4YJ3B

Crystal structure of tubulin bound to compound 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj3B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj3B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj3B01
4IHJB 5JVDA 1SA0A 5J2TA 3VOBA 3E22A 4O4IB 4ZI7B 3HKBA 5JQGA 4U3JA 2RHHA 4O2AB 1TVKB 4O2BA 4EB6A 5MN4A 4HNAA 4YJ2B 2R6R1 4O4IA 5M7EA 4TV9B 4TUYA 1TVKA 1TUBA 4O4HB 3JALB 5CA0B 4O4LA 4TUYB 3JARA 1W5FA 3R4VA 4X20B 2GVIA 3RYFA 5IJ9A 5KMGB 3WGJA 1W5BA 4O2AA 4U3JB 1W59A 4X20A 5LP6C 3HKEA 3N2GB 5ITZA 4HNAB 5EZYA 4YJ2A 3HKCB 5LOVA 5CA1B 4X1YA 3HKEB 3N2GA 5CA0A 1SA0B 5J2TB 2BTOA 4IHJA 1JFFA 2Q1XA 3RYFB 3RYHA 3ZBPA 4EI9A 3JAWA 4FFBB 3JATA 4O4JA 5LP6B 4KWEA 3HKDB 4B45A 3VO8A 5MN5A 3RYHB 1RQ7A 4I50A 4WBNA 3JATB 4O4JB 3N2KA 5BMVB 4YJ3A 4IIJB 4X1KB 3VPAA 4I4TA 2VAWA 4O2BB 4EB6B 5IYZB 5LYJA 5JH7B 5LXTA 3JAKA 4ZOLB 5EZYB 5J2UB 3ZIDA 4FFBA 2VXYA 4EI7A 3JALA 5LYJB 5KX5A 4XCQA 4X1IB 4ZHQB 3VO9A 4YJ3B 3WGLA 5EYPA 4LNUA 2VAPA 1FFXA 2Q1YA 1FSZA 3HKDA 3JASB 5JCOA 5ITZB 5LXTB 3N2KB 5IJ9B 5KMGA 1RLUA 4E6EA 4X1KA 2RHLA 3ZBQA 1Z5WA 2RHJA 4DRXB 5IJ0A 5EYPB 3HKCA 3JARB 1Z5VA 5IYZA 5JH7A 5EIBC 3WGKA 5C8YA 3RYIA 4DRXA 4F6RA 5LA6B 2RHOA 3WGNA 3RB8A 4DXDA 3RYIB 4F6RB 4X1IA 4ZHQA 2R751 3M89A 5LOVB 4LNUB 4X1YB 3VOAA 3JASA 3WGMA 4ZOLA 4TV9A 1FFXB 5EIBD 4I55B 5GONB 4WBNB 5JCOC 5MN6A 1JFFB 5KX5B 4IIJA 5LA6A 4U39A 3UT5A 3HKBB 5LP6A 3JAWB 5CA1A 3JAKB 1W5AA 4EI8A 5IJ0B 2VAMA 3CB2A 2BTQA 2XKAA 5CB4B 1TUBB 4O4HA 5FNVA 5BMVA 1OFUA 2BTQB 4I4TB 3V3TA 5C8YB 5GONA 4TV8B 5JVDB 5JQGB 1RQ2A 3E22B 5J2UA 3UT5B 4TV8A 3RYCB 3C8LA 2XKBA 4B46A 1W5EA 5FNVB 1W581 3RYCA 4M8IA 5CB4A 3M8KA 4O4LB 4ZI7A 4I50B 4I55A
chains in the Genus database with same CATH superfamily
5JVDF 3QO8A 1DT3A 1DOZA 3O1HB 2WWHA 2OKCA 2WUDA 2IJIA 4QEZA 3KSBC 4CQLA 1TLFA 1FXVA 3NX4A 2G36A 2XMCA 4F2WA 5I3CA 3F8SA 2A33A 1K8RA 2QT1A 3NBKA 1NBMG 2CXNA 3Q3HA 3TOXA 4AG5A 1LI7A 4QGBA 4YR7A 1JHOA 1NP7A 4JAVA 3NJ4A 1A98A 3EIQA 5F9MA 1A4XA 2OHJA 2J0SA 3THRA 1VCHA 3P3NA 2W8BA 1AS2A 3EEFA 4MPPA 1WXFA 4F3NA 3FPEA 4EFKA 2C2KA 3P97A 2PWPA 4O8ZA 2QTMA 2BFBA 1JMYA 3RD5A 1IAVA 1HTBA 3JAMN 3ON5A 1ZIDA 2NZXA 1NDUA 4K26A 4KE9A 4GXQA 5B37A 3MJDA 3V4PB 1T0PA 4ENVA 1J8FA 4EO4A 1OYOA 1Z33A 2V7EA 4LF8O 2ZK7A 3I2YX 2XXAB 1H5QA 4O08A 2GD6A 2I2FA 5LU9A 2WABA 2XYPA 3PRJA 1P29A 3PIRA 4GUAA 2O3QA 3UJCA 1G8GA 1OSNA 4LR3A 3STXA 5JXHA 3HL4A 5DGIA 4G8BA 3TSOA 4RNDB 2G5PA 4TYYA 3TD4A 1JIKA 4YQEA 1IE3A 3ZHZA 4LRTB 1J24A 2NU9A 1Q1BA 4P4GA 1QU7A 2C5FA 4BP1A 2VTKA 2PWYA 3F5DA 3LWZA 1H8EA 5AK0A 1ESCA 5D2CA 1VQMV 4MVYA 4PPYA 4KR2A 1OAPA 3P2MA 2VHEA 2VBGA 1FD9A 4FKZA 3QMMA 3WQRA 3EQ6A 3TFWA 1OIWA 3A4LA 3B3QA 2REQA 2P78A 4DR7B 1IU9A 1SUAA 3PFIA 4NYMQ 4TQUS 2Q45A 3R0VA 1IY0A 3C1OA 1H2XA 4BO6A 3ADBA 5ICGA 1TW3A 3NASA 3O73A 2QTOA 4YRPA 1RLUA 4NE9A 5EEHA 1U0NA 4XD7A 4W6ZA 1T2DA 2JFVA 2VWJA 2I7VA 4J7AA 1G18A 5BURA 1SD2A 3F6EX 5T57A 1NLZA 1LI5A 4YBRA 1S8NA 5L45A 2CJWA 4FONA 3IXLA 4AHCA 1XCOA 4MW9A 1UKEA 1KU9A 4IIBA 5TS3A 1CQWA 1NYLA 2X8JB 2QUKA 2ZWIA 4RA6A 3PUXA 3T1NA 2ILVA 1CVIA 2NO4A 2PUJA 2EL7A 4GU5A 3ZUPA 4X45A 4F12A 3QKSA 3H5OA 2NT3A 4JT4A 1W5TA 3UMCA 2UUCO 3IT3A 2ATKC 1FTNA 1XU7A 3A4VA 4N3GA 1H9AA 4IKPA 1E1DA 1CF2O 4I5GA 1CY1A 3SBDA 2FJUA 2BI7A 1GO2A 1TKAA 1ZMRA 1GN3A 3VQXA 3SR3A 3IPAA 3U3OA 1DDOA 2JNBA 2UUBB 4JLVA 3A25A 5L4SA 2EJBA 2PKQP 2XBUA 3KKYA 1M5UA 3A05A 5I8WA 4QQRA 1RI1A 3S1LA 2C2ZA 2GTPA 2C97A 3M82A 1ZRSA 3T3NA 3D00A 2QVLA 1H9CA 2DHQA 3Q6MA 1K27A 1XXHB 1MOSA 2XWPA 2EIMC 2Q0XA 3PA8A 4KAJA 4NTZA 4O5OA 4PANA 4QOGA 3D81A 2WJWA 2LCFA 4QQ8A 3WMGA 2R11A 2Z1NA 5I01A 2FAXA 1P84F 2Q3BA 4M49A 5C18A 2N75A 4DF3A 4MW8A 2CBZA 3UB2A 2F6RA 2ZAGA 3TIIA 1VQVA 3H1FA 2C2MA 4RFLA 4GXTA 5A9GA 5K0LA 1IJFA 3HXMA 1TRHA 4C4WC 4DXWA 1SGWA 4EPTA 4IEEA 3I12A 3EG9B 4LGVA 1G6OA 4ZAZA 5BNFA 3CRCA 4DV5O 3RVSA 4TUYA 2OC4A 3DWGA 1DCKA 5HJEA 1AY0A 1CP2A 1CR4A 1NF9A 2UXBO 1FYDA 1MNAA 4FR5A 4QQNA 4XW2A 4ALLA 3WZ2A 3CCRF 2IIQA 2WSSA 3DWFA 1G3UA 1WEHA 2ZTMA 1P2GA 3OJXA 4FM1A 1Q11A 4MAFA 4UNQA 1E60A 3D1VA 3PYXA 1XQVA 2ZFUA 1QFZA 4HHEA 1OLSB 3TMKA 3BSFA 2IS1A 2RB9A 2NTNA 4GOOD 4QUAA 3B52X 2E4AA 4JL5A 1WD5A 2OQVA 1IPAA 4AJOA 1TC1A 3L5KA 5BOSB 5AVKA 4LBYA 5AT1A 4P5DA 1SHZA 3NBAA 3RW0A 3HWWA 4C7JA 1X9HA 1T9CA 5DLYA 4WXRA 2HJ9A 5EKUA 1GZ4A 5DW3A 2R72A 1JIQA 4KOEC 1KI6B 3K71B 2Q0SA 5JQGF 2DPLA 4URFA 2HBQA 3DMGA 4UCSA 4QEDA 3G0OA 3TR5A 2X58A 3UMRA 1G4YB 3HHPA 4X3OA 3ZH9B 1GU1A 4D0SA 4OJMX 1PRYA 1A96A 4D56A 1GUBA 3Q7QA 4TKVA 5KVCA 2H2AA 3L6OO 2IX3A 4L5CA 4XOIA 3GD5A 3LX8A 4ARUA 1JEEA 4U9IS 1ZXXA 1GEGA 3ETHA 3TW0A 1G3IA 1WDWB 3CUWA 1RD4A 4NYIQ 3EB9A 3BIOA 3F6PA 4XQ0A 1L7NA 4JI4O 1XHXA 2EJ7A 2OFPA 3ZE7A 4IDOA 4MKFA 4CMHA 4W4LA 3BOSA 3HS3A 3ROKA 2AOWA 3GNLA 1QFJA 3DL7A 4RJLA 3HKDA 3BMCB 2F1OA 1YR6A 3GELA 1QZTA 2XUHA 2ZRQA 3HJGA 3NEJA 4J1TC 3WGTA 2QZ4A 1KC3A 1D04A 1N2BA 1N77A 4REQA 1B00A 1KI3A 2DR2A 4AJHA 4YY3B 2P62A 5DVZA 1E7YA 4TYQA 3PGLA 1KU0A 1NFQA 2A3NA 1KFKB 3QKRB 1QLWA 4HK4A 2ARHA 1Y89A 1GY8A 2V74B 4CYMA 5LSAA 1JVBA 3BMOB 4IQ0A 3C8UA 3WGKA 3AVTA 5KJ6A 4QE9A 4JI1B 3GUZA 4N4AA 4CL0A 1JPNA 2H1CA 3GHYA 2HEIA 1GZ6A 4WRRA 1FMLA 5JRJA 5FKJA 4PR0A 4X97A 4BVEA 5C5DA 2YZ7A 3CX7A 5FO1A 1I7PA 1U5BA 5I4CA 3CX6A 3JZFA 4JOBA 3LT5A 2RI6A 3ABUA 3F96A 3OW2U 2QTRA 4Q9NA 3WLJA 2FN8A 2VDLB 2HK9A 3H9CA 3TOZA 4L22A 4X64O 1YIAA 2XHEA 1YOVB 2LR0A 4KE6A 3G5LA 5CBGA 2FWBA 4GMDA 2REBA 1CF4A 2CZQA 3F9IA 3HZZA 3IVAA 1BFKA 4RUKA 3G7SA 1DGSA 1AHPA 4YLYA 1P4RA 4G2TA 1U7UA 4EJMA 3SK0A 3TQOA 4EHKA 3OY2A 3GRUA 2WPDD 2B61A 3IUNA 3LVQE 4P36A 4UUBA 3TNJA 5JV5A 2ZJ3A 3E9EA 4HNGA 3TOVA 1N5OX 2NU6A 3O8CA 4OFWA 5CM2Z 4N39A 2EFJA 2YIBA 1VQ7F 1U90A 1N34O 2VO1A 2IH3C 4BVSA 4QJ5A 3WLSA 3I5YA 3AR2A 1QP0A 3ENNA 5HMLA 1UBRS 3LUAA 4MOWA 2PMEA 4EBBA 3K1AB 1NJ1A 1HRDA 3MINA 4G9BA 4LHSA 1FX1A 1Y3BE 2JAWA 4F96A 1S89A 1PJ4A 3CYPB 1NVDA 1XV5A 1KEPA 4G0XA 3FLAA 4D9GA 1DG1G 1NV8A 1GL3A 2CB0A 4P80A 2P2GA 2LBPA 1H2KA 1I80A 5JO9A 2JLWA 3GD7A 3D2AA 3W9SA 1NATA 1THGA 3KQUA 2HR3A 4EARA 1CZOA 3W7VA 4OAQA 2Q8NA 3IMCA 4RGQA 4H17A 2FZ5A 3K79A 5AH0A 5AK4A 1KYWA 5DXFA 4LXXA 2R85A 1F4PA 3LO8A 2C94A 5DGDA 2FWPA 3LSUA 1YJ8A 2CE2X 3BX1A 3I83A 3P4YA 4LJ8A 1SQ6A 4LRUA 5E6UA 1EUZA 4D9JA 1CFZA 1MIHA 1L0LH 4MUIA 5G1PA 3JARA 4ASUD 3KKKA 2CYCA 2EFYA 2Q2OA 4PRLA 5I45A 3M7IA 4WAUA 4CI9A 5IULC 2ZDQA 3J7AR 3AESB 3IGAC 1T3ZA 4NF2A 1S0VA 1H48A 2JC3A 2NPIA 4RZ2A 4CH3A 3TTWA 1UJ5A 4P54A 4PHCA 4BTVA 1YZYA 2VHWA 4A8JA 1XNRB 1QGZA 1B42A 3JZIA 3CYFA 1VL8A 1ZK4A 1K97A 3H87A 3OUTA 3QU9A 1LLCA 3NHRA 4KK4A 4LGMA 4MQBA 2XCLA 4BT3A 1LPAB 3AILA 3PFKA 3D7SA 4PTYA 3SHWA 4HVCA 4JI1O 2REXB 1Z8DA 5ELMA 1WA5A 3FFMA 1XEQA 3HA2A 2HA2A 3LL7A 5JJCA 1FP1D 1G8SA 2H17A 3B7GA 1F8XA 4HUJA 4PO1A 5P21A 3ROXA 5I51A 2OCGA 1UWLA 2JCVA 2BFMA 3UQZA 4BVQA 2NUPB 5J4HA 1UPXA 1JYEA 5DHAA 5AYVA 3KJJA 4HAUA 2JIZD 5DM1A 3KAPA 3QH4A 4Q3OA 5DZSA 3G6BA 2R3SA 1EWYA 3ADOA 3A70A 4ZVNA 1FUIA 2IYSA 2WKSA 3VV3A 1VHQA 4N41A 5F3RA 4K9PA 1EFCA 2X0RA 3F4BA 4BS9A 2F93B 2A5GA 2OCIA 1ZHFA 3H16A 3MRVA 4DLWA 2JGDA 3C3WA 1XJ5A 4H0FA 1L6IA 3AU8A 4QPDA 3ZDFA 4FMDB 4DA8A 1FLAA 5J47A 3OEYA 1MAVA 2CCGA 4IHKA 2X8LA 2FX3A 1QDLB 1YRHA 3P9RA 4KR0A 3UXHA 3W1EA 4AX8A 4MI1A 3IOEA 4WVFA 2W6OA 3G6EV 2IRWA 1M5IA 1E4YA 3UH0A 2CMKA 2VCEA 3JD1A 3FPJA 2UYQA 4LMRA 5JE8A 2ISSD 4LY0A 4DRXB 2W6PA 4EJ2A 1QLEC 1RHJA 2OCDA 2P1DA 2Q0QA 4E6PA 2CF6A 1I4WA 3F5WC 2ZJ7A 1SPXA 4OCZA 2PI5A 2XYVA 1CU1A 3SLKA 2YOHA 3WLLA 1D6MA 4YEDA 5BSUA 4NZMA 3TM5A 1QHFA 5AJUA 3KUUA 4WASA 1B0ZA 4G65A 4I6GA 2X1HA 1XHZA 4Q9IA 2CNDA 2BONA 2EAUA 5KOHA 2CB9A 2YKGA 3UAVA 1AK1A 4IM7A 4QU5A 1VBKA 1H2SB 3AQ4A 3ZHXA 3LA6A 4D5EA 1N75A 5BRNA 3N2IA 1TTQB 4N7JA 2QX9A 2HS0A 2CJFA 4LDZA 1M54A 1XD2B 2BMJA 1S7CA 3OX3A 4C3ZA 3AR8A 4MDFA 1I1QB 1YI0A 3BPZA 4BDTA 1KZHA 3UG7A 1KVUA 1P9WA 4IZIA 2ZRGA 3NV7A 2ZZNA 1WP7A 2EZ4A 5LZ5A 5ECWA 2BW0A 4X94A 2Z4RA 3TD3A 1DAKA 4K05A 2O07A 1B15A 4GIBA 1H4VB 2VZ0A 2VCHA 2DHEA 1QYIA 4I9FA 4HF7A 4B32A 3BB4A 1VBMA 5A3RA 2DB3A 4GI2A 4RY0A 1I9GA 3KWLA 4CF3A 2P7IA 3QPVA 1PGOA 1U8UA 1BCSA 4GDFA 1OCEA 3LM8A 3EIWA 2G4VA 1FP6A 1RJDA 2AXQA 2O0JA 5IJAA 3FG9A 2GAJA 5IARA 3FOEC 4GT1A 3RK4A 1J0EA 3K12A 2GNAA 1QMPA 2JLQA 2PAAA 4L8GA 4N6OA 5JZVA 1F9AA 1T4BA 1LPOA 1CNEA 1UBJS 1VA5A 1XNHA 2Z8ZA 1JYSA 5ALIA 1OCRC 3IKFA 2H1WA 3DMRA 1DKLA 3KB2A 2ZB2A 3O3CA 4LWSB 2PXXA 4EHAA 4Z4GA 1FJXA 3NJ8A 4MR7A 4PO3X 3UM9A 2UAGA 1DSSG 5FYQA 5JATA 1K3UB 4FPPA 3R7DA 3E20B 4JLAA 4G2KA 3ZWOA 3TMYA 1VMKA 1V6CA 1NUHA 2C3YA 4HD8A 4RAOA 5LQUA 5J9PC 1P5FA 1MOQA 4X8AA 4DLUA 3UBTA 2H85A 4W82A 4LBVA 4FWBA 4MHTA 1ORDA 2B5UA 1TEZA 2C9OA 4QXRA 3PFCA 4BVJA 4I1VA 4QOFA 1R6DA 4UMVA 3RF6A 3HI4A 3HSSA 4HAWA 4P83A 1QIIA 4BVHA 5KNBH 4K6HA 2W48A 4KIGA 5L3QB 1KNQA 4XDLA 5F7XA 2V9YA 1IPFA 1UK9A 3QWBA 4EG5A 3CXHF 3O26A 4YRRA 1AA6A 4IXWA 2CL0X 4XGRA 4CM9A 1NX6A 2RGEA 3NCTA 4EMBA 5BNTA 1NZJA 1HOTA 1Y7TA 4AY6A 4DCOA 4NBVA 1P4GA 1JIVA 2AUTA 3BAAA 5A4MS 4NOJA 3SQDA 2C4VA 4C87A 5HKAA 2R00C 3MUEA 4Y0VA 4G0QA 1ZXBA 1ZH6A 3LS2A 4FYYA 2O8DB 2W2MA 3KSZO 1YE5A 1ZJ6A 3NHPA 1W2GA 3V9PA 4P7GA 2RHBA 4BAUA 4HLQB 3LDEA 4DT1B 4BCDA 5HZMA 4DIBA 1DNPA 5BN3A 3I9FA 3KR9A 1SG9A 1OFVA 1F14A 5A2QM 1HORA 3ECSA 4U7TB 4AJIA 2OCKA 2VP9A 3GHHA 5D6OA 3O82A 1UWCA 4FYPA 3L8YA 4KL1A 5CNIA 2AZ4A 3RSSA 2X42A 3ROEA 4Q03A 4FFRA 5F2NA 3QVMA 5HX7A 3F6CA 3RVQA 3KVVA 5D6NA 1NXSA 1X3LA 5KSWB 1T5DX 2DQ4A 4RSHA 5H0IA 2JBWA 1PX0A 2X9NA 2WFMA 2CD9A 2YHSA 1L7OA 4G8CA 4LXQA 3FSJX 4N7BA 3RVKA 2PD3A 2PBFA 1CYEA 1JG6A 1XWWA 3EWAA 1MFPA 4B48A 2FU5C 3GH3A 4B3CA 3GDFA 4Q39A 1COWA 1CN7A 4EGFA 2WK1A 4M9QA 2LW7A 3WGMA 1EUDB 4ZOLA 5FOVA 1X1AA 1GV0A 1YDGA 7AT1A 3B5EA 3ZCPA 2WWYA 3DBLB 2N9UA 1YL5A 5T67A 5FBVB 4F1KA 1NVKA 1LD3A 4YHBA 1NVXQ 5KYVA 3K5LA 2EWWA 3LGAA 5LJLA 5FPRA 3OQVA 4AKIA 2ENWA 3T4UA 1EZJA 1U1EA 2VDOB 3M6IA 1GZHB 3OJ0A 3DSQA 3IQWA 3Q2IA 5CIWA 1VJ5A 3IA2A 5EHQA 5GONA 2J7KA 1U3VA 1QUFA 3NMUC 4HL6A 3S28A 3E22B 1ZICA 2WT8A 1X8KA 2ZT7A 4F46A 1V5FA 2AGVA 5JNVA 2GWRA 4WOPA 5EWMB 3OX1A 3ETNA 3PJGA 1KYTA 2PO7A 1P7CA 4HBZA 3CWBH 3ASOB 4GCZA 4JH0A 4KO1S 5LQJA 3WRYC 5CVJA 5HMMA 2XAAA 4YRJA 5TQ2A 3DOEA 1XAHA 2ERXA 3LT4A 4CN9A 4EG1A 2AT1A 4B2LA 5IKPA 5K4HA 3DTVB 5JNSA 2HCTA 2ZIXB 3IQFA 4ZODA 2PGIA 1YL6A 5SZHB 4JI8B 5CBHA 4HNRA 2IW5A 4TSFD 1DQYA 3SSMA 4CIYA 1YB5A 1YS1X 4F8EA 2PSHA 3L82B 1HE5A 3TSYA 1XZ8A 2ZYGA 4HXEB 2D4HA 4D8WA 4X20B 1A9PA 2Z2JA 5KMGB 1ICIA 3LQRA 4GSLA 3TW8A 4JC5A 1KP9A 2XPCA 4JPRA 1ZI6A 5DK6A 2WPDG 3V2GA 5IKEA 2IDMA 3GCWA 4Y6OA 5BRJA 4Y98A 4NTYA 4JB3A 5K51A 4BVFA 1CEEA 2VNIA 4P84A 3GEMA 5KYWA 3A1EA 5DB4A 3G71V 1ACJA 2B0JA 3I30X 2NO7A 1ENZA 2BBOA 2QRLA 4HRVA 4B3BA 5KWEA 2BFCB 1IN7A 5KAFZ 1WE2A 4YASA 1EFVB 1W0KG 2C4KA 2J9YB 4DYLA 1QGUB 4QRHA 2Q7XA 3GFSA 4RYLA 2HA3A 1VTKA 3DTVD 4YMWA 3PD1A 5BMVB 3A06A 2E87A 1PSDA 3A0RB 5P8WA 3OJFA 4B6RA 2DQ3A 2X77A 3NCHA 4MDYA 5D7NA 4EBFA 1BVHA 1L8QA 1Q77A 2NU7A 3ILXA 5ECYA 4EI7A 3P9KA 2FJ0A 4DV4O 3GFGA 3KALA 2EJCA 3GWGA 5EPEA 1F48A 2RMKA 4QFMA 4C07A 4CEJB 4X63A 4H1VA 4YJFA 3DP7A 1M2NA 3SX2A 1DOAA 4KR7A 4LNUA 2PBLA 4BJHB 3IBYA 1KSGA 4JJZA 2JFUA 4JZ2A 1RWMA 1Y1SA 2YCLA 3MRXA 1AV6A 1X1QA 5GOTA 3VR4H 4CVNA 4PZCA 4CG3A 4HB4A 5KQSA 3N2KB 1CLIA 1W0CA 4NJOA 4X1KA 2F62A 1Y8ZA 3S2SA 1R6UA 2XUPA 3BN3A 3KE9A 5ESWA 4ZZ3A 3D3WA 1YVWA 1JHYA 3KQYA 3KSUA 5IJ0A 4FC7A 5E6UB 4A5SA 1EFKA 4EZBA 4DR4O 2J9RA 1GCAA 3LPCA 3OM8A 1G8HA 3NHBA 4XYMA 1THZA 2VG8A 4BCCA 5KHLB 5TF4A 1LPBB 1CUBA 3FGOA 4FFMA 5K0NA 1ZHOA 3AR7A 3ZN0A 1FPOA 3FPIA 3NT4A 2HK6A 3OE1A 3OMIB 3T7IA 1WRBA 5E38A 1VPDA 3AL3A 3NLLA 2RCVA 1ATZA 4G28B 2N74A 1XP8A 3QMWA 5A2GA 1UT6A 1XYYA 4I55B 2QLNA 3QVTA 3R77A 1CXZB 1VMIA 2A9JA 3AY6A 1YQDA 2CL7X 4OOFA 4IMJB 2XYRA 1O97C 1RYMA 4Y9RA 2F1KA 2D54A 1AKUA 2C42A 4G25A 2M9MA 4LUCA 3JAKB 3OONA 1C4XA 1KQ3A 2SNIE 2ZI3A 3OIDA 2EL9A 4UU8A 2VYFA 3LVRE 2RH4A 1WV1A 2WDPA 3EG9A 4FEAA 4L8VA 3UJ3X 4C6SA 1WIWA 2IP1A 3LZDA 2SECE 4IJVA 4UPDA 1Q44A 1XUOA 1Y6JA 3L8HA 2OV3A 5DYYA 4ZVVA 3IC7A 2G3YA 4KSBA 3UWDA 3V1TC 4AJLA 1XF9A 4RK7A 1U80A 4BFXA 2QD5A 2HK7A 4IRXA 2FV8A 4NZ9A 2RBKA 2BMVA 3E58A 1O9HA 1YVRA 2GSWA 2YYAA 5DH9A 5EP1A 3WIUA 4XM1A 4C43A 3L70H 2WKPA 3VX4A 1GT6A 1RPZA 4H7HA 3KXDA 3BULA 4HX9A 5I9IA 3O4RA 1BDHA 1N6NA 3OCXA 3FYUA 4PNPA 4PNZA 1GGHA 2LP7A 1X3SA 2JJ2G 1JHDA 1X7XB 4FFSA 3P9IA 4FOSA 3HJWC 2ACWA 3KQTA 4GL4A 4UBLA 3PHHA 4ALKA 4CNBA 4LXUA 1FXKA 2IZZA 3NHLA 4L8JA 2AI3A 3MT9A 1UT5A 3LECA 2BE7A 1Z4LA 1Y9ZA 2QL6A 5ALDA 3OO0A 4OXXA 3A8TA 2C0QA 1H2WA 3W9UA 4D5GA 2I91A 3JVEA 2QZSA 1LQTA 2FWNA 2ZIXA 2GUGA 1QR9A 1H22A 4RD6A 5JASA 5EBWC 5IW8A 1EFRG 1WMAA 4JEUA 2H1HA 3AC0A 1J22A 2HMSA 1KIAA 1GQRA 1M8KA 1U2QA 1ZM3A 2Q4BA 1P1FA 2IYAA 3CNBA 4IBOA 2VKTA 1DRJA 2GWHA 5ICFA 4J1QA 5EWMA 4W5RA 4C2AA 1YCIA 3W2FA 2ZODA 1DPFA 2AWNA 3VSCA 2C2YA 3R74A 2TECE 1L5OA 3W6OA 2WHXA 1WMSA 4PCVA 3VOTA 1A2BA 1Q50A 4ZRMA 1LBQA 4RH0A 5TIIA 4G41A 3TG8A 1KQPA 4D99A 3GTZA 1DLIA 1IHDA 3DDHA 1RJEA 4NNJA 3ZHUA 1FLVA 2V1DA 2FRXA 1HE4A 2WNIA 2XRFA 4RHUA 5D1NA 5LL6P 1RS0A 3QXGA 1OFHA 2CL5A 3V55A 3OESA 2ZQYA 2DPYA 2CVQA 3MS7A 3WAJA 1OTXA 2AJLI 2X5JO 3H13A 1V5EA 2B8TA 2QSZA 2H7XA 3KOZA 4J1TA 2I2DA 4OK5A 4RWZA 4Q9JA 4RTPA 1C8LA 1XK7A 5IT9M 1QVFU 4JP8A 3DZBA 2UUOA 4NDNE 3E35A 4OK3A 4QSHA 5IK2A 1D2EA 1I7FA 4HBNA 1FUYB 2AXPA 2IIBA 1QVGU 4L9WA 2PI4A 3ICPA 2NU7B 1J2RA 1V95A 2ZYDA 1Q16A 4IR7A 4JQOA 4K3VA 3CLRD 3CGWA 3P7MA 4MV7A 4EB3A 4QKQA 5BPHA 1SG6A 2QGFA 5JCJD 5IJ9B 2V5UA 3HVUA 2JPDA 2XYGA 3LQ4A 4RF3A 3CSXA 1WNFA 4E7OA 1CDZA 3Q7TA 3Q7EA 1U1FA 3PC7A 2I4MA 3THXB 1WB9A 4Q3KA 1NXXA 2O2CA 3H5RA 2PD4A 4C82A 3D4BA 2FN3A 2MJLA 2OGUA 3T5AA 3Q88A 2IPXA 3MCAA 1EGAA 4TWRA 3A6DA 2RHOA 4G1CA 3BK2A 4C21A 4BZZA 3GN1A 4XM0A 2I71A 2ALJA 1Y67A 2VP6A 3B1KA 2JGFA 2FWAA 3FYDA 3MBIA 3QKSB 4QOEA 3U26A 4I14A 5IY5B 1YCDA 1RPJA 1BHBA 1NPDA 4C7KA 1Y9AA 4S24A 3JQ8A 4JELA 4PDMA 3CEJA 5HHTA 1EZZA 2YBEA 2LIPA 4U1RA 2F95B 2EKLA 3EVTA 2C2BA 3CURA 3DLTA 3HADA 4LSMA 4Z0PA 3T12A 5B1HA 3ZOKA 1Z7BA 2C5HA 3UMGA 3HKBB 2P77A 2H9YA 2X5OA 1S0UA 2ONYA 3WBKA 3MW8A 4J0IA 1QAHA 1JHXA 1F4LA 1FUEA 2FQWA 5EE3A 2PGDA 2QI9F 5M5BA 3O8OA 3KK0A 1HDOA 1YB6A 3G8DA 3JW8A 3N28A 4Y2HA 3UB3A 3V1NA 1XBIA 3D0RA 3DUFB 3V4SA 4JF3A 3EAGA 2AOTB 3HA7A 4RFSA 2XT0A 4UU0A 3N53A 1NUSA 1P39A 4HWTA 3AB8A 3NFRA 4MGKR 1ZUHA 2QD3A 3S40A 1UODA 1CK4A 3U0BA 4NAVA 4Q19A 5E3HA 5B12A 3KDPA 3KXLA 1ZD8A 5A5GA 1WUYA 2DULA 4EMSA 1N6LA 1E32A 1PLJA 4I50B 2HSGA 2P11A 1OC2A 2C9YA 1L4UA 5CBPA 1O0CA 3T7AA 1SXIA 3L79A 4XR4A 2DKFA 3BFPA 4KHPB 2MINA 3Q5DA 3DBOB 5MN4A 2BM0A 3B3FA 3N9IA 1AJEA 2VDNB 2GXAA 1N2IA 3BICA 2I9PA 2WMOB 4TTJA 2XGMA 1ZONA 3F2IA 5FLXM 2AIZP 1Z2AA 1ID1A 4Q4HA 2AEEA 4QATA 5FL7D 3EA5A 3PICA 4M7WA 1Y9JA 1EQ2A 1YE3A 3HPQA 3ZWQA 3DT8A 3QIVA 1CT9A 2QTHA 1HDYA 1NNI1 5ALFA 3ZMUA 3ESDA 3KBOA 3NBZC 4FT4A 4MV4A 4R98A 4CTKA 1JJOA 5LB2A 5A3JA 1GSOA 3G71F 1PDWA 1YQWA 2AK2A 3MG9A 4YJGA 3FFAA 2KTVA 1HE8B 3DQPA 2WZQA 1H65A 3N74A 1QVRA 2C4NA 3L8CA 1LPMA 1NBWB 1L3IA 4UJ5A 4D3YA 5AHRA 1AZLA 1YCHA 5IJZA 5EQFA 1OLUA 4DN6A 2OIEA 4AY3A 4KO2S 5CH5A 3RSCA 2H4HA 4QD3A 1X92A 1Y7PA 4BO4A 3VAYA 3WU2Z 3K6RA 3GWOA 1RXSA 1J8QA 4GM1A 2W8BB 1BEZA 1T1IA 4NBTA 4P53A 5I9MA 5CLFA 3CCVF 2QUBA 4MMZB 2AGAA 1AO0A 2XNDA 4TWBA 5DGXA 2O54A 3VISA 5BSHA 4XYEA 3A4MA 3K0AA 3BL5A 4IJUA 3RRZA 2GN4A 2PMKA 1P1CA 1UOQA 2RBGA 3AW9A 5I7SA 5JYBA 4OU5A 2EFDB 3IV7A 4N3NA 1OX6A 2IW1A 4IHQA 4KVAA 3AK4A 1OCRB 1HMYA 5HF6A 1L4LA 2DGDA 1YHNA 1PPJH 2V8OA 1D6SA 5HSGA 1VF6C 5GONF 3D6UA 2ATVA 1MX5A 3P2OA 4Y6SA 3TCKA 4YRBA 1NI4B 3PJDA 1X1DA 4C4OA 3U4MA 1QO7A 4TPKA 4CBVA 4PC1A 4LJ5A 1B74A 1NQVA 4Z4QA 1IVYA 2R5NA 3OTIA 3HRHA 4JQYA 5BSMA 2PPVA 3RROA 1EWVA 2RHWA 4B9EA 3EGWA 4FCCA 1DV1A 2D74A 3OPNA 1RXEA 3EMDA 1I1HA 1QOZA 1QU9A 3G7UA 3GVXA 3CEAA 4CM8B 2QPTA 2F9FA 3KBBA 1ECCA 3AIKA 1VI5A 3QI2A 1JQDA 3I6BA 5AW6A 5FOXA 4ZHWA 3OTOO 3K15A 4QTTB 1TIKA 1GTOA 3REFA 3CB4A 2FPIB 2XUOA 1XRMA 3I76A 2CNOA 2RH8A 3NNNA 4NZPA 1PQPA 2UVPB 4DK1A 3DLCA 5DFAA 3OWHA 1RQRA 3CCBA 1ZD2P 4KUEA 4I4NA 2A9PA 3L7QA 5DBFA 3PXGA 3WK5A 2AJBA 5KTTA 1CEYA 1JLLA 2HIAA 1HFKA 2QW1A 3ICVA 5CT6A 4PZ9A 3VOAA 1BEUB 2R97A 2RGBA 3ND7A 5L3FA 4FSHA 1YACA 5DIZA 5AI4A 2OQRA 1HM5A 2Q62A 5EIBD 1IUOA 1V1RA 2WZCA 5TR9A 1Q1ZA 1UFRA 4BGIA 2QIOA 2CJWB 3L9DA 4DJTA 3I2KA 1VEWA 1C7QA 3NJRA 5BSKA 2ZYSA 4YMVA 1M67A 4H7FA 4KVGA 4G0ZA 2BTQA 4DV1B 1WP8A 2PUCA 4BNIA 2GJSA 5DSTA 3VXKA 1O94C 5REQB 1GPUA 3HH8A 4G4SP 2B7LA 2VYVA 2HA7A 5TVKA 3ROMA 2Z98A 5ILQA 1TZBA 2AFHB 3FPAA 4RPCA 3IA7A 1LLFA 5BV2P 4ZCRA 4UAJA 3A1FA 3P4UA 2VRWA 2J9ZB 2ZSHA 3BWBA 2CVPA 4JR2A 4R1UA 3WSTA 2HWYA 3RT3C 1UMDB 3R3ZA 4A92A 4E1VA 1RRFA 5LHIA 3MCAB 1K63A 3EN0A 2FQYA 3KLBA 5LBUA 4F84A 1KWGA 1DC6A 3PTAA 4YCSA 1GKKA 3D6HA 4JFRA 3E8XA 4AMYA 4P0PB 1Y1RA 1NXPA 4XFJA 3C3TA 3W4KA 3IHKA 2Y4UA 2PUVA 1R15A 2PX0A 4PN3A 2I80A 4OA5A 5F21A 3WJPA 1Z6XA 1GRJA 3OLXA 3V42A 3NI2A 2PUDA 4TL9A 4LJLA 1G20B 5CMUA 4R40B 2X8BA 3HB4X 5KHAA 4YMUA 4LK2A 4G0OA 2A2ZA 3GRFA 4EAAA 5HFNA 2EKDA 4A9AA 4EHFA 3DLHA 1NPTO 2PFKA 4LW8A 4V0KA 2YZNA 4DSZA 5EJEA 4WNAB 2H92A 4TQFA 4K0RA 3KJGA 5DX1A 3STVA 1AILA 1W59A 2PIDA 5JBNA 2J3JA 1QKJA 3C39A 2KLBA 3G68A 3MCTA 5EJ8A 5KTKA 1T2CA 4G89A 3K14A 2B1GA 1BE6A 1Z75A 2XB2A 2MSWA 2IQ5A 2ZXFA 3CHYA 2QGNA 1L7PA 2FYTA 3VYTB 3EGIA 3DW3X 1L3CA 3LDAA 1MD9A 2CLSA 2MWMA 4OQPA 4AS2A 1AC5A 1AA9A 1G4AE 1M2HA 4W5HA 5ESDA 3HBLA 3D0KA 5EKSA 4MW0A 1UAGA 4QNHB 2KG7B 2Q7GA 2ZOVA 3Q9UA 1PTKA 2BHRA 621PA 4O2BB 3WLEA 3R9KA 1WCWA 3A26A 3G3EA 2OQIA 1E5VA 1N7IA 3EF1A 3PQ4A 1HV8A 1BRMA 2ACEA 3DHYA 3WK4A 4G56A 1SXQA 3OPMA 3LWOC 2ZRHA 3OZXA 4OD0A 8ADHA 3WGLA 1U2EA 3AI7A 4NPHA 1BN6A 1OY1A 3H1IH 2ATEA 3SNHA 3WXMA 1Y3AA 5G41A 2CFOA 1RRCA 3ZRSA 1QHYA 3ZP7A 1YR3A 3AEZA 4UNIA 3TINA 3PJRA 4RHCA 2XUJA 5KAMA 1NQTA 3SQXA 1M5RA 3FYHA 3KCYA 5L40A 2VL7A 1RRVA 3JD0A 3R3SA 1K08A 4FC6A 3K8QA 1EEHA 3MB5A 4BYMA 4I1UA 4C0AC 3OFNA 4F60A 4EUHA 1ONIA 2KI5A 3KR0A 3M4JA 1A4RA 1NA5A 3GLIB 3G9QA 1ZH2A 5KJ1A 4B3GA 1B6RA 4BWVA 2Y1FA 1BDBA 4OX9Y 4HUQB 1B6SA 4HFMA 1V8ZA 3GMSA 2VSXA 2HHAA 1Z6GA 2VZ9A 1P74A 3MYRA 3F7VC 3ZJZA 1ZH8A 4E5NA 1UF9A 2EX0A 2GPYA 1ZG3A 3DWIA 2VOJA 4A5UB 2YMQA 3DOCA 4HYEA 4CV2A 4EQ6A 3BM5A 4UHKA 3H8VA 3G5TA 1DRUA 4B3DA 4MIOA 1OILA 4Z7QB 2NV0A 2XTJA 5AM1A 3ESCA 3W8DA 1ZSVA 1M57C 1EFHA 1B8NA 1XDZA 4P34A 1WOYA 2W98A 2PVCA 4UCXA 2YUAA 3TO5A 2FMXA 4LZPA 4PPQA 2H4YA 2YV5A 4G88A 3FCCA 4TLDA 1NQ3A 4DZRA 2WWFA 1R0KA 5K7SA 5KYNA 3P4XA 4FIPC 4DPKA 1SBHA 4LOKA 1N2HA 4Q9LA 1G19A 1B41A 1N2CA 2YZMA 4WXPA 2O3UA 3PXEA 5BWOA 1KXJA 3EFEA 2BELA 2GYVA 2EARA 5BN1A 2Z1FA 1HE1C 1UANA 4DBZA 3B2NA 1I2DA 4ICGA 1QH1B 1NH2B 2NOAA 4QLAA 1NN1A 1CQJB 2NYUA 2EZTA 5CXXA 4QGGA 3G7NA 3UUGA 3VR1A 4I4LA 3G0BA 3WYGA 2ID8A 5HTKA 1Q8RA 2QE7D 4AN1A 4B31A 5BPFA 4CI0B 2JFXA 4UEWA 1E2KA 4QVKA 3O4FA 1ZA1A 1LFDB 1ZOPA 3F90A 3JYLA 3OLCX 3LQQA 4HPWA 2WP8J 4L5AA 3B3AA 1H66A 4ZO4A 3JCUZ 1Y6ZA 3UWSA 4FI3F 2GVIA 3LRTA 4BR6A 4NBSA 4Z1MA 4M53A 3UOAB 2FN7A 3LSQA 1F23A 1KH1A 1PR6A 4FYMA 2UXBB 1X80B 4HGRA 4JT9A 2PY5A 1QIHA 1RAEA 5IYDO 2Z58A 3KKNA 5HBGA 2FGJA 3NHMA 3WBJA 5FP0A 4EVQA 4UXIA 4J1NA 4BVTA 3T3GA 4ND3A 2X9LA 3VR5A 1EXMA 1P1JA 1Z0UA 2W6IA 3OP4A 4NYIR 3OEEA 2KSQA 4QFDA 2VQEB 4MTGA 2P6JA 4FFNA 4GH5A 4GOXA 1E77A 3U4QA 4UEKA 1PLLA 1T8PA 4GLBA 1ZVJA 3MCQA 3VO8A 1Z12A 4DLVA 2XB6A 4JZYA 1JSZA 1ZVKA 4XDJA 4CIDA 2G6BA 4KL8S 3QTTA 2DTDA 1Y6QA 5JRZA 3QUBA 4Z9AA 4BY9D 3VYRB 3K35A 1FYEA 1UJWB 1RRMA 5J2UF 2WI8A 1PCXA 1G5IA 2Q67A 4DT1A 2CV1A 1GYPA 5KIAA 1WWKA 3KZOA 4YJ3B 4XRRA 3U39A 5FNVF 4PEVA 1BXRB 4GLXA 2ARKA 4K35A 4NS1A 1UBLS 3NOQA 5BSFA 5JNRA 2ODTX 3MJTA 1SC5B 5LKRA 2H2HA 3G0DA 2VUHB 3HYSA 3Q8XB 1P3JA 1IATA 4N12A 3ADCA 1SZDA 1PWYE 2I4OA 3DFMA 3MXOA 3TPFA 3EUEA 5EJAA 3ZMTA 2QUJA 1FXWF 3IKLA 3K8ZA 3OEED 3PPIA 5AOVA 2Z5GA 4N6GA 2FE4A 1AD2A 4Z99A 2P2NA 1MW9X 1ZGZA 2EV9A 3WPWA 2JKZA 3H0KA 4G1EB 1U7ZA 3HLTA 3NTRA 2KWIA 2JHAA 4JP5A 5CNMA 1G9TA 2Q6LA 2LQTA 4IH4A 3HP1A 1NBOA 4TKZA 4LH7A 1R0WA 4MW6A 2OFOA 4C88A 1OGJA 3P71T 1A2OA 1J00A 3ASUA 3HVKA 3TBKA 3U7IA 5IDYA 4V0MA 4DA7A 3CPHA 4J0EA 4J6EA 5IJWA 3A6LA 1RMYA 2VJQA 3EFOA 3FWNA 3O6VA 2IYRA 2BEKA 5TVGA 3VPSA 4C4YA 2G63A 2WBLC 3JX9A 1IB6A 5E4TA 3TCXB 3ADDA 3LWBA 4DR7O 3E9RA 3OM0A 3U11A 5LQDA 1QF6A 5A7GA 2IDKA 3SZUA 2ZETA 5HNKA 3M6AA 4I5DA 2COEA 2JI7A 4JBLA 2BFWA 2V3WA 2HA6A 3WE7A 4BIUA 2ODPA 3KR2A 4P5EA 4X93A 1ZOLA 3GV0A 4JGGA 5MHTA 3MXTA 2WWWA 3QUQA 2GJ8A 5F5NA 2VIIA 4F2HA 1PVOA 2E4XA 5DOVA 5E7QA 2Q5FA 3PVZA 5EMJA 4PONA 2A1TR 3GVIA 3H3JA 4LFBB 1PZMA 2GXUA 2PTHA 5EVCA 5CFLA 2XNHA 1Y33E 1QRDA 2YXYA 1ZUWA 2FVYA 2W6NA 2XUQA 1HNXB 3A1WA 3RU2A 2HSDA 4WCVA 1WU7A 2H7CA 3OZAA 2W43A 1V2HE 4MPTA 3VKUA 4FZVA 521PA 4WGGA 3HWSA 4PZLA 3HBMA 2BRUC 3MK31 3PJFA 2J6IA 3IMEA 4QT4A 1PT7A 1KK2A 2ZPTX 3NP7A 4XJVA 3RWOA 3VTKA 4I5IA 5JY6A 1MQAA 3FNHA 3F0DA 3PHGA 2R8EA 1XVTA 1K2WA 2HP0A 1ZZEA 4XD2A 1R6VA 4JY7A 1VF6A 1N8TA 3RIEA 1U3PA 1LTQA 1MO5A 5CPFA 2JEZA 1OH7A 2J09A 2ZU0C 3CR8A 1VARA 3DF9A 4PYIA 1FZQA 3ZCTA 3QYJA 1TD1A 1TKCA 3UT0A 1QLEB 4DV3B 1ODSA 5TQJA 2QY9A 4AL4A 1SCUA 4OH1A 3UAWA 4HKTA 3VHQA 5A7FA 1MHTA 2GZHA 5CA1F 2P9HA 4B0OA 3EWSA 5CDTA 2QAGA 4B3TO 4WN9A 1AMOA 1Z07A 2O50A 2AFIA 4HJRA 4MJ3A 1BMTA 3M9XA 3T9CA 1QPZA 5CB4F 4U7JA 3M6WA 1NWHA 1W2HA 2QTSA 2NIPA 1GKYA 4TQ9A 4TTQA 5JJEB 3HNPA 4MVJP 4F97A 2O8VA 2WTUA 3P45A 1V5IA 2C92A 3IP5A 1PXWA 5CXSA 4CT5A 1YDXA 3MUFA 2I5PO 1YFJA 2H00A 3CO0S 3I52A 3QBJA 4XGIA 2D7JA 1E1RD 2QTBA 3KOUA 4ZU6X 3TWOA 3W2EA 3NTQA 3SD7A 3DDNA 1RHUA 3Q10A 1A9ZA 3LT1A 1VGRA 3DAPA 3EXEB 1TECE 4BKRA 3T06B 5CDHA 3PAFA 1YXMA 2WW8A 3BJIC 3HY6A 4ZT5A 1HR0O 1L5QA 2PUWA 1UK7A 3GDOA 2CHVA 3TXYA 1TAUA 1FDIA 3B2QA 5IFLA 2J3MA 2GPBA 1GQSA 2GUWA 3JVDA 5CYOA 3O8RA 2ERYA 2YJ4A 4GE0A 1N34B 3AV0B 3OCJA 4FMDF 4OQDA 4D9EA 2MSDB 4ZJYA 1G5RA 5A4JA 2QNBA 2OG1A 1QIKA 1QP8A 2VAVA 2I67A 3DE1X 3KZMA 4MWGA 4RF5A 4JTCB 1A9SA 3GQBA 3I9JA 4ROSA 4OIMA 4IIJA 1OKKD 4PV7A 3ZX4A 2ZKLA 1NKVA 4EFMA 2UXDO 2P3SA 3WGIA 2N04A 1BGWA 2DPXA 4JLWA 3FE2A 1QOPB 2UXXA 4RAIA 1MGOA 1SQBH 5LNK1 3GZ4A 3OBYA 4DBVO 3WB1A 3CPJB 4BRWA 3W04A 1R1MA 4D6TH 1QVFF 1VL1A 2VDUE 1GM7A 1BVRA 1P4AA 2QN8A 5CT8A 4CMKA 1H1TA 4P92A 5DGCA 5EHXA 4HB0A 3BFXA 3ZC3A 3GGPA 2Z2ZA 2X6BA 1JHUA 2OTJV 2ZSAA 2G04A 3AO0B 1AVMA 3ZDEA 1JXAA 1PBNA 1M6WA 5AJXA 1X86B 1XEXB 4MQ4A 5JTUA 1G8FA 5HQ3A 4D98A 3VR6A 1N5MA 1F2TB 1WCXA 2ZJ1A 1ZVQA 3RLIA 4BQQA 2PUEA 1RHRA 2VN8A 3I09A 1IEVA 3C15C 2W90A 4CS3A 4Q1DA 1JPVA 2IV2X 3T4PA 1TO6A 4BKOA 5K0GA 1TU0A 4RHXA 1VMEA 3C3DA 1D1SA 2V5VA 4JD5A 5B4TA 2XXAA 3ABIA 2FI1A 1NTOA 5CCBA 2C5SA 4GUDA 2C00A 1TVKA 1Q0RA 1V7CA 4C4TA 2ZB4A 3O4GA 4B7KA 1F5SA 2G72A 1FSPA 2I3BA 3VVMA 5TQ2B 8AT1A 2WC1A 2X0JA 3ENQA 5D3KA 1UBTS 3R4VA 3H97A 3HU2A 3L18A 1VPLA 4XD7D 3EYAA 2AL7A 2HRCA 4BX0A 1NI8A 2H07A 2NQ8A 4XR9A 3ZVRA 5JTTA 1Z5UA 2DRIA 2ZYAA 3L7JA 2VRCA 1HRKA 1XNJA 3OF5A 2VPZA 2VK4A 3DYIA 3Q41A 4I6EA 2X0KA 3DDCA 3KYDB 4JVSB 3SBOA 3MCUA 1KYZA 2P6YA 1KSJA 3ZWNA 3UJ7A 5BUQA 4ZP1A 8MHTA 3HA3A 4FHZA 1UQUA 3L4SO 3CCQF 5DP1A 2MMGA 5GGXA 4EVRA 3IEMA 1ADGA 5F2OA 4G4WA 3E1GA 4MGZR 2XMBA 3T1TA 1V55B 1RCUA 1BHO1 3QELA 4M8LA 1VSBA 3NDBB 1SXGA 4GPZA 4DDWA 1C9YA 3VOSA 2O14A 1EE9A 3KVYA 4HOYA 3DDZX 4PX5A 4UVEA 4BMDA 3LUDA 1WULS 5IN5A 4R01A 3O4JA 4PGAA 3OZVA 3CNLA 4POOA 2VXYA 3EPLA 1KBOA 2RAFA 4M60A 3JD2A 1CB0A 4PRYA 1R6XA 2DH6A 2ODBA 5KX5A 2GBPA 2QAGB 3BS4A 4TMWA 5ERYA 4FIDA 4XRGA 1UM8A 1E3EA 4X1OA 2QXYA 4YRCA 5EYPA 1KOGA 3JWEA 1XRGA 1JU4A 3IPYA 3H5VA 5B2ZA 421PA 3PX3A 1YMQA 1SVOA 3GRPA 1PYOA 4R6ZA 1T5LA 1YIDA 5A9TA 2D1SA 4K6OA 2ZJ5A 3A9CA 3OM3B 3SBEA 5JY1A 2PGNA 4LJ9A 5CVCA 5AJVB 4IEFB 2QVYX 4D4MA 4F3KA 1C3LA 1YNSA 5F78A 4BO5A 1ZO8A 2ATIA 3U7EB 2IP2A 4CM8A 3HFSA 3HXLA 4MGIR 5THQA 3RVYA 2B0CA 1JA1A 1VI6A 4RQOA 4MV3A 2YS6A 5CBFA 3ET4A 4ZVLA 2BHLA 4U2BA 1YITV 1OJLA 3I5UA 3PT9A 5HJ5A 3TXQA 3L6BA 4JKYA 1LRLA 4M38A 1P8AA 3MELA 1KAGA 5JS8A 3GLGA 3HDTA 4N18A 4J9ZB 1H0SA 3W3AD 4B2YA 4UOEA 1T0UA 1EX1A 3N2NA 2I66A 3T1HB 1WJZA 4DUYB 3CG0A 2VT2A 3I04A 4UUMA 4QTZA 4KC0A 4G97A 3LTEA 4WV3A 2MSCB 5CFNA 4R4JA 1I2BA 2H08A 1JVSA 2B1QA 3Q9LA 3JQGA 4X7BA 1V6AA 2GTSA 5JG7A 4GGMX 4D7AA 2AHZA 3IP8A 5K0EA 1F8YA 3O83A 4NL4H 4RVCA 5FTJA 3C5EA 4MQLA 3IULA 5JNLA 3L7MA 2V3CC 1DUVG 1X13A 3EXEA 3CBGA 3HZHA 3I1FA 1EXWA 1PNKA 1OBHA 2HC9A 3LY7A 3N7UA 4QHYA 3TLCA 2QKCA 4AS1A 5F3WB 2JFNA 4G4ZA 1OHHA 1B06A 6PFKA 1Y98A 1NV9A 3USES 4DL9A 3AHIA 4EO7A 3PLAC 3IT1A 1PF7E 1T2FA 4ZVPA 3OUSA 1MB2A 4YJ3F 1TMOA 3I01A 2PG3A 2QW8A 3HEBA 1AMNA 2YRXA 3EPPA 2W37A 2V7BA 3RAEC 1CV2A 4ZV9A 1X7YB 4JYYA 4I7ZB 1Z0AA 4KMMA 1YR7A 3UHAA 4GE3A 1CY2A 4K9SA 4XX0B 5B1DA 3ADPA 4RUFA 1N1EA 1GDTA 2NVUA 4ND7A 1D5WA 3FWZA 1NHWA 2OXTA 5FULA 1JH8A 1CHNA 1TZMA 4RIGA 5C53B 5HKKA 4FE4A 2CCKA 1GNPA 4HLUA 4MCIA 2A92A 3GY0A 3KEGA 3T54A 3GJ7A 1SS3A 3I28A 2IGBA 2G38A 1XUQA 4C0WA 1QM5A 1XCMA 3HMKA 3IX7A 3PQCA 1EFDN 2JLYA 3FRJA 5EFOA 1L4YA 4L4XA 1DX6A 1QH0A 1R6BX 1T15A 3AHFA 4RXMA 4CCYB 5EP4A 4I1RA 1MBZA 2Z6VA 3CHXA 2HRYA 2IKSA 3ISTA 3RUEA 3JZAA 2PLFA 2EGUA 3KO8A 4PPGA 4AJKA 2CHUA 3BK7A 4TXMA 2IXBA 1BTOA 2L0XA 2QG6A 3ESJA 2O7NA 3IP6A 1NW5A 2E4UA 2I6GA 3PRHA 2OILA 3GIWA 4H3HB 4RZSA 5F98A 4A7PA 4ZCIA 2VJAA 2LE0A 1PF5A 1OX4A 2B94A 4KPFC 3W2TA 1WW8A 4DR1B 3I6IA 1SXJB 2BGRA 5FTLA 3BKWA 5F2EA 4ECEA 1M7GA 2Q3DA 4MUYA 4IDDA 2O4CA 2HT1A 4YP7A 3VH1A 3KB8A 4ND8B 4E21A 4FUQA 3W9YA 4I0XB 3UJ6A 5DXAA 4AP5A 4P4UA 2I7XA 2WYOA 2X6CA 2BMEA 1ABFA 3Q15C 3TF5A 2B4RO 1JJAA 4KXMA 5AKLA 4PWYA 3OQOA 2AKEA 3DA8A 4B3FX 4Q3NA 3QF4A 4QSMA 4BRSA 1N7HA 13PKA 3MMNA 5SICE 3GJ3A 3AJRA 4YRSA 4RQFA 3KB6A 3SCZA 3EXG1 2Y1KA 2RGGA 3VR5D 5KBYA 1O2DA 2TYSB 2ZCUA 2CXTA 5ALRA 5FPOA 2ZE5A 3C3XA 3P2KA 4QDTA 3ZVNA 5BSTA 4A26A 1TJNA 1QYWA 1RLTA 1SKYB 2WJJA 1ETHA 4ZC1A 5FJJA 5IDWA 4F6RA 3K5MA 4AY2A 1E8MA 3RFRA 4K0KO 1Z9BA 2PGGA 1EQAA 1ZI9A 3A4IA 3CT6A 3PX2A 3RK0A 3VR3D 1PT9A 1SZPA 2R7AA 2OTCA 1NF3A 4MWEA 4BBAA 4QM7A 4D8YA 2QE6A 5EEGA 1JPUA 1QOQB 1YQEA 2B8EA 4K9OA 1F9EA 4V2UA 4RA6B 4ARCA 5CVUA 3L3BA 5FBHA 1F4VA 3P9XA 4MVJF 4XUCA 1TEVA 4KFMA 1BQZA 1GG9A 2VRCD 4M1KA 4FMBB 1M2KA 5DM70 3TL6A 4MHSA 5B55A 4H13B 1NJIW 4MVJG 1U1DA 3W5AA 1LW7A 1WX1A 3KD2A 1V3TA 1X9GA 3L77A 1DG9A 4J4BA 4OQLA 4YFYA 5FTWA 4E5KA 1E1RG 1ZESA 4BV8A 2LJ2A 1SBQA 4FN4A 4IV8A 2P9BA 1I4EB 4DR5B 1I13A 1NF8A 2WT4A 1VJTA 3G5AA 3K92A 3KYCA 1W7AA 3OTOB 3ZDRA 1O03A 3CC7F 4BMPB 3W5DA 1I01A 1C8VB 1O96B 1FXSA 1Z4IA 3H1LH 1RDFA 4MLZA 5CDSA 3IEPA 4ZDKA 2XOKG 3AESA 2Q3LA 3BF7A 2Q6TA 2XV1A 4KRXA 1UJCA 1SC3A 2HTFA 3BMQA 3HRIA 3OE5A 3RABA 3RBAA 3TBFA 5CEFA 1KK1A 4OHBA 2OUKA 2BJHA 4AU1A 1TMKA 4IG4A 4UTVA 3GYBA 2AFVA 3ASZA 3M84A 1K86A 2YCBA 1PV0A 4NSNA 1CW2B 1DAPA 4C4XA 8GPBA 1WHSA 3RF7A 4CEHA 3ECCA 5TNXA 4X65O 2EZUA 4Q9KA 1LTHR 3F9CA 4OH7A 4WCFB 4DM4A 4OJYA 4YCNA 2XD9A 3KT0A 5LLSA 3L1HA 3O8BA 2DPHA 3M81A 3WTCA 1WY7A 1RC1A 2GZAA 3DZ8A 3IKEA 2YWRA 1RXWA 1B23P 2OWDA 1NU6A 3UB4A 1MC5A 3HJBA 3BFVA 4NABA 2HJVA 4P7JA 2EQ5A 3H05A 1UOEA 3LPAA 4LTNA 3S70A 4YXFA 4PJ0Z 4CS2A 5JSZA 1YCFA 8OHMA 1K33A 1E18A 4FU0A 4R5MA 2QRVA 2PZFA 1UBFA 2PKCA 3RFFA 4N8EA 2AMTA 1B0AA 2Y69C 4Y67A 5DM2A 4DDHA 1RI3A 2V4DA 1CIVA 1J0CA 3OUFA 3K05A 2D1FA 3Q1LA 4HQFA 2F4NA 4BQPA 2AI2A 3QQ5A 2QTVB 3BMNA 4XYLA 2I78A 5HJ7A 5F23A 5F5LA 1RLIA 4J8PA 5ESXA 2IOQA 3V48A 2D1TA 4ZYTA 1MOZA 2BSXA 4CIWA 4AUKA 1L5HA 1SCJA 9LDBA 4LFCB 1Q74A 2GN6A 1KMHB 2F1IA 1G63A 4HQOA 4Q37A 3VYUB 3N58A 3K0GA 1GLNA 2JB9A 5EAZA 4OHMA 4A2WA 1SMKA 2R6FA 2X5XA 3E3MA 4FILA 3I2FA 2FK7A 1NJGA 2GERA 1MEJA 2Q6KA 5KHOC 1F1BA 1Y3CE 3DE5X 4PRKA 4QYXA 3R76A 5B2FA 3IDFA 3B20A 3UMVA 4JXKA 3IHWA 4BX3A 3ZZNA 1CFJA 1AF4A 1WNSA 1KD1H 1NJ6A 1WCYA 3NGXA 4MS1A 3ZI0A 4EGSA 4JYCA 3KQQA 2ZR2A 2AMJA 2GILA 3PUWA 4FFLA 1E7KA 3G2QA 4K03A 4RL6A 2BEWA 3PC8A 3EISA 4WESA 1KEVA 2ID4A 3VYSC 4H08A 4QM6A 1RQPA 3A7EA 1KJ8A 4QPCA 1EFRD 3UK1A 2PWBA 3CP1A 4JBIA 2PSJA 3N5KA 3T3MB 2X6TA 5LWHA 4NXMB 1GNTA 2FRDC 4KN9S 4UEOA 2NR5A 2WD7B 4YQZA 3RJMA 3TZCA 4IUYA 4BE9A 4RTQA 1SKMA 4JXZA 3IC5A 2DERA 4F8YA 1HE3A 1KR5A 4RS3A 1OAOA 3MLBA 4JXXA 1QNFA 1FFTB 1R6AA 2WYUA 5TJ9A 1SUFA 3KQMA 4B6QA 3Q3CA 3CX3A 3IQIX 4H1WA 4YCLA 3EH1A 5ARCA 3NHKA 2R62A 3MTBA 5CH8A 5K5EA 4IQ4A 2DBRA 1YXBA 2AG1A 2Z6UA 2D2XA 4CDRA 3K8OE 1YJWF 1DBPA 3E9YA 3R6TA 4AZWA 1YQ9A 1JDUA 1Z88A 5CIQA 2ANCA 3RW9A 4A6PA 1AKYA 3ZHQA 1OOEA 1N7GA 3HDJA 5EXEA 4D79A 1RYDA 4EHHA 1B16A 5IDVA 4QA9A 5HRAA 3RU7A 4E5VA 4EYSA 3JAWB 2GN9A 3N2LA 3N05A 4R1NA 4G5OA 4RGVA 2VAMA 4Q82A 4AJ9A 3VI3B 4M46A 4ZQFA 5F35A 2NO6A 4LWSA 5AW9A 5AVTA 1QQBA 1CLUA 2QM7A 3OEHG 3IQGX 1J1UA 2H3OA 5FWYB 2FQQA 3IIJA 1QHIA 3AM5A 3B12A 1E2QA 2DQYA 2ECPA 4MYTA 2V98A 1ENVA 5KPJA 2DFDA 3A9TA 1OZFA 1U4NA 4DV3O 5TARA 3V4ZA 3J80M 5AVQA 2XLBA 4B35A 5FIUA 1PG0A 1GRNA 2BFOA 1D7AA 1K9SA 4URVR 3LDDA 1HP8A 5IANA 1DWQA 2PS0A 4MP6A 3BTSA 1BS2A 3EK2A 1IG3A 3JQQA 4NNOA 5B3JA 2Q6AA 3FTNA 3UY4A 3WLMA 1VQMF 2AZ2A 3ZGNA 2IE0A 3Q7RA 4YFVA 4AZTA 1PDVA 1UDCA 3DP9A 1L4BA 3EZ6A 1LUAA 1L7DA 3CXUA 2UU9O 4MVOA 4JLKA 3W2HA 1U2GA 2YHUA 3H2JA 3IAHA 3I1IA 4B4VA 2C3UA 4ZI7F 5HWSA 2RGAA 3F8WA 4IUBS 3DOHA 1E79G 1DAEA 2XOKA 3GVHA 2WMDA 3H1GA 1B8PA 4M1TA 1N57A 3L4KA 4REMA 1JR9A 3T1QA 1DCFA 1UMBB 2ASVA 2WU3A 4PNHA 5K8VA 4HNAB 3ON1A 3ORRA 4BMNA 1R12A 3VR4D 1VQ1A 4BO7A 4NMMA 5KUMA 1AE1A 4XVUA 3MJEA 4KU4A 2PT6A 4NU8X 2B6NA 1A5BB 3U4QB 2BO1A 1ZDMA 1NZFA 2P65A 1K8QA 1ENYA 1Z8NA 2SHKA 2WIGA 2WPNA 2Y71A 3AOEA 2J6HA 3F3YA 3DXRA 3WGVA 5CJJA 2QZZA 1U7OA 5HXUA 4GRAA 5EK0A 3LDTA 2FUEA 3NBFA 5CDUA 5G4LA 2VPXA 1O6BA 1IM5A 2AOUA 2JAOA 3QENA 5JSHA 3DDSA 4U7GA 3FHTA 5LL6Y 1GKIA 4YMLA 1LPPA 2A5LA 1HTTA 1SCIA 1SK8A 2FGKA 5FL3A 1T2UA 1XMQB 1M1KW 1K68A 1GADO 3W3AA 1FS0G 1XMSA 2HBRA 1L5HB 1WZIA 1XV2A 3TLKA 5I48A 3DNMA 3VAAA 3KKEA 5LMZA 5GV7A 2FB5A 2X7RB 2I22A 4WL0A 1RWOA 1U8ZA 5TF0A 3W05A 3CSSA 3QFCA 4QIWF 4RQEA 4DA9A 1J2JA 2OORC 3R0QA 4JCCA 4E2FA 3ZVMA 1TU4A 5FOQA 3SJAC 2D2FA 1P7BA 4IZHA 4MPDA 4F85A 5L95A 1SH7A 4C2UA 2HHCA 3RHZA 2XUZA 1S6YA 1FKAO 2LD4A 3DULA 4RTLA 1R4NA 2EIKB 1AQYA 5HF8A 3UAZA 3YASA 1ZSNA 1R7RA 2WF5A 4EK9A 4CTMA 3WWZA 1CRLA 1WR8A 2PYLA 3COSA 3OSZA 2C7BA 1M74A 3WXMB 1JBKA 1FVFA 3A1NA 3CLHA 4DRXA 3FLMA 3L0OA 4XFDA 3UCXA 2CSUA 2MSEB 4DXDA 3SZRA 2WG2A 5DWQA 3KJXA 2CZCA 2QTZA 2OV4A 2YV3A 5E4YA 4DLLA 1E1KA 5BQPA 3KZIZ 1K7YA 2AR7A 1WM1A 2I4NA 2VWPA 4RKRA 4F6EA 5TISZ 5EMMA 1ZOOA 5FL7A 1Y42X 4WFBV 5GONB 3TD5A 1M3SA 3QE0A 2EINB 2R6HA 4FTWA 1F7YA 4L9AA 1K3TA 1DAHA 4CCYA 4L07A 1VQKV 5HA5A 3ZE0B 3AJ8A 3PFFA 4M88A 2FMUA 4UHHA 3RGWS 3LH5A 3U7RA 4KJXA 5G0TA 4EZEA 1NUUA 1OFUX 1PL8A 1QBKC 1YBMA 2BJVA 4FGJA 3QTYA 1Y34E 1G6Q1 3OD1A 4OP2A 4D0LB 2GDJA 3R3WA 4PQEA 4DB2A 1V7ZA 3DV0A 4RAQA 4B3XA 5CVVA 1P9NA 4ON9A 1KZ4A 3GFFA 4H1UA 4D82A 2UYHA 1ML3A 1K4MA 1C8KA 3RNOA 3GLFE 3C87A 1R3IC 2RGCA 5B1SA 1ESEA 2RC6A 2QT0A 2FLVA 1YJNF 1DDGA 3V8EA 1UKVY 1XZFA 2Q9BA 1OYWA 3LC2O 4MWSA 4XWYA 3RS2A 1AKEA 2H1IA 5TQ0A 1EESA 4UMFA 2I99A 1R8XA 1JAXA 2QP3A 5A05A 5ELXA 1GRVA 4PX9A 5DHRA 3ZY3A 2V8BA 5DYGA 1O94D 1ZMTA 4P22A 1EFRA 2FUKA 1YFKA 5L3ZA 1UFIA 5EHGA 3HLYA 3ZS8A 3DR3A 3K16A 4KDFA 4BO8A 4PELA 2GM3A 3DQQA 3RC9A 1B4DA 2ZUSA 3KP1A 3Q6IA 4MR7B 1ULSA 2HQBA 3HABA 3MTEA 3RSGA 4B5KA 4EUSA 3QOXA 4EEQA 4KXQA 1NHGA 4WD3A 5KYTA 1ZJ5A 5A71A 3GLQA 2YJTD 3A1VA 3WYFA 1GTRA 4XEUA 1DOHA 5B1AC 4YLGA 4EEXA 1J99A 3VDXA 1MVNA 5EJ9A 3KSRA 3CVWA 5AKKA 2W2OA 4G1MB 5REQA 3CW8X 1WMDA 2HQRA 2PSFA 3UC5A 1EDBA 2MIIA 1DZIA 1U3GA 3J7AC 3USCS 3FDIA 5JDIA 1MO4A 1TAGA 3H83A 2GFHA 4YAJA 1K5SA 3TQCA 2F9ZC 1D9ZA 3FB4A 5TPWA 2FR8A 1K9VF 1U2DC 4BRZA 3HNOA 3EZYA 1E3JA 3B8EA 3EOAI 3OCUA 4K81B 3AF1A 4ERHA 1U3UA 1WDKA 2FW1A 3ZGLA 3E86A 6Q21A 3UTCA 5ICEA 3U3JA 4MSUA 1Z4OA 3ZRXA 2OV8A 2PLNA 2WLLB 3BB1A 1I14A 2YW9A 3E2IA 3K30A 1ECBA 3N5CA 4EFNA 4RABA 3URKA 4EFDA 1TVEA 4BTLA 3KWMA 1QGYA 4ZT2A 2PT9A 4DR3B 1ACLA 2ID7A 2A9KA 3WGOA 1P72A 3VKHA 1YTFD 3Q3JB 1T9ZA 2JATA 1IQPA 1LB1B 2YV1A 4FE3A 4ITVA 3FD5A 1H9BA 3LLCA 4LJ7A 3S6JA 4CLRA 1BDIA 4IVQA 2I6TA 3FNBA 5A6VA 1XWFA 4ND4A 1CZUA 4W4TA 3ORQA 2C5EA 3FFQA 3BHNA 4MYSA 3R7WB 2X13A 4DCJA 5ITVA 3NDIA 1A8SA 4HDKB 4HQLA 5K0FA 4K8OA 4GEGA 3A0BZ 1L4FA 4PR3A 4IWNA 3VR4A 2ANBA 3STZC 2RGNC 3PEVA 3QP9A 1B76A 3TB4A 2HU2A 1Z38A 3WJAA 2DYRC 4DCMA 4LBWA 1KU6A 2JLBA 4MIKA 4EDFA 1WP9A 4RSMA 1R74A 2NWQA 2CFIA 3QZUA 1ZL0A 3LFTA 5AW5A 5TT0A 2X0FA 4E4YA 2X2FA 4I46A 1TA4A 2I8AA 3KFLA 2QBYA 1J09A 5LZ7A 2IDZA 2IXGA 3K0FB 2FSHA 5DNUA 3G49A 3LWRC 1JFRA 3CMEV 1LJUA 5BOVA 3ZXXA 3PGVA 3HB9A 1XMXA 4HEA6 3LCUA 4GRDA 3CB2A 6YASA 3I2IA 2FXIA 2WAMA 1M8JA 1P8JA 5KWJA 3FSGA 2Q5ZA 2VYQA 1JEYA 5EC1C 3EFOB 1Q90D 3RGBA 5F2VO 2A1UB 3GDWA 3HB7A 1QG0A 1T2VA 3EGXB 3FIJA 4NDZA 3U49A 3VVBA 4HVAA 1W0JD 5M29A 2ZIOA 1Z5NA 3IPRA 1H3NA 1M2OB 3JD4A 1JZSA 2WIBA 4TYMA 1PFVA 1EN4A 1QKKA 1F38A 1W1WA 1GEEA 1D6JA 2WJAA 1P19A 3L2OB 1A9TA 1M34E 4I3GA 1F2UA 1GM8A 1FNNA 1FTWA 3H0CA 4H3SA 3KUCA 3RDPA 1A1SA 4E03A 1EVJA 2PUSA 1FDOA 3GBVA 1SA0A 4S1PA 3VR3A 1I2ZA 3H99A 1FUUA 4B84A 4J07A 3WKEA 4PHFA 5GJVC 2FEKA 4GKJO 3UJNA 3B09A 1AHNA 2E55A 5CTJA 5FQOA 4JVOA 4LZNA 4R8LA 5IASA 1ID8A 1Z4MA 4J80A 2RAUA 2YN0A 4XDKA 1KDPA 1TM2A 2ITDC 2WFLB 1LBSA 2P06A 4DR2O 2O8DA 3OCCA 2LZ0A 4R3NA 2C9BA 1B6QA 2Q49A 3A6GA 2REOA 5K2MA 2H29A 3KYDA 1F12A 4YT2A 5DHTA 1A9YA 1PGPA 5CA1B 4FZRA 4UE6A 4YYZA 4LFBO 3QF7A 1JIUA 2CEAA 2X8WA 3B6MA 3R7SA 4C20A 4DCVA 2X76A 2XDQA 1DBQA 3RYFB 1K4DC 1XTQA 3PUIA 4NK5A 4RDCA 2ECKA 3FZNA 3MILA 4AQYO 1K5DA 5ALPA 4DMCA 4KRGA 4EF6A 2AJDA 1QIMA 2NZJA 4CF4A 2FSUA 5B58C 5C4IA 4GP6A 4Q05A 4YUVA 1S2GA 2IYVA 6CHYA 1SQVH 2W2PA 3GLHE 4LNHA 2YXLA 4UBKA 3BGVA 4KMRA 4FS8A 4NTWA 1QYDA 4OXRA 3GNTA 4N5LA 1GTMA 3MLAA 1RRKA 2H4ZA 2UUPA 3QVVA 5KCMA 3A7DA 5FI3A 1T1SA 2IEBA 1JJVA 4YRDA 4NH4A 5K8UA 5IHXA 3NVIB 3H2KA 4IDCA 1VJ1A 2P0AA 5A5VA 3NPAA 4KAXA 3M99B 2EXXA 3L46A 1WMBA 1J95A 2BCEA 1BMFD 1X9IA 3P96A 5D8DA 5AVWA 3G9UA 5HGJA 2EJWA 5PNTA 4Y0NA 3P0EA 3Q8KA 4HEQA 3O5AA 3DDWA 3HHEA 3N76A 4KQCA 4NMXB 3SXUA 2V59A 5LGUA 4EKWA 5CG1A 4LOLA 1P2SA 3CNEA 4U2EA 3HKCA 5AVJA 3STTA 2J3HA 2XAHA 4R1QA 4EPYA 5KVSA 1NS1A 2EILB 1JR3A 2EBUA 3F6BX 4KUHA 2E0IA 4MINA 5GMOA 2OA0A 3W1VA 2WT9A 2JAQA 4OQZA 4QREA 1J1ZA 4ZKEA 5KDDA 1CDDA 1XG5A 1B3QA 1I6KA 2V9PA 4AG6A 3GPLA 3SFZA 1VSUA 4HAVA 1YJWV 1EM8B 5EHNA 2AC2A 3Q87B 4KR9A 1EQUA 3U1TA 2PLAA 3H9QA 4AUMA 4H7JA 2R6GA 3NZEA 4PLCA 5A4DA 1I4DD 3BYQA 3M6VA 1GAJA 4I8IA 3PV0A 5H81A 3ZGXA 4ENRA 4P3PA 1WKBA 1ULBA 2X5NA 2WU0A 3GAMA 3GCDA 3PC6A 2R1VB 3UAXA 1D5NA 4GX5A 3H1BA 2Q8PA 2X14A 4B6PA 1QRSA 3G0GA 4ZD6A 5KVQA 5JPDA 1MQ9A 2A0LA 5F64A 3K0BA 4D3DA 3ANNA 2G8NA 2PFSA 3E8GA 2GLZA 3LYHA 4PSKA 5G53C 1ADBA 3FB5C 1BHAA 1IL0A 1KGSA 4RKFA 1R6TA 2Z9CA 3EVCA 4KXXA 3V5NA 4Q1FA 6ADHA 4DV0O 2HL6A 3EZLA 3EOZA 4ID3A 1J0DA 3JRXA 4OB7A 4YN3A 2ZVDA 3ZWDA 4C6RA 2JGDB 4ZHSA 1WQ3A 4AWXA 1YF3A 3VQYA 2Y05A 4YV2A 1XRRA 3A2NA 3IOMA 5CYFA 3S99A 3V80A 1RACA 2VJDA 3AR3A 2O8CB 1RHKA 1FUKA 2XDWA 3WB0A 4TUYF 2I1LA 1U0JA 2MOKA 3KLNA 1X4TA 1ISIA 3L43A 5B5EZ 4WLEA 5EIOA 4G3XA 3QLVC 2ZBRA 2ZYTX 2NVUB 1N5RA 3OFNG 5C8XA 3PHIA 2V3VA 4J2TA 4AP6A 5HQTA 4WY8A 3R65A 2BCGY 2Y1DA 3CE6A 3MAJA 4OFBA 1QIFA 5AP9A 1R0LA 2RKOA 1GU7A 1XL6A 3D6MA 1S7GA 2WSBA 4RESA 1JR6A 1F8FA 4DMHA 2QPOA 4LYFA 3WAGA 2GZLA 1WHTB 1DTSA 3ORSA 4MGYR 1MX9A 1KAQA 4FYXA 3IR7A 5A5EA 3PE4A 3GT0A 2WKWA 4H4DA 3OZ7A 4M0FA 2V9ZA 4X3PA 4F4LA 2H2GA 2I33A 4C8GA 3G0CA 4JI5B 3GT4A 2DYYA 3QNEA 3GPCA 3E5RA 1EX9A 3HSKA 3G9XA 3BA6A 4NXMO 2KBEA 4RACA 1P0PA 3PGA1 1WABA 2PSEA 3ZD9A 4BQIA 3GRKA 2PRJA 3LWPC 3GAAA 3I45A 4F5DA 4DAEA 4JL6A 4R8SA 4ZT7A 1P7PA 2Z43A 2ADPA 4O4JB 2K87A 1CJCA 2FB9A 3RU9A 4Z9YA 1E3WA 1EB9A 1EPUA 1OH8A 3D9QX 3WL7A 1P1KA 3E7FA 1XOUA 4GOKA 1T8UA 4L50A 4BO1A 4BVGA 2K6GA 4ZT4A 3TKAA 2VVTA 2YY7A 4TXNA 4FHEA 3D3EA 1BXGA 4DWOA 2QWRB 4RHYA 5LYJB 1W0KD 4PSAA 5A3SA 5JZ9A 1Q57A 4X1IB 4QQKA 5THXA 2M7WA 4HZ3A 1M1YB 1ODLA 1P7YA 2DJ5A 1L7AA 4HPJB 3K73O 2H54A 1EJ2A 3D7LA 5D3MB 5DNVA 5B3AA 4DUYO 3TZQA 1Q7EA 2LP4Y 1YZQA 5D87A 1JR2A 1MOFA 4TSFG 2R2AA 3LKZA 2GHQA 3OURA 1P44A 3DBIA 1SERA 3C9RA 1KP2A 1C0PA 2DPGA 5EBMC 1VHDA 3VC3A 3PYLA 1MAHA 3FKSG 1L5ZA 2O2XA 5F1PA 1Z29A 1N92A 2FR0A 2W9XA 4BNMA 1Y4DE 1XCGB 3DDUA 3EFFK 1WVGA 2ODMA 1ZM9A 4X65B 2J7PA 5LMCA 2OAQ1 2X9QA 3GUHA 4UU1A 4IH1A 1JQBA 4QPKA 1UXGA 3CUYA 3T3HA 1OA0A 1ONPA 3VKGA 2DYKA 5BUCA 4WF9V 2H18A 2VS1A 4LNUB 3GFOA 3EEIA 3HYCA 3QQPA 1VYHA 4MHOA 4WDRA 1PS8A 2IGTA 5AJYA 2NMUA 3FYEB 2QJFA 1F3OA 1XOIA 5LQKA 2CAZC 4LF9O 1RJWA 3HVIA 5HCIA 3B1JA 3DOIA 4XEHA 4HZUA 4C6TB 1OFIA 4DAOA 2JBAA 5FEUA 1CY7A 2AQKA 5ES3A 3REOA 3FFWA 1KDVA 3AG1C 2B34A 2JCGA 3CJRA 3U4CA 1Z26A 3KHTA 3KHSA 3SP1A 2PVSA 4OP1A 4DTIA 5FYDA 3T7JA 2FSVC 3GA7A 1XCJA 2VYNA 5BYJA 4ZYVA 3FMPB 1YQUA 3GLGB 1XA3A 2OECA 2PMDA 3FPCA 4LXIA 4WK2B 2HU8A 4A8JB 4EHIA 5K45A 3SKVA 4MO9A 1RJGA 3NT2A 2GOYA 4GICA 1UKZA 4RVSA 5IE9A 2Z6AA 3E6AA 2BGWA 4FX2A 4S04A 4Z6KA 3GVPA 1CJSA 2QUIA 1M90W 1RQXA 4K9MA 1JTFA 1MJNA 3UHPA 4B4OA 5B30A 2ETVA 5CB4A 1MVLA 1K75A 1QZXA 2YEVA 1X52A 3U0OA 1Q5OA 1UJBA 2VNHA 1Z4KA 1Z47A 2CJYA 2X2OA 1YKFA 3E4DA 5IF9A 3T9DA 2IDJA 1I4OA 2ZVYA 5LQAA 4RVGA 3RVLA 3OPXA 2DXIA 1ULZA 3F5QA 2D3TA 4PA4A 3BJMA 1QS0A 4ZZ0A 4P98A 3MPOA 2RCNA 5F7ZA 5K03A 3V8RA 2RJOA 3A6KA 5CX1B 1KP3A 3R6WA 2NQ2C 5BN4B 2Q5LA 1JGTA 3T3DA 2GRUA 1YDFA 4MV8A 3A4NA 3P2EA 5AHOA 4L5YA 3TX2A 3GLTA 1MZPA 4CKZA 3B6NA 1XZHA 2VHZA 3BWDD 3AJDA 4U5XA 3OHSX 1LDYA 1L4MA 2J3QA 3QOFA 4XSGA 5FI1B 2GV9A 1SQFA 4NYKA 2UZHA 2AR0A 4RD4A 2VSQA 5EQTA 1TUEA 1GQFA 1QHGA 1YR1A 2JJ2A 1V16B 3CMAF 2E82A 2ST1A 5E7MA 4QLOA 5FEMA 1WJGA 2BKEA 2ZYWX 1EZVH 3AYXB 4JJFA 4WVLA 2EZPA 3C1TA 1W96A 1P2VA 4FFBB 3CD6F 2P1ZA 3CEHA 4TKMA 3IUYA 3PTLA 4ETNA 3K0SA 2B4AA 1CUJA 1KSFX 1UJ2A 3HEMA 5J43A 3KVNA 4LIPD 2MK3A 2ZIFA 1YRAA 4GLJA 5KQMA 4LDRA 3PD7A 1H69A 4RHAA 1RE0A 2BZGA 2EJUA 3SR2C 3DO6A 5HW0A 1WSBA 4COKA 2PS1A 3T41A 4ERNA 1UEJA 5CLHA 4FP9A 3PL5A 4AICA 3D4NA 2UYPA 2B3TA 4M2LA 5K0ZA 3VHXA 1KTIA 2R8OA 4KUMA 4KP4A 5ULLA 1DKMA 2YJGA 5NLLA 4GGOA 1OT5A 3QKUA 5D01A 1HDCA 2A0YA 3ZY4A 3DL4A 5ILOA 3EPJA 1E4EA 1GD1O 1PKEA 1SHKA 2I6FA 3GP5A 4ND5A 3CIFA 2QB5A 3DC2A 4Q4LA 3SNKA 3RC7A 1E3MA 2BC9A 2HLDG 3A6PC 1G64A 4NMHA 3T0IA 4X6UA 4R2IA 4WKPA 1F5NA 3ZE2B 1A1VA 1V55C 5CX4A 2WTMA 3JQ9C 1AXRA 5K1ZA 4DR4B 1YFLA 2GBOA 5K3OA 2ZM6B 4TLEA 3TS1A 3HB3B 3OOSA 3FH0A 3OKFA 1YA4A 2YDEA 1U98A 1ZK1A 2EIXA 1WZEA 2G88A 3GVCA 4Q01A 2V7VA 4JJ4A 1P2BA 2EKPA 1Y5NA 2QE7A 1PG5A 3MNFA 3E27A 4TM7A 4L8LA 2IX9A 5C8YA 5E7JA 4A10A 4M89A 4DMLA 4FLFA 5LA6B 3FZGA 3CRNA 5FCDA 4BE4A 4F5YA 2QBYB 3VNAA 3T5TA 4W5JA 3U7FB 2PMCA 1HT0A 2M98A 4US2R 1U28C 4Y0AA 2L82A 5K3BA 1WS6A 3ETGA 1JA8A 1T6YA 1Z34A 2WG1A 2YFYA 1Q0SA 4N1AA 1ZK2A 4XDGA 2IV3A 2NO9A 4TYWA 1IG0A 2WJGA 1RXUA 1RZVA 1PU2A 2X2PA 1WPRA 2Z08A 2XF2A 3OJEA 1P6XA 1SCKA 3QKTA 4G37A 4IW3B 1IAQA 3H1EA 4YCDA 1OVGA 1STOA 2A06H 2G17A 4TRRA 3NWPA 3V34A 2G0TA 4JI7O 1TF5A 3BJZA 3LGXA 4CDGA 2F59A 2YS8A 1AVTA 3L74H 3QUSA 1LUVA 1RYZA 5I5GA 4BN4A 1U4OA 3B1YA 2FZGA 3E3OA 3TYXA 3RRYA 5EUCA 1EU1A 4AT1A 4NKRA 3X2QC 4Y2YA 5FFNA 4DG8A 2X8AA 1ZJYA 1L4GA 3K9LA 1PJBA 2I2AA 1QHTA 1U6JA 3H2SA 3H8SA 3LUGA 2RI0A 3QFFA 3UAOA 4KV7A 5EXDA 3IE1A 2J5RA 1JLRA 2YJ6A 1DHRA 1QQ7A 2P5TB 3PHLA 2BKAA 4QFCA 1XQWA 4XASA 4BEBA 3RIYA 1M2WA 1MDFA 3PXAA 3TKLA 4D0NA 2Q5HA 5CR9A 3LUJA 4RIFA 3EQ8A 3F7NA 1LSOA 3KOOA 3ABKC 1B7GO 3JR3A 4EELA 1YAJA 3T7RA 1UIRA 1A95A 5IAAA 3BB3A 4C08A 2O8FB 2BM1A 2Y1GA 3AWDA 4EB0A 4HQKA 3S3XA 5KC9A 1K1EA 2Y0PA 3TB6A 3D5TA 4Z1MG 5GINC 3WG7C 5L51A 2WZDA 3O74A 2O2SA 2PNJA 2OV2A 3H17A 1BMFG 4U3JB 1EB8A 2NSHA 4RK4A 3EDMA 4RJKA 4WFKA 3H11A 2ZM6O 5EZYA 3L0BA 3KKPA 3SJAA 1HW7A 4UVHA 3UA3A 5KDOA 2J6BA 4L28A 4LJSA 4OHPA 4RELA 2VGNA 3MRTA 4KV9A 4M0CA 1YTLA 4Z86A 1ZP6A 1IN4A 1QK4A 1UBKS 3OO1A 4HZIA 1KI2A 3VMFA 5BMVF 2X4DA 3FLEA 3ZNOA 5KYXB 1CLEA 4YIPA 1VQ9F 1ZJZA 2WJ6A 1GNVA 3R5TA 4QNRA 4K46A 2QR2A 4BNJA 4EYGA 3SWWA 2PF4E 2E6UX 4HSGA 4NYJQ 4U2GA 3K5NA 3PQEA 3PQ7A 2PQ0A 1TD9A 4UPVA 3RUDA 1HDJA 3UJBA 3C0KA 3I5AA 3VDMA 4F71A 1XZPA 1WXHA 1D9XA 3C8MA 3NBYC 2BP7B 2A9RA 4R9SA 1KZ6A 1NXOA 3DHWC 3G8AA 4TL7A 2P9JA 5FUVA 3ER6A 3EOBI 3D7MA 5JD5A 5B57C 5JS2A 2D3WA 2IZ7A 2HMWA 4QELA 4FFBA 1LSJA 2Q6IA 1KDTA 2HO4A 2NUTB 2PU7A 3DB2A 4ILEA 4ND6A 1XLTA 5DBGA 3TPZA 1KWKA 3JYPA 1XZNA 2CY0A 1NAIA 1ZS9A 3GC6A 5CNJA 2Q46A 2CD7A 4NX2A 2GGSA 3WY9A 1HC7A 4YX9A 2MYUA 1U5AA 3K1YA 2KQUA 4GVPA 1KPHA 3GMIA 2AEFA 4V0SA 2VYND 4B6GA 4YTEA 2OTJF 1PHRA 5T8KC 3FTDA 4DANA 2VHUA 3K9CA 3ZV6A 5HQ3B 4DLKA 2CC2A 1BA2A 2HDHA 1Y5RA 1NBMA 4I9NA 1TM4E 1SBTA 5JPCA 1TYZA 1SD1A 1H8EG 1PFGA 2Y4OA 1N33B 3IEXA 4OL9A 1M2FA 1EP9A 5C7LO 4RLSA 3QHDA 1JU9A 2AFIE 5J59A 3TDKA 2OCXA 2GA9A 4CMIA 1D2NA 2WV7A 4WHMA 1L4HA 1MLDA 2QP4A 4NV0A 3KEQA 4KQXA 3WYCA 2O05A 1ZISA 2Z8XA 2GYYA