA 3B6KA 1FIUA 3PFCA 2GPJA 2ZSFA 4BMDA 4XFKA 2PMPA 2OXCA 3FWHA 1AHHA 2O2HA 3N8DA 4ER7A 4LMRA 5LHGA 2C31A 4JT9A 3LDDA 1YZVA 4Y9TA 4FEGA 2QMEA 1OR8A 3EFOA 1N7GA 5H68A 3IMKA 4HKTA 4EYQA 2C95A 2PUVA 3F5WC 3PV0A 5KOHA 3EIWA 1Q6HA 3UBMA 4IDQA 3K72B 4ESEA 4P33A 2WV7A 2X40A 1FNCA 3QV1A 4MVWA 2BEWB 4GEGA 1COWD 1E3WB 4O8CA 3L0SA 3U31A 4YR7A 1HA3A 3R6LA 2OLEA 4L6IA 5AHKA 3LXXA 4NZMA 3DO5A 2BUCA 3O4FA 2A4KA 1PR3A 3LCUA 4P98A 3K2XA 2JJ2A 3VISA 5AJTA 2YN0A 2BHTA 1SVSA 3UWSA 1NR7A 3E1KA 1GVHA 2BTUA 4F0JA 2HGZA 4W99A 2W43A 4YACA 3VR6D 1E1YA 3GCZA 2R00C 5J2UA 2QXUA 3LDFA 2VJPA 4GOXA 2YWHA 2XTMA 2YS7A 1RMYA 1BRTA 2O2YA 2ZSIA 4HWKA 2WA4A 2OPBA 4AKEA 5BSVA 2I4LA 2XGSA 1OILA 3S99A 2F43B 1A71A 1W42A 4BLVA 4NCJA 3DC5A 1UOPA 4ARSA 4NV1A 2TYSB 2CGEA 4KIWA 2R97A 1PR5A 1XTJA 5I6DA 4HJXA 2E4YA 3T1TA 5C51B 1ZQ9A 1YQUA 1XMOB 3HYNA 3C24A 3PQ3A 4FGLA 3WRVA 4YY3O 3RAJA 1GRJA 3PVCA 2J9FB 3RSZA 1RC0A 4PCAA 4IEFB 1WY5A 1K33A 1KORA 3SR4A 1U2QA 1X6VA 2VAPA 2PI4A 1K3TA 3W9YA 2AGVA 4N3CA 1FSFA 4RTMA 3FB6C 1E79G 3K70C 4X97A 4ZVLA 3AIKA 1EEHA 1YRBA 2CXNA 1U90A 4TXMA 3SYTA 4FGSA 2IZ5A 2LFSA 2FPMA 2D2FA 3E15A 5IP5A 2GZMA 1QBGA 4F1JA 3DTVB 3SIXA 4D6XA 2ACWA 1KSHA 4BMXA 2OSBA 4YAJA 3ZHOA 2ZT5A 1MD9A 1OLSB 1N2JA 3AL2A 4GQIA 5DGDA 5CH3A 1UR5A 121PA 2E4XA 2C4TA 2KBEA 5ALDA 1P75A 4DQUA 5E9JA 3USES 1LS6A 2G0AA 6GPBA 4O2BB 3D7KA 2AN3A 2NQTA 3O47A 3D7MA 3OEYA 3V2UA 2OZEA 4QULA 4Q9JA 5JJKA 3B1XA 1GMGA 2HV9A 1KWKA 4PFKA 2JIZD 3DZIA 5JD4A 1YR9A 2QU8A 1KVQA 1BGYH 2GEDA 3IAXA 2Q8PA 3K0SA 1QG0A 3DEFA 3QTLA 4RHAA 1E58A 3IUNA 4QJFB 2FR8C 5K0LA 1GYRA 2FYTA 2V0CA 2DT4A 3FBAA 5E6SB 4EA7A 3PB3A 1XHXA 2QD1A 3EXHB 4RF5A 3ZN0A 3NV7A 4TT3G 5BY1A 1N1MA 1OGYA 1M2FA 5FBWB 1I14A 1W49A 4MW5A 1XEQA 5D3KA 4G0MA 1I1OA 2I33A 2EKPA 2WJYA 4OHOA 4D3XA 4X71A 1AS0A 3Q5GA 2ZIFA 4BP9A 3C5VA 3D3EA 4JLPA 4INZA 3BQNB 1UKZA 4WPGA 4LOKA 1PVOA 4I19A 1DV1A 1T3HA 4BU1A 4MVJD 1VQ4F 4ODIA 2OORA 2F1MA 4QUDA 1BXGA 3H0KA 4YRIA 1USIA 2NMVA 2KLBA 3K09C 3FNFA 4EO9A 1QYWA 1K4CC 1ZUD1 5HWSA 4XOIA 4DPLA 1GKIA 2PO5A 1H2FA 5JD5A 3A1EA 4RQBA 3WBBA 3OR7C 1XQ8A 2H6EA 1KETA 5D3ZA 4UMFA 2BJVA 5HGJA 1KAMA 5CA1B 5H9WA 3JRNA 4J11A 1X9HA 1I1HA 3Q72A 4QPZA 5FADA 1E3QA 4PA7A 4QQFA 1HG0A 1E1RD 4UEOA 3K1AA 1XCLA 2LPMA 1Z17A 2OAQ1 4MRMA 2B34A 1C41A 1XLVA 1D2GA 2Z1MA 1P31A 4HGNA 1ILEA 4C0QC 4ENWA 2XXAA 1RYDA 5EE1A 1ZVQA 1KHTA 4WZBB 2Q07A 2OV6A 5T3UA 2Z2ZA 1RKXA 1TK2A 3K8ZA 4Q9IA 1EUCA 3ONNA 3DVSX 1MDFA 4ZMBA 1TK9A 4QYIB 4JI4O 1V2GA 3OIWA 4WN9B 4B09A 3DR3A 5B3JC 1QNFA 1M9NA 1U8UA 4OQZA 4L5JA 4FNMA 1BJRE 1H2NA 3D2BA 3PXCX 3DNMA 3NHAA 2CHQA 4MVOA 2NU6B 4OLJA 3RS5A 3NBFA 3PF9A 1TL7C 1CY6A 4FMCB 5AKYA 3U40A 2ZJ6A 4ZYXA 4MQ4A 2C0CA 3ASOB 2FNAA 3EN0A 3GRAA 3BGOS 4WCFB 2ZRFA 5B8FA 3ZW8A 4ITUA 4ZC1A 2VHJA 3OJWA 1BMFA 1N2XA 1PEYA 2WJJA 2XB9A 4PZUA 2UKDA 821PA 4E5YA 2YOHA 2OCDA 4XH9B 1P72A 1RWVA 2YC0A 4URXR 3LUCA 3OX1A 3OT1A 1BN6A 4NXNO 4FLUA 3GEDA 1MNQA 4WZAA 1U8XX 4JGIA 2HNAA 2JAXA 4F9TA 1YZBA 3F8SA 3UCEA 3CISA 2R7KA 5L3DA 1V11B 4QO8A 4AJ2A 5IPFA 3UKMA 3CF4G 1H4SA 1QV9A 3ET4A 1Z63A 4LA4A 5ILQA 4LV5B 4EDHA 5ES3A 1BX1A 5HZMA 2ZSHA 2QUBA 3PGLA 2WUWE 1GO0A 4LRSB 2IS2A 3F1KA 2A4MA 2IJHA 5AHRA 1VF6C 2PY5A 3ASNB 3MEQA 5HBRA 2ZR3A 3JVEA 1XDUA 3CLTD 3GN2A 3OY7A 1EE2A 4Z51A 3GYBA 4ZJPA 1RDFA 3LCMA 4BVJA 3UQZA 1FUYB 2HR3A 2HQSA 2EATA 2MCFA 1A4XA 1AKEA 1ZMOA 2JHCA 3IIKA 2XKBA 2XGJA 2DBZA 5LP1A 1TZ2A 4ZVUA 2LW7A 5M04A 2OR3A 4JUFA 2PZBA 3CZ5A 4HN4B 1U3TA 1EJ2A 1V5EA 2Y93A 4GKAA 3C87A 3D1LA 3IHWA 1O3YA 4IJQA 5D5QA 2UZAA 1JEYA 4MB0A 1NA5A 3U61B 3MBIA 3WICA 3SXPA 1FJ2A 2QZJA 5AJZA 1YTUA 3WGUA 1G16A 4L22A 1BWRA 4BW0B 3AJEA 1KZGB 2B8JA 4DK0A 4DVJA 4BNZA 1F8FA 1D1PA 3GWGA 4P9PA 4OD0A 5AUPB 2EW1A 5FORA 4JLAA 3UWDA 3P9KA 4XEUA 1F5SA 4RENA 2HHHB 2DP4E 2JIOA 4PZCA 3MC1A 3CUTA 5BQOA 5F23A 3Q7PA 3MS7A 1PKEA 2YQZA 3QI2A 2VDJA 1P5FA 4J7XA 1ZLYA 2UYNB 1G6KA 5A3VA 2GD0A 1R16A 1SCUB 5AIAA 3MJCA 1J6UA 3UHOA 4YJGA 5CAEA 2HSWA 3WK4A 3HWX1 1KAQA 2Z5UA 1T2VA 5I7EA 4RH1A 2D2XA 2YXNA 2X8LA 1R50A 1TMKA 1F2UB 1M8JA 3HYTA 4DVGA 3KWFA 1CIPA 1KMNA 2CFSA 4M1TA 5IULC 4EGAA 1M7GA 5DIZA 3EOZA 4KYUA 1DE0A 3ZGYA 1NNLA 5KUMA 4ZAXA 3KU4A 4E5SA 5LOVF 1Q0PA 1QVZA 3ZWXA 4K87A 3L8EA 1JKJA 2WI8A 4H4EA 1XMJA 1W30A 1AS3A 3ANXA 3BTSA 4AKGA 2Q3FA 2HSJA 3I92A 3ED5A 2F2TA 3IC9A 2EL9A 3ESXA 5BQXA 4DBZA 1TADA 1TM1E 1GAEO 2NTNA 4RXTA 3HY3A 4ZPXA 3K5LA 4M1MA 4KR9A 2WIFA 3TLAA 3KKNA 4U39A 2XJ4A 4N0DA 1LJ8A 4RFLA 3D0QA 3H18A 3GNLA 2YY6A 2XMPA 3HCFA 2XUOA 1ZA1A 3WL8A 4J42A 3LUBA 3NHFA 3RIYA 4KXXA 3MXOA 3LGAA 4CKCA 1Z8FA 2ZQZA 2FSVC 2QE6A 2GCEA 2AJTA 4C7XA 1C0KA 4W5JA 2BPOA 3CTMA 4OGLA 1XRGA 4R7CA 3PLRA 2Q6VA 4QQRA 1ZJJA 3RGGA 1I5OA 2FJUA 3L7NA 2GRAA 2M32A 1N7IA 3VX4A 3CRCA 3B3JA 3GDOA 2HU2A 1TGVA 1O6FA 3V97A 2QRLA 1VJ0A 3JQGA 3E8HA 4YV1A 2JVJA 5JZSA 3KELA 4KG7A 3CXCU 1IBSA 3OM0A 2ZBGA 1IPHA 4LZOA 5FBQB 2RHWA 3RUEA 1MV5A 3OJXA 3W8EA 5IC4A 5UKDA 3KQVA 1AUQA 1QQCA 1PL8A 4LQCA 1I5RA 4HQOA 3BXPA 3PKJA 4UJ3A 1CUZA 1BE8A 1D7OA 4MAFA 3EWNA 4IV0A 5EHXA 2QTVB 4ZICA 4OI0A 1KYTA 3BJMA 4FEEA 1KMIZ 3FNHA 4TOIA 2BFOA 2J7PA 5CU7A 2EFDB 4JT8A 2VCYA 3L49A 3V9PA 1PF7E 5DNYB 2PH3A 2DHQA 2XHBA 5TEWA 5A5DA 4RM3A 5KQMA 3RRJA 5ERXA 5DM0A 4QNNA 4HLNA 2Q50A 5INTA 1NVVQ 4AY6A 1H2EA 2QY6A 2PX5A 1F8GA 5JH7B 1JLRA 5F1YA 3FPGA 2HFJA 4Z3OA 4CG3A 4BNHA 5KNBA 1C9EA 3P5BA 2E6KA 1SOMA 3B6IA 1IBLO 1QS0B 4X66O 3H99A 2GV9A 1DAOA 4PQEA 2VSOA 1GNQA 2DULA 2XA2A 2WVHA 2QG6A 3V6MA 2P9GA 3JR3A 1MC4A 1XXHA 2IXTA 1O94C 1QIEA 3F7MA 4K28A 3VU9B 1R64A 4N5LA 3KB8A 4IIUA 4JF3A 5CT4A 5FWNA 2JGIA 4ILEA 3NHZA 3LP8A 2ECPA 4H9GA 3H13A 1EG2A 2VZ8A 4PRYA 3B2EA 3BDVA 2XDAA 1QFSA 1T4CA 4H08A 3CUEF 4CMAA 1VMEA 5CM9C 4GE0A 2JIRA 1YZKA 4HRAA 3CH4B 1YBFA 5H70A 4TQ9A 3NPAA 3T5CA 3QMVA 1PDOA 3RLFA 2YWGA 5K0JA 1SNYA 1UKEA 4BEJA 1YL5A 3VPDA 3PNSA 3PGKA 4ARVA 4WGGA 3H5NA 2DQZA 3GLIE 1DGQA 3AP2A 1IQRA 2NM0A 2VHYA 4I5EA 1OJ7A 3C8UA 2FW0A 1R8XA 2CVHA 1IG3A 1YZLA 2AK3A 2FPPB 3T3GA 5JR3A 4UNPA 2HTEA 3SF8B 3GZJA 2JATA 5CDHA 2B1GA 1E7SA 3OETA 1NT2B 4HK4A 1PL4A 3LYAA 3KUUA 2J6BA 4OHWA 4AP6A 4NTZA 2YSUB 1F0KA 1MO4A 1W2BF 3S40A 1K5HA 5C34B 3IT0A 1ONSA 2GD1O 1QGYA 2OGWA 4QHSA 4IXTA 4KUGA 1H2MA 4RO0A 1UK6A 4RPIA 2DQKA 2ZB8A 5FA6A 4PZ0A 1N2EA 3NYIA 2HM7A 1PTJC 4NE7A 5BRNA 3GFRA 1WTAA 4NDZA 3HCCA 2VBCA 1W4CA 1VE9A 3AM3A 5DSTA 2PYJA 2CNOA 1VE7A 5G4VC 1R6UA 1G7TA 4H35A 3F7NA 4F4CA 2EIJC 2FF7A 3RS0A 2YZ2A 4YRLA 1K3UB 3AY3A 3M9XA 3B51X 1KQPA 3WAGA 3WQRA 1ADYA 2P5TB 4RF3A 3A6HA 1OXXK 2QIPA 4OJKA 2H16A 2VKTA 4WRRA 1QHYA 2Y0BA 2QS9A 2POQX 4W8GA 3OZDA 4WXHA 4DGSA 4E30A 3C6QA 1AUOA 4ZHWA 1L9KA 2HVJC 3PEWA 1G20B 1SOVA 5JNSA 1ZGZA 2P2ZA 1P9RA 4MW7A 1A97A 2Z98A 2GPAA 4N21A 3CD6V 1S3JA 2PWAA 4KGZA 3FN4A 5EMLA 4FGWA 3ZHQA 1EPUA 5KWJA 2VXBA 2H8EA 1UJWB 3QNUA 4AURA 1EYZA 5H5JA 2CZQA 3BJRA 5HG0A 2EIMB 3HWSA 2A3QA 1A1VA 5CYFA 2WJPA 3LQQA 3GPCA 4LJKA 4MPJA 2B33A 2IJIA 3GH1A 2H5JA 5LZ2A 2RBEA 3P5SA 2F4VB 1G7SA 4PNPA 1VB3A 1IDSA 1N6NA 4U7WA 1JB9A 2R6JA 2QRUA 1JAZA 2E49A 2JD0A 5B1DA 2LBTA 3JYQA 3SN6A 1MN6A 4YJHA 1ZSPA 3EDMA 1IN4A 1WCXA 2F64A 1C0EA 5FBHA 3RVBA 2MDTA 4KAAA 1R37A 1Q21A 1XNHA 5AK0A 3OZGA 1Z33A 3ROEA 3JD2A 1GKKA 4DR7O 3PNVA 4YTEA 4BAGA 3A04A 1W1UA 2D4HA 3T41A 4BV2A 2YV4A 2Y1XA 4MV7A 1Y80A 1Z22A 3EJ6A 2AB0A 3Q1KA 4JI1O 4QDOA 3VQTA 2VYND 3C6YA 4JI6O 2DKFA 3PI6A 1HMPA 4TVBA 4PA9A 4W7SA 2Q4TA 5CB8A 4MVQA 3AZOA 4ZARA 3ACBA 2PA0A 3U17A 1PHPA 4P2ZA 2I4OA 4Z6KA 2ZYGA 4ITVA 4EJ2A 4E09A 4GT1A 2XZOA 3EIEA 3JY6A 3COSA 6PFKA 1Z16A 2ZTLA 2I1WA 4DQ0A 1TQHA 4FJ1A 4JODA 3V4ZA 5TB5A 1K9SA 3VC7A 4RVUA 1SD2A 2WSLA 5AXBA 1VFNA 1SQPH 3Q8WA 3NWBA 4IIGA 2W2NA 5A9RA 2ZPAA 3MGBA 4HQ6A 2XGGA 1BMTA 3AO0B 5CCBA 3DTUB 1JLHA 5B37A 2WU3A 4RPGA 1CNMA 4UBIA 2WBLC 4ER0A 1XU7A 4R54A 2NO0A 1XC7A 1BVHA 1ZI9A 2WVJA 1WV0A 3D4OA 3IQXA 4NKRA 1EBBA 5FJIA 1KSJA 1IXMA 3U3KA 2O8BB 4IYJA 1V55C 1FBTA 1AU9A 5AVZA 1AQ6A 3O4HA 4QUAA 4JL8A 3VC3A 1QR6A 4J0EA 1XUQA 1KNKA 1VHTA 1AI6A 3N2LA 1RIIA 3K09A 4LSMA 4UHJA 4PC7A 2FK8A 2XE7A 2QMQA 4HRYA 4M8IA 2BF7A 3FNIA 1II8A 4D57A 5FHRA 1OLXB 4X65B 2SCUA 1VPLA 4GICA 4XIGS 4QBKA 1PD3A 3Q2IA 1BHJA 5E3IA 2WE8A 4CR6A 2X0EA 4K6GA 4HADA 1IBKO 2X6AA 1K4DC 4MHOA 3IBCA 2PUFA 2WTXA 1WB4A 4E33A 5BYBA 2DE0X 5HTOA 5L45A 5F5XA 1YTFD 4NPCA 1NV8A 1LVUA 1ZJZA 4EPTA 1RPZA 2CLKB 1VF7A 4GECA 2R7LA 3CSDA 1NQUA 3L02A 4X3PA 1YVRA 1MJGA 2ODAA 4LHWA 3LH5A 1E3SA 4AF7A 2E55A 4ASUA 3IIEA 5A4DA 4LX8A 1UZUA 2IOHA 3RS7A 4NI5A 4ZIBA 1BOFA 3CV3A 3RUIA 4PPGA 1K5DA 5EJFA 5JZBA 5KS2A 3DMDA 3JQBC 4Z9YA 4C81A 1R3LC 4F8YA 2NZVG 1DXHA 3LIPA 1JMVA 2BFAA 2J5QA 3GGCA 2PZLA 4J10A 4D56A 1ENYA 3NT2A 4I55A 1W4BA 2VFAA 2FF5A 1L7PA 3PIDA 1C9MA 1DX9A 7REQB 3QLUC 3C4VA 1W9HA 4I0WB 1U04A 4S1VA 4KE6A 2N04A 3H2YA 2ZJBA 4Z7QB 2AGAA 3HNOA 3FB4A 4KMSA 3TD5A 2RB4A 4GFDA 2ZR7A 1FLVA 3MT7A 2JVKA 5E9WA 3KPVA 4JXZA 3Q7EA 1CBUA 3OIVA 5LYJF 3FROA 2XUMA 1LSSA 1T9AA 1U2ZA 1IDOA 3L6OO 3PDJA 3UHFA 4D02A 1J07A 3E3AA 1B0AA 2HB6A 2LXNA 4N47A 3OICA 4KQJA 5LBUA 4NK4A 5JADA 4JEHA 3N8HA 3QMMA 4TL9A 4HR7A 1GN9A 1RR6A 3WXMA 3JYHA 5K6TA 1Y3CE 4OUDB 3NJRA 3ON1A 4PPNA 2CXOA 1QC5B 4FXPA 1NBHA 1MU0A 1A7JA 3DZHA 3LZDA 1X1BA 2ZULA 5EN4A 3OZBA 3OCWA 3CC7V 1V8DA 4LF9B 2ZWAA 3OLXA 5HMLA 4J41A 4XYMA 5AW7A 3KXPA 1IUNA 2ZYWX 1MX3A 2Q68A 2QP4A 4EJSA 1HBJA 4C4AA 2DUNA 4LHXA 3NNSA 4EP1A 1PZMA 4HS4A 5KJ6A 4GYCB 2G25A 5HY1A 3FOEC 3BRWD 3PPVA 2A84A 4BEVA 5JMTA 4LDPA 1NPTO 3PL5A 1UIMA 3Q2OA 1D5AA 4KNYA 1V1JA 2PL5A 4LQLA 1GKLA 3RQIA 4C4XA 4PGMA 4F92B 1N36O 2A5YB 2GZRA 1H2YA 2HA4A 1DIRA 2Z3ZA 4QGFA 1P7GA 4QDKA 2IXGA 1K92A 5FJ4C 4V0MA 1TJPB 5LMNO 5CCXA 3LX8A 5B58C 1P61B 4PDLA 2ZB4A 4AD8A 4I1RA 4RAIA 5DN6D 3KK0A 4YMHA 4IJKA 4FS8A 4R1NA 4BNVA 4ND2A 5C1IA 1PLLA 5LM3A 3KVYA 2H5IA 5TQ2A 1TMGE 2CNWD 3HTXA 4PCLA 5IVKA 3I0MA 4V0KA 5K4HA 5C37A 2R8PA 2AE2A 4QEZA 4BLUA 2DVMA 1QVRA 1J0XO 3DDWA 2A9QA 5CVVA 4R1SA 2IHUA 4A8TA 3N2GA 2CY0A 1XLWA 4UM9B 3NC0C 4MVUA 1E7MA 1MSDA 4E6PA 2W2XA 3P19A 4U2GA 4AJOA 3EB9A 4XGQA 4JC4A 3KR2A 1GDHA 5IFLA 3IBSA 3TJRA 3IUPA 1T6YA 4IMPA 3FYCA 5ALHA 4CTNA 1B6QA 3OOHA 4FOSA 2UZ3A 4ZHYB 1D9XA 3HXOA 2ETNA 1QK4A 1ETHA 3LQRA 3ONWA 4EW3A 3ZU5A 3QRWA 3K0GA 3Q88A 1KIFA 4LP8A 4TSFA 4JWTA 1EN6A 2W6ID 4BZQA 2P9TA 3RVJA 1I4LD 2ZANA 2ZITA 3L8FA 2EX1A 3HJFA 3IX7A 3O82A 3TB4A 4KYTA 4OYRA 1YITF 4B4UA 2DR3A 4YONB 1R3KC 3RYIA 1T5SA 4BVAA 4AMYA 3T1CA 2XCSB 3DEAA 1EGQA 3F46A 4YROA 2C20A 1NJ2A 3DBOB 3ZD8A 4AWBA 1HL7A 2BDEA 3MTAA 3OPXA 3HPLC 3DDZX 1Y74A 2UUBB 5B7QA 3B60A 4K1XA 3N3AC 1P74A 4LZWA 1MABA 3UJ6A 3GLGE 3T12A 3BHJA 3X44A 5B3SC 4UD2A 3M84A 3Q87B 4MW1A 5TJ9A 1VXRA 5DU2A 3VOBA 2RKOA 3PXGA 4Y1EA 3NAMA 1NVWQ 2OB1A 4YRKA 5LL6P 4AM8A 4OHMA 5F4BA 3ZGXA 5JMWA 2WV9A 1T5HX 4XX0B 4LBVA 3U4QA 2TMGA 4BMZA 1I1QB 1KYVA 4UCWA 1HTBA 4JASB 5L4SA 3SS9X 1H2SB 1MB2A 1U81A 3F5MA 3IEWA 4I1IA 4A92A 1M6NA 3V33A 3U4DA 4JJAA 1CWUA 3SYRA 4YT5A 2X1LA 4M1OA 3QQ5A 1O6CA 1UZMA 1X3SA 5GV7A 3PC8A 4JA0A 4QNMA 5JNWA 5REQA 5G1OA 4ID9A 1Y4UA 3FUXA 2WAYA 3O1IC 3AG1B 5AW9A 4MUFA 1JBEA 1RMQA 2APJA 2ZM6B 2P7TC 1PSWA 3DAPA 2IV2X 4UHEA 1L6IA 1ULBA 1NBAA 2VT2A 4LXIA 1M75A 3T7EA 4PV1B 4MA0A 2ORWA 4BGVA 1GXSA 1JHMA 3SNHA 3GUHA 1CYEA 3H6HA 3NU1A 4HH3C 5TQ0A 2QE7D 1VQ6V 3TVDA 2DYKA 4PO1A 4YIKA 1VYTA 1NTZH 2OCCB 1JG2A 1Y6XA 1WDMA 5IABA 1DOHA 1EN4A 4DV1O 4HAXA 4I50B 2GN6A 1EFKA 1M1NA 4ZOLA 1YCGA 1PKXA 4MUGA 3VR6A 3LWBA 3TFWA 3C3BA 1D1QA 4RKRA 2F1RA 1J97A 1AGYA 1MO5A 1FQJA 4DV4B 2ZZNA 3SVTA 4WTOA 4HHEA 3T3EA 5EWJB 5GVRA 3U1TA 1QVGU 1E4VA 3UK2A 2A1UB 2W8BA 1MAHA 1F48A 3BXXA 4EAAA 2RHRA 1Z2EA 2JFGA 5K7SA 2F9LA 5JFTA 5BWOA 3BRQA 1P49A 1SCNE 2UUPA 2VBIA 5B1AB 1GPUA 3DEJA 4FYIA 4KX3A 1L4HA 3ZNQA 3MGKA 4HTAA 3S27A 4WJZA 1LLFA 5IDJA 2RC6A 3CKKA 3KVNA 2P5YA 4H7PA 3RADC 2GM4A 3OT4A 4WJKB 4MTXA 3IQEA 4R2IA 1G42A 5LWQA 2I7XA 2I54A 1KOLA 5U4QA 5GTHZ 4MRSA 1EKXA 1S2MA 1YH3A 3ZHTA 2VHTA 2OYCA 1OYWA 3AP3A 2FZGA 2WIDA 1SKMA 1HDIA 1NUAA 2PXAA 1KI6A 1VRVA 4RC9A 4WL0A 1D2NA 3L75H 5DEIA 1L5WA 4C7VA 2Q5JA 4E11A 4W1QA 2WLIB 2I65A 5HFJA 3LT2A 3CJHB 1OH8A 3MWEB 3LRPA 2HU5A 1B0UA 5E8RA 1G1MA 1U2RA 4ERXA 2PMFA 4G4VA 3BWBA 2C4VA 4MW8A 3OZXA 2V6GA 1WV1A 5DI3B 3JAWB 3GA7A 1NPDA 1TZJA 1DI0A 2A94A 2IZ1A 3AF1A 2GF9A 1R0WA 4F2WA 4PQFA 2J3HA 2WLKA 4KRGA 1SCBA 1FFGA 5LXTA 2G82A 1HLPA 1MO3A 2DW4A 2HBRA 3O4IA 2Z1DA 3WDKA 4CV0A 4IMJB 1E1NA 2X8WA 2PZFA 2FPWA 3QOXA 5J3JA 3S2EA 3I37X 2BLNA 1Z2GA 4EY8A 5FPSA 3HKBB 4REQA 3VYSB 4D81A 1GJRA 2Q0AA 2EHDA 4N3NA 4R16A 5KX5A 3IR6A 2PV0A 4QXMA 4BQEA 2AXEA 4FFNA 3OX4A 1H4VB 5TR9A 3ZUPA 5K3FB 1GK9A 2W2VA 1N0HA 3S1AB 3PGA1 1XV2A 3QEKA 1M2OA 2IYPA 3FCYA 2REBA 5D6NA 4XM0A 4WZ6A 1PO7A 4POOA 3IQWA 1IL0A 1CJUC 4I5SA 1H9CA 3QVSA 3FOZA 1B73A 2G0NA 2GHTA 3Q5EA 4P4UA 4EQ6A 1PFQA 5EERA 3EEBA 3GN1A 4IDHA 3E9MA 4BKMA 1PV0A 2GVIA 5FLXA 4B44A 4GC9A 2CDNA 1B8OA 1SOUA 5T7BA 3Q5DA 1TTPB 2BMFA 1WPBA 1Q1AA 1NRXA 4MVJA 1V5GA 4LDNA 2OM2A 2Z2IA 2QAGA 1XEXB 4EG3A 1Y76B 5DM60 1ORWA 3G2IA 4HEHA 3OPQA 5FJJA 3CBGA 1I9GA 2VXYA 4L4ZA 5EXPA 4K3UA 4BKRA 5ALIA 3P4YA 3GMSA 1H4TA 1HDCA 4BJ3A 1DDGA 2YINC 3AETB 4GIBA 1AR5A 5SY9A 3EQ9A 4F4HA 3TMYA 1VSBA 1FNKA 4KKXB 4LHZA 4AO8A 4WJLA 4M0PA 3W9BA 1E2LA 4HNRA 2OPHA 1JYSA 2VEDA 2I8LA 5LQSA 3ZWPA 4MUHA 1W52X 2HRDA 3PJFA 3GMDA 2ANBA 3CONA 1NQAO 2CV2A 5T8KC 2PWPA 3AP1A 5A6SB 3T34A 1G2OA 1KXZA 1IZZA 3EOAI 3HBMA 1DUSA 3D8TA 4BCCA 2HVKC 2M98A 4LDZA 5HFLA 3SYCA 3JWIA 4ZK6A 2DB3A 4U2FA 3C3CA 3TNYA 3QFTA 4ZHQB 1QFYA 3BX1A 3EY4A 5GADl 3M9WA 2P6RA 3HWUA 1QAOA 2R25B 3CW8X 1Y8CA 4E2ZA 3GQBB 2PGDA 1GNRA 1BT8A 3W8RA 2YIVX 1HM5A 2JI7A 5ALRA 2B5WA 5IN5A 2X15A 5KVSA 2M6SA 3LC2O 1X92A 1A9OA 2P5UA 5CBFA 1JXAA 3A9CA 4ZKIA 5DWVA 1Y34E 3BHMA 4HLUC 3A06A 4ZAGA 1H8ED 4GKBA 4H7KA 4UBMA 1JG1A 5CJPA 3D0RA 2UUOA 4RNDB 4GW3A 3DOFA 2V4UA 4CODB 3GFQA 2QB5A 1LPAB 5E7QA 4X1IB 3H9EO 5IE9A 4MS1A 3NTVA 2E85A 4BX8A 3QUTA 1Q16A 2GNPA 4A10A 3AIIA 1UQRA 4UVGA 4CTKA 1PPJH 3H1TA 5IUKC 1DL5A 1MX1A 1CCWA 3W9SA 2WALA 4Z4FA 1RBYA 4TWKA 2QP3A 2GUWA 2I2CA 2ZSEA 3APQA 2O20A 4MR8A 1XNRB 3QF4A 4DV2O 4MJ3A 4UAUA 4URWR 3LDAA 5KIAA 1ZY2A 5FWXB 1PU2A 4C7MA 3KIPA 1A5AB 5EC1C 4QDXA 1KC1A 2QU7A 3E7PA 4JDUA 1KQ3A 5L4NA 5EZ5A 2YIJA 3QW2A 3UAGA 2PQ2A 4Y2VA 1NMYA 3L0BA 1QP7A 1ENPA 4CYMA 4BO2A 1P7CA 4HVCA 3SX2A 1XZNA 3MILA 3PRHA 4CU2A 1WSDA 1O94D 2CMHA 3PIIA 4KO1S 1J2EA 2INGX 4ZRMA 1ACLA 3T5PA 1J0BA 3AR3A 4GOOD 3PYMA 5ANRB 4P2GA 4XPIA 2EZTA 1YS6A 3H42B 1EFVA 3W2EA 4YAUA 1XYGA 3AUFA 1YHQV 4GD3Q 5ER9A 2PKYX 2EKZA 4DR5O 4NENB 4RXUA 1JG4A 5TE9A 2KMLA 5JU6A 4ZQIA 5J5CA 1OBVA 2CHFA 4M1SA 2OQRA 4M0EA 5T4HA 3UEOA 5DTMA 1ZICA 5B1BC 4S2EA 4E12A 5CBPB 1SXHA 4Y9UA 2PRJA 2AC4A 1D2EA 1NS1A 5BT8A 3VYUB 2R48A 4UXNA 4HQ0A 2Y4UA 3V4DA 3FTCA 4Z2YA 4GLFA 3BEHA 4ZCQA 4DJAA 3K2QA 4P93A 1IY8A 1U7DA 3SWWA 3P9IA 1N25A 4INJA 5FHQA 3DPUA 3WIUA 2F3PA 1C9DB 3QBDA 3G7UA 2ISQA 1N5JA 4F4JA 5BV8A 2QLLA 3RCBA 3K9GA 2DYSB 5A3RA 5AK6A 1JJ7A 1TIKA 3ECSA 1OHHA 2I71A 4GI7A 5CLFA 3OPNA 4JKOA 1EM6A 1ZYUA 3QY9A 1QOPB 1PFKA 5A3JA 4ISCA 1MRZA 3GF4A 2OIEA 2DQYA 4JYAB 4WACA 1U8AA 2VZEA 5F2NA 1NVEA 4P8RA 1B15A 4KVFA 5CD9A 5J4LA 3LHIA 3WV4A 4D4GA 3UJDA 1AJPA 4JI5B 1GO1A 1OFHA 5ETJA 1PYOA 4CVNA 2FN7A 1GZ0A 1I7QB 3H1FA 4QYTA 5ELLA 3Q4HA 4CMKA 2X4IA 2V7QD 4GOJA 1XE3A 4BTVA 3EHBB 1XZIA 1TEHA 2DWUA 4OP2A 1FNMA 1ZEMA 2YWCA 1JF8A 1UT8A 3LX6A 4BZZA 4R68A 4B7UA 2B92A 4RJJA 1RRKA 3HCPA 3B6ZA 1BEEA 4MQ6A 1KZ1A 4UM7A 4OKIA 2ALEA 4BKUA 2PQ6A 4HDKA 3NK6A 3UW3A 1JSLA 1YDFA 3PQCA 4GNKA 2WB2A 1LX6A 2UXCO 1WOYA 2ZLBA 1ULZA 1VIMA 4C7UA 3T1OA 4MKGA 3QU4A 2VPTA 2CEKA 2H1FA 3GNQA 3E9DA 3K0CA 3O8RA 3M33A 1S3IA 2WOJA 3ICCA 4CEIA 1MC5A 2OSVA 4C0KA 4ZK2A 5KYTA 3O73A 1O0SA 3B3GA 5EK0A 4OJYA 1NVXQ 1EWVA 3L7LA 4NCIA 1ZW6A 3AZQA 4YUWA 3ML1A 5IC5A 1NQWA 4G9EA 1NX6A 3QW4B 5HYVA 2C5FA 1RPOA 5DPMA 4OQPA 3UMFA 2YXPX 2O54A 1R6NA 2YN4A 2IY8A 3I76A 1HH4A 1BHAA 2B37A 3OAAG 1FP1D 4RGBA 2AG8A 4LAFA 1YC2A 5FR2A 4Z1VA 3LY7A 4WBNA 3ED1A 1I30A 1H5UA 5AK5A 1MPTA 4J8PA 2HDOA 1NF3A 2JJ8A 5KPJA 1GFZA 4HYQA 3OFKA 6AT1A 3HVKA 1MJ5A 1RXSA 4BLWA 1NQTA 4C76A 3QA9A 2YV2A 5LOVB 2J41A 1OLUB 4FSHA 4OMDA 2C8KA 3RARA 2Q3JA 1Y81A 3OP1A 4KXNA 3NHBA 2H06A 1KYQA 4GWLA 2BE9A 4RDXA 1ZOOA 5BWLA 4L8VA 3O31A 3B9QA 1IN1A 2D54A 5FPOA 2W6OA 3IPYA 3PHIA 2ADQB 1Z2AA 4P3KA 1NN5A 3MWDA 2JFQA 2IYRA 1PWEA 1OPXA 3SVLA 1H1TA 4RMIA 4DR1O 1CUXA 4PAOA 3W6UA 2IV3A 2FKAA 4F72A 2HU8A 1CW2B 3IQIX 4MWOA 4GMXA 3ISTA 1IULA 3G2JA 2W0XA 4WY2A 5A03A 3BEOA 3TE6A 5CHEA 1NJ5A 5ILOA 5KO2A 1E77A 4J2OA 1JHRA 3ZQ4A 3THXB 4PLFA 3UXYA 3W04A 4BE9A 5B6PA 3D6HA 1NVVR 3NTLA 4ZI2A 4BT4A 3KJIA 3VDXA 3GGPA 3F73A 4FBGA 4U02A 3CPEA 1RM5A 1ZONA 4F6EA 4Q9NA 4ARBA 1L7OA 4HDRA 1AK1A 1II9A 3TGWA 3QU7A 4GR9A 2CYCA 1OIVA 2Y76A 3W2IA 4I1PA 1RFGE 4EFBA 4ZAZA 2WK1A 3JQCA 4Q7JB 1CY2A 2VQ6A 3BCRA 3LC0A 2Y69C 1MP0A 2WYVA 5DN9A 1X1AA 3IB3A 4ZDIA 4MWCA 4DXAA 1HYEA 1GQSA 5GIPC 2QG4A 1P8AA 3IMGA 1YQNA 4CIWA 4MWDA 3UJBA 1F3LA 2OENG 4DARA 1JDPA 4II2A 5CDFE 3G68A 5JUWA 1V0JA 4YAOA 4BFVA 4Q20A 2JZNA 3Q7SA 3ZQ6A 5G0WA 3EODA 3HP7A 3QBTA 4DNFA 2QMZA 1P7PA 2O14A 4JGGA 3OLCX 1U8FO 3V1LA 1OX6A 1JVBA 3I2GA 4JR0A 5SYNA 4Q37A 4GG1A 3HBFA 2QN1A 4YHBA 1MIHA 2JA1A 3EDRA 3BS4A 1Z2OX 1ZN8A 2ZXFA 2RGRA 1YSCA 2C0PA 4FCTA 7MHTA 2HA6A 4Y2YA 3KE9A 1QE3A 1XHZA 3ZD9A 2WZQA 4A8JA 4YMLA 1UT6A 4JUIA 2I2BA 3PQ2A 2X8JA 1I2ZA 1ZL8A 2C2MA 3IP6A 2ZRHA 1S3GA 4FMDB 2B98A 3H11B 3L4BC 1UOEA 2ZCVA 5CG2A 1KEVA 2O3RA 4WFQA 1JG3A 3WKCA 4BQQA 2XF8A 3L6UA 3O85A 1E61A 1WXHA 4EEQA 2YWRA 3WGTA 1YBAA 2H8KA 4XWGA 4XCVA 5IT5A 4KSCA 1US8B 4GOND 3O8LA 3CEMA 2NVBA 3KX2A 5AIBA 5ADUS 4LNHA 2OWEA 4EL5A 4X94A 2IJKA 5EJ2A 2ECQA 1ZIDA 1JEEA 1EVLA 4L4XA 1V8FA 3OMAB 4KPFC 1VL2A 3ZK8A 4BBPA 1I4WA 3OWXA 1C4WA 5IKXA 4EW6A 3K31A 1CK2A 1VHWA 1YCHA 2VRZA 2YV3A 1WSWA 4GR5A 1I9CA 1J95A 3GXOA 2WUFA 3GLHE 1ZLZA 1MHTA 1U8YA 2QR3A 4HB2A 4NJEB 3CNHA 2ACEA 7ABPA 1DBSA 5EIOA 1VQOF 1WZEA 1ND5A 2ENWA 5DNWA 1PG5A 4MGEA 3V7YA 1VHDA 1R6BX 4RUEA 4GP6A 3K59A 1P4JA 2RI0A 1Q1EA 4GZ5A 3TI7A 4PPYA 1CQWA 2CHVA 1UK8A 4QARA 1Y1PA 1GGVA 3VKWA 5D6OA 3FPAA 3AHCA 4B48A 4CG2A 2FPGA 4QT0A 5CPFA 4MP6A 1AV7A 2H29A 2OXRA 4C5AA 2QWQB 3ZCUA 4WFAV 2BCEA 3EGCA 1KJIA 1S0VA 5FUWA 2QTGA 3ZXYA 5J2TF 1W2GA 1UBLS 2F66C 1RZVA 4KI0A 2Z6AA 2ZXEA 5DIFA 4OHFA 2QM3A 1AROP 1NC3A 3M4JA 1ULSA 2VYNA 2L18A 1FFTB 3NBMA 1ECPA 3WFZA 3FYDA 1C1HA 4DANA 4MR7A 1F4MA 2GRUA 5DTEA 4KQMA 3VZDA 1SZXA 1OV9A 4D7SA 3NTUA 1FDIA 4NJOA 3HB4X 3FH0A 1EX9A 4MARA 3COJA 2G9NA 5AUQA 3SR0A 2NUAB 5B2ZA 3T1HB 3BE6A 3IMFA 5IWAO 4Q39A 3V4RA 4Z99A 4HGZA 4AZ3A 3B82A 3W8NA 3OBWA 1N9ZA 4JB2A 2R1VA 1OXUA 3HACA 1C9JA 4H6PA 3RNLA 3RDPA 4I9HA 3T5GA 1KO4A