3LWQC

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwqC00
5GIOC 3LFOA 1K8AH 3CCMF 4BY9D 4LCKA 3J80M 3CMAF 3CCRF 1H7MA 4X3MA 3LWRC 1M90H 3NK7A 5DCVA 3HJWC 3JCMM 1VQKF 4X3LA 3SIVA 5EO3A 1VQOF 3LWQC 3RA6A 1K73H 2OTJF 1X7OA 3G4SF 5G4UC 2JNBA 3VMFB 3E1YA 2OHWA 2KTVA 2OTLF 3CPWF 3G71F 2WALA 1S72F 1VQ7F 3CMEF 1VQLF 1YJ9F 3NK6A 3N4ZA 5IT9M 3CC2F 1KD1H 5GIPC 1K9MH 1VQNF 2QA4F 1W42A 1SDSA 3CCSF 3CC4F 3GYQA 1RLGA 2AIFA 2OZBA 1RA4A 3N4YA 3LWOC 3NVIB 1W40A 3OW2F 1VQ9F 5FJ4C 1YITF 3PLAC 1CN7A 5GAPK 2BO1A 1Q81H 1YJWF 3AGKA 1VQ6F 3OBWA 1QVFF 2KTUA 3SIUA 3CCJF 3PAFA 1GZ0A 2I6DA 4BW0B 1Q86H 1DT9A 3E20B 3FFMA 1W41A 1GO0A 1IPAA 4NUTA 1X52A 3HAXD 2LBXA 5G4VC 3LWVC 1YIJF 2ALEA 1JJ2F 5GANK 1KQSF 4TZZA 1Q82H 1VQ8F 2CZWA 3V7QA 1N8RH 1VQPF 3I55F 2QEXF 3CG6A 1CK2A 1PXWA 3ON1A 1ZWZA 3VI6A 3CXCF 3CCUF 4C4WC 3OBYA 1GO1A 1YI2F 3J7AR 3JAMM 1YHQF 3V7EA 3MCAB 2VGNA 5GINC 3LWPC 3CCLF 1YJNF 1W2BF 1KC8H 2HVYD 3CPQA 1T0KB 1Q7YH 1X7PA 3CD6F 1VQ4F 2QI2A 3CCVF 3I56F 3O85A 3CCQF 3IR9A 3WXMB 2LBWA 3NVKE 1NMUB 3J81M 3CCEF 3CC7F 1M1KH 3NMUC 5FLXM 1NJIH 1VQMF 5A2QM 2KG4A 1W3EX 3G6EF 1VQ5F 1QVGF 1XBIA 5EWRA 3RA5A 1E7KA 2VGMA 2FC3A
chains in the Genus database with same CATH superfamily
1K8AH 3J80M 1VK3A 2HRUA 4B5CA 2RHJA 1M90H 5LA6A 3IMPA 3F0GA 4FFBA 3D00A 1K73H 2KGWA 2JNBA 2LBTA 2V9YA 2KTVA 3F6MA 3E22B 4BVRA 3G71F 3MCQA 3N2GA 1XHOA 2UYNB 3ERNA 1KD1H 1W42A 2MQEA 3P4EA 2UYNA 3GYQA 1H48A 1RLGA 2AIFA 1RA4A 3JAWB 3JALA 1YITF 2BTUA 2YYEA 3PLAC 2R6R1 4M8IA 3F0DA 4NQ3A 1YJWF 2GZLA 3F0FA 3VYTC 1W5AA 3WPXA 4ZOLB 5J2TB 3R0PA 5HY0A 1GZ0A 5IJ0B 3S0YA 5MN5A 5GONB 1W41A 3S03A 1TUBB 4ZHYB 1GO0A 1IPAA 1X52A 3HAXD 5J2UB 5BMVB 1TUBA 3HTNA 3VOAA 1YIJF 2RHLA 5BMVA 1KQSF 4I4TB 4U3JB 4IHJA 1SA0A 5EB0A 4BT3A 3V7QA 3HKDB 4I4TA 2F9ZC 3HKBB 2RHHA 3IKFA 3JAKB 3CG6A 2QEXF 3TD3A 4PWTA 3VYSC 1ODEA 2Z1EA 3JAKA 3U0OA 3EORA 4O4HA 3C9SA 4C4WC 5LYJB 4TV8B 2VXYA 3J7AR 4X20B 4HNAB 2LCAA 1W55A 4O4LA 1VH8A 3Q8HA 1W2BF 2CHTA 4X20A 3RYHA 4HNAA 5LOVB 2PHNA 3ZP4A 1Q7YH 3HKCB 2DYYA 3LMEA 1FNJA 5HP7A 2HP0B 3I56F 3O85A 2HS0A 3WXMB 3JASB 2ZF8A 4X1KB 1M1KH 2RB9A 3MDOA 5A2QM 5C8YB 2KG4A 3ZOPA 4BVTA 2L26A 5ITZB 3RYFA 2Z1UA 3WPWA 1QVGF 1XBIA 5CB4A 4IIJB 3FD6A 4B46A 1J7HA 2FC3A 1U3PA 1FSZA 4IIJA 4WBNA 3CMAF 3CCRF 1H7MA 2HS3A 4X3MA 3M84A 3L7QA 4RHAA 4YJ3A 3KHNA 3HJWC 1Z5VA 3JCMM 1Q8RA 1VQKF 3LDTA 1VQOF 4ZHQA 3HKEB 1U3LA 5G4UC 3VMFB 1H47A 3ZO8A 3HKEA 3N2KB 1NQ3A 3CPWF 2ZAUA 3UT5A 1S72F 1VQ7F 1UFYA 3NK6A 2H8CA 4BVQA 1IV2A 5EYPA 4ZHWA 3N2KA 5KX5A 3WGKA 1SDSA 2HX0A 3CCSF 3CC4F 5HWEA 2UZHA 5LA6B 3LWOC 3NVIB 4FFBB 5EZYB 4BT2A 5MN6A 3OW2F 5FJ4C 4DRXB 3S02A 4XCQA 4X1YA 3LYBA 5EZYA 2BO1A 4DRXA 3QUWA 1Q81H 2B33A 3TD5A 3AGKA 2AMTA 1QVFF 2KTUA 5EAZA 3S06A 4YJ2A 3CCJF 3SIUA 3ELCA 3N2GB 2BTOA 5MN4A 1JFFB 5LP6C 1Q86H 3QHDA 1IV3A 3VOBA 4C8GA 3GTZA 1JFFA 2P6YA 4NUTA 4E6EA 3VTIC 1XRGA 3WGJA 2LBXA 3JALB 1W59A 3JARA 4BVSA 2RHOA 1JJ2F 2VAMA 4TZZA 1Q82H 3M1XA 1VQ8F 5HY2A 5JQGB 3RE3A 5JCOC 5LXTB 2BTQB 3V3TA 2IAFA 4I50B 5JQGA 1VQVA 3CYPB 2HQSC 3DC2A 5LXTA 1YQNA 3DDNA 4I50A 3CXCF 3CCUF 1COMA 4O4JB 1GO1A 3JAMM 3C8LA 3MCAB 4O4JA 3T80A 3CPQA 4G4XA 4RQOA 1X7PA 4IHJB 1SA0B 2QI2A 2CVLA 4TV9B 3CCQF 2R751 4C8EA 2CHSA 5IYZB 2CWJA 4TV9A 4LNUA 3WGLA 4BT6A 2ZODA 4O4HB 3CC7F 5IYZA 5FLXM 4X1IB 3MQWA 1W3EX 2I6RA 3WGNA 4X1IA 1U40A 1VQ5F 4O4LB 5JVDA 2VGMA 1TVKA 1QAHA 3RYHB 5GIOC 1XV2A 4BY9D 1U43A 2HP3A 1R1MA 1FNKA 3LWRC 5DCVA 2OTMA 2K1SA 1Z5WA 4X3LA 3LWQC 5EIBD 3RA6A 4BT7A 4C81A 2UYJA 2OTJF 1X7OA 4G4VA 3E1YA 2OHWA 3RYFB 4EI8A 5CB4B 1VQLF 1YJ9F 4G88A 1JD1A 2DT4A 5GIPC 3HWUA 1W5EA 1T0AA 4WBNB 4ZI7A 4O4IA 3TD4A 2OZBA 3MBMA 1FFXA 4YJ3B 2H6LA 5AVMA 4TUYB 3S0HA 4BT5A 1OAPA 4ZHQB 5HXUA 4TUYA 3RYIA 2H8EA 2QTPA 1VQ6F 3UT5B 3C9UA 2Z1FA 1RQ7A 2I6DA 5EYPB 4BW0B 5KX5B 1W5FA 4O2BB 3M4SA 1DT9A 3E20B 2EWCA 4O2BA 5G4VC 1QU9A 4O2AA 3C9TA 2ALEA 5GANK 4G4WA 1YGYA 4X1YB 2CZWA 4C82A 4F6RA 3K2XA 1N8RH 2GLZA 4ZHVA 3I55F 1CLIA 3I7TA 2YXZA 2PMPA 3JVHA 4YJ2B 5EIBC 3VYUC 5JH7B 5FNVA 1CK2A 3ON1A 1ZWZA 1W57A 3VI6A 2VAWA 5JH7A 4B45A 2HRYA 3GHZA 3OBYA 1YHQF 1KNKA 2VGNA 5GINC 1YJNF 3JARB 1KC8H 1SZQA 5CA0A 3KIZA 4DXDA 5CA1B 2HVYD 1T0KB 1W581 4G4YA 5CA1A 2FGYA 3CD6F 1VQ4F 2GVIA 4G4ZA 2NMUA 3CCVF 3IR9A 4U39A 3NVKE 2LBWA 3WJQA 3J81M 1VHAA 1IV4A 1VQMF 3CB2A 4EI7A 3ESJA 3E22A 2Q1XA 2N48A 3JATB 1E7KA 2ZOVA 4NWOB 2CSLA 1ONIA 3LFOA 3CCMF 5B8FA 3JATA 4LCKA 1IV1A 2Q1YA 3NK7A 3JAWA 3VIUA 3KJJA 1KNJA 1X25A 4LNUB 3S0WA 3SIVA 2HS4A 5EO3A 3WJPA 3G4SF 2VAPA 3F0EA 3P0ZA 5J2TA 4ZOLA 2OTLF 2WALA 3IEQA 3CMEF 1JN1A 5JVDB 5IJ0A 3K0TA 3N4ZA 5IT9M 1TVKB 3CC2F 1VQNF 1K9MH 3V4DA 2QA4F 5GONA 3ZP7A 3KE1A 5J2UA 3N4YA 1DBFA 5HP8A 4BT4A 1W40A 3VCZA 1VQ9F 3WJRA 3I3FA 3KJKA 5IJ9B 1CN7A 4U3JA 5KMGB 3FD5A 3D01A 4ERHA 5GAPK 1RQ2A 5LP6B 3FPIA 3HKDA 5IJ9A 3HKBA 3OBWA 5KMGA 4C8IA 2ZVZA 3PAFA 5LP6A 3D54A 1QD9A 3FFMA 5LYJA 4KWEA 4TV8A 5HY4A 4ZI7B 1OFUA 4ZK7A 4O4IB 3RYCB 1FFXB 2IG8A 3LWVC 3VO8A 3FBAA 2ZVYA 5LOVA 3RYCA 3HKCA 2HP0A 5HY1A 5JCOA 3RYIB 3BYQA 1VQPF 1PF5A 2Z01A 3JASA 1PXWA 3IKEA 1RLUA 2W8BC 4X1KA 3WGMA 1UI9A 2UYPA 3CYQA 5C8YA 5ITZA 1YI2F 4EB6B 1JY8A 3K12A 3V7EA 4O2AB 1GX1A 3P10A 3LWPC 3CCLF 4EB6A 3OONA 1W5BA 2IQQA 3K14A 4I55B 2G9IA 4R40B 4F6RB 3QTYA 4I55A 1NMUB 5FNVB 5EB1B 4B62A 2Z1TA 3CCEF 5HXZA 3NMUC 1NJIH 3IEWA 2UYKA 3B6NA 3C9RA 2AIZP 3G6EF 3RA5A 4EI9A 5CA0B 5EWRA 2CW4A
chains in the Genus database with same CATH topology
5GIOC 3LFOA 1K8AH 3CCMF 4BY9D 4LCKA 3J80M 3CMAF 3CCRF 1H7MA 4X3MA 3LWRC 1M90H 3NK7A 5DCVA 3HJWC 3JCMM 1VQKF 4X3LA 3SIVA 5EO3A 3D00A 1VQOF 3LWQC 3RA6A 1K73H 2OTJF 1X7OA 3G4SF 5G4UC 2JNBA 3VMFB 3E1YA 2OHWA 2KTVA 4EI8A 2OTLF 3CPWF 3G71F 2WALA 4BVRA 1S72F 1VQ7F 3CMEF 1VQLF 1YJ9F 3NK6A 3N4ZA 5IT9M 3CC2F 4BVQA 1KD1H 5GIPC 1K9MH 1VQNF 2QA4F 1W42A 1SDSA 3CCSF 3CC4F 3GYQA 1RLGA 5HWEA 2AIFA 2OZBA 1RA4A 3N4YA 3LWOC 3NVIB 1W40A 3OW2F 1VQ9F 5FJ4C 1YITF 4XCQA 5HXUA 3PLAC 1CN7A 5GAPK 2BO1A 1Q81H 4NQ3A 1YJWF 3AGKA 1VQ6F 3OBWA 1QVFF 2KTUA 3SIUA 3CCJF 5HY0A 3PAFA 1GZ0A 2I6DA 4BW0B 1Q86H 1DT9A 3E20B 3FFMA 1W41A 1GO0A 1IPAA 4NUTA 5HY4A 1X52A 3HAXD 2LBXA 5G4VC 3LWVC 4BVSA 1YIJF 2ALEA 1JJ2F 5GANK 1KQSF 4TZZA 1Q82H 5HY1A 1VQ8F 2CZWA 5HY2A 3V7QA 1N8RH 2F9ZC 2GLZA 1VQPF 3I55F 2QEXF 3CG6A 3V3TA 1CK2A 1PXWA 3ON1A 1ZWZA 3VI6A 3CXCF 3CCUF 4C4WC 3OBYA 1GO1A 1YI2F 3J7AR 3JAMM 1YHQF 3V7EA 3MCAB 2VGNA 5GINC 3LWPC 3CCLF 1YJNF 1W2BF 1KC8H 2HVYD 3CPQA 1T0KB 1Q7YH 1X7PA 3CD6F 2FGYA 1VQ4F 2QI2A 3CCVF 3I56F 3O85A 3CCQF 3IR9A 3WXMB 2LBWA 3NVKE 1NMUB 3J81M 3CCEF 3CC7F 1M1KH 5HXZA 3NMUC 5FLXM 1NJIH 1VQMF 5A2QM 2KG4A 4EI7A 1W3EX 4BVTA 3G6EF 1VQ5F 1QVGF 1XBIA 5EWRA 3RA5A 4EI9A 1E7KA 2VGMA 2FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIO C;  3LFO A;  1K8A H;  3CCM F;  4BY9 D;  4LCK A;  3J80 M;  3CMA F;  3CCR F;  1H7M A;  4X3M A;  3LWR C;  1M90 H;  3NK7 A;  5DCV A;  3HJW C;  3JCM M;  1VQK F;  4X3L A;  3SIV A;  5EO3 A;  1VQO F;  3LWQ C;  3RA6 A;  1K73 H;  2OTJ F;  1X7O A;  3G4S F;  5G4U C;  2JNB A;  3VMF B;  3E1Y A;  2OHW A;  2KTV A;  2OTL F;  3CPW F;  3G71 F;  2WAL A;  1S72 F;  1VQ7 F;  3CME F;  1VQL F;  1YJ9 F;  3NK6 A;  3N4Z A;  5IT9 M;  3CC2 F;  1KD1 H;  5GIP C;  1K9M H;  1VQN F;  2QA4 F;  1W42 A;  1SDS A;  3CCS F;  3CC4 F;  3GYQ A;  1RLG A;  2AIF A;  2OZB A;  1RA4 A;  3N4Y A;  3LWO C;  3NVI B;  1W40 A;  3OW2 F;  1VQ9 F;  5FJ4 C;  1YIT F;  3PLA C;  1CN7 A;  5GAP K;  2BO1 A;  1Q81 H;  1YJW F;  3AGK A;  1VQ6 F;  3OBW A;  1QVF F;  2KTU A;  3SIU A;  3CCJ F;  3PAF A;  1GZ0 A;  2I6D A;  4BW0 B;  1Q86 H;  1DT9 A;  3E20 B;  3FFM A;  1W41 A;  1GO0 A;  1IPA A;  4NUT A;  1X52 A;  3HAX D;  2LBX A;  5G4V C;  3LWV C;  1YIJ F;  2ALE A;  1JJ2 F;  5GAN K;  1KQS F;  4TZZ A;  1Q82 H;  1VQ8 F;  2CZW A;  3V7Q A;  1N8R H;  1VQP F;  3I55 F;  2QEX F;  3CG6 A;  1CK2 A;  1PXW A;  3ON1 A;  1ZWZ A;  3VI6 A;  3CXC F;  3CCU F;  4C4W C;  3OBY A;  1GO1 A;  1YI2 F;  3J7A R;  3JAM M;  1YHQ F;  3V7E A;  3MCA B;  2VGN A;  5GIN C;  3LWP C;  3CCL F;  1YJN F;  1W2B F;  1KC8 H;  2HVY D;  3CPQ A;  1T0K B;  1Q7Y H;  1X7P A;  3CD6 F;  1VQ4 F;  2QI2 A;  3CCV F;  3I56 F;  3O85 A;  3CCQ F;  3IR9 A;  3WXM B;  2LBW A;  3NVK E;  1NMU B;  3J81 M;  3CCE F;  3CC7 F;  1M1K H;  3NMU C;  5FLX M;  1NJI H;  1VQM F;  5A2Q M;  2KG4 A;  1W3E X;  3G6E F;  1VQ5 F;  1QVG F;  1XBI A;  5EWR A;  3RA5 A;  1E7K A;  2VGM A;  2FC3 A; 
#chains in the Genus database with same CATH topology
 1K8A H;  3J80 M;  1VK3 A;  2HRU A;  4B5C A;  2RHJ A;  1M90 H;  5LA6 A;  3IMP A;  3F0G A;  4FFB A;  3D00 A;  1K73 H;  2KGW A;  2JNB A;  2LBT A;  2V9Y A;  2KTV A;  3F6M A;  3E22 B;  4BVR A;  3G71 F;  3MCQ A;  3N2G A;  1XHO A;  2UYN B;  3ERN A;  1KD1 H;  1W42 A;  2MQE A;  3P4E A;  2UYN A;  3GYQ A;  1H48 A;  1RLG A;  2AIF A;  1RA4 A;  3JAW B;  3JAL A;  1YIT F;  2BTU A;  2YYE A;  3PLA C;  2R6R 1;  4M8I A;  3F0D A;  4NQ3 A;  1YJW F;  2GZL A;  3F0F A;  3VYT C;  1W5A A;  3WPX A;  4ZOL B;  5J2T B;  3R0P A;  5HY0 A;  1GZ0 A;  5IJ0 B;  3S0Y A;  5MN5 A;  5GON B;  1W41 A;  3S03 A;  1TUB B;  4ZHY B;  1GO0 A;  1IPA A;  1X52 A;  3HAX D;  5J2U B;  5BMV B;  1TUB A;  3HTN A;  3VOA A;  1YIJ F;  2RHL A;  5BMV A;  1KQS F;  4I4T B;  4U3J B;  4IHJ A;  1SA0 A;  5EB0 A;  4BT3 A;  3V7Q A;  3HKD B;  4I4T A;  2F9Z C;  3HKB B;  2RHH A;  3IKF A;  3JAK B;  3CG6 A;  2QEX F;  3TD3 A;  4PWT A;  3VYS C;  1ODE A;  2Z1E A;  3JAK A;  3U0O A;  3EOR A;  4O4H A;  3C9S A;  4C4W C;  5LYJ B;  4TV8 B;  2VXY A;  3J7A R;  4X20 B;  4HNA B;  2LCA A;  1W55 A;  4O4L A;  1VH8 A;  3Q8H A;  1W2B F;  2CHT A;  4X20 A;  3RYH A;  4HNA A;  5LOV B;  2PHN A;  3ZP4 A;  1Q7Y H;  3HKC B;  2DYY A;  3LME A;  1FNJ A;  5HP7 A;  2HP0 B;  3I56 F;  3O85 A;  2HS0 A;  3WXM B;  3JAS B;  2ZF8 A;  4X1K B;  1M1K H;  2RB9 A;  3MDO A;  5A2Q M;  5C8Y B;  2KG4 A;  3ZOP A;  4BVT A;  2L26 A;  5ITZ B;  3RYF A;  2Z1U A;  3WPW A;  1QVG F;  1XBI A;  5CB4 A;  4IIJ B;  3FD6 A;  4B46 A;  1J7H A;  2FC3 A;  1U3P A;  1FSZ A;  4IIJ A;  4WBN A;  3CMA F;  3CCR F;  1H7M A;  2HS3 A;  4X3M A;  3M84 A;  3L7Q A;  4RHA A;  4YJ3 A;  3KHN A;  3HJW C;  1Z5V A;  3JCM M;  1Q8R A;  1VQK F;  3LDT A;  1VQO F;  4ZHQ A;  3HKE B;  1U3L A;  5G4U C;  3VMF B;  1H47 A;  3ZO8 A;  3HKE A;  3N2K B;  1NQ3 A;  3CPW F;  2ZAU A;  3UT5 A;  1S72 F;  1VQ7 F;  1UFY A;  3NK6 A;  2H8C A;  4BVQ A;  1IV2 A;  5EYP A;  4ZHW A;  3N2K A;  5KX5 A;  3WGK A;  1SDS A;  2HX0 A;  3CCS F;  3CC4 F;  5HWE A;  2UZH A;  5LA6 B;  3LWO C;  3NVI B;  4FFB B;  5EZY B;  4BT2 A;  5MN6 A;  3OW2 F;  5FJ4 C;  4DRX B;  3S02 A;  4XCQ A;  4X1Y A;  3LYB A;  5EZY A;  2BO1 A;  4DRX A;  3QUW A;  1Q81 H;  2B33 A;  3TD5 A;  3AGK A;  2AMT A;  1QVF F;  2KTU A;  5EAZ A;  3S06 A;  4YJ2 A;  3CCJ F;  3SIU A;  3ELC A;  3N2G B;  2BTO A;  5MN4 A;  1JFF B;  5LP6 C;  1Q86 H;  3QHD A;  1IV3 A;  3VOB A;  4C8G A;  3GTZ A;  1JFF A;  2P6Y A;  4NUT A;  4E6E A;  3VTI C;  1XRG A;  3WGJ A;  2LBX A;  3JAL B;  1W59 A;  3JAR A;  4BVS A;  2RHO A;  1JJ2 F;  2VAM A;  4TZZ A;  1Q82 H;  3M1X A;  1VQ8 F;  5HY2 A;  5JQG B;  3RE3 A;  5JCO C;  5LXT B;  2BTQ B;  3V3T A;  2IAF A;  4I50 B;  5JQG A;  1VQV A;  3CYP B;  2HQS C;  3DC2 A;  5LXT A;  1YQN A;  3DDN A;  4I50 A;  3CXC F;  3CCU F;  1COM A;  4O4J B;  1GO1 A;  3JAM M;  3C8L A;  3MCA B;  4O4J A;  3T80 A;  3CPQ A;  4G4X A;  4RQO A;  1X7P A;  4IHJ B;  1SA0 B;  2QI2 A;  2CVL A;  4TV9 B;  3CCQ F;  2R75 1;  4C8E A;  2CHS A;  5IYZ B;  2CWJ A;  4TV9 A;  4LNU A;  3WGL A;  4BT6 A;  2ZOD A;  4O4H B;  3CC7 F;  5IYZ A;  5FLX M;  4X1I B;  3MQW A;  1W3E X;  2I6R A;  3WGN A;  4X1I A;  1U40 A;  1VQ5 F;  4O4L B;  5JVD A;  2VGM A;  1TVK A;  1QAH A;  3RYH B;  5GIO C;  1XV2 A;  4BY9 D;  1U43 A;  2HP3 A;  1R1M A;  1FNK A;  3LWR C;  5DCV A;  2OTM A;  2K1S A;  1Z5W A;  4X3L A;  3LWQ C;  5EIB D;  3RA6 A;  4BT7 A;  4C81 A;  2UYJ A;  2OTJ F;  1X7O A;  4G4V A;  3E1Y A;  2OHW A;  3RYF B;  4EI8 A;  5CB4 B;  1VQL F;  1YJ9 F;  4G88 A;  1JD1 A;  2DT4 A;  5GIP C;  3HWU A;  1W5E A;  1T0A A;  4WBN B;  4ZI7 A;  4O4I A;  3TD4 A;  2OZB A;  3MBM A;  1FFX A;  4YJ3 B;  2H6L A;  5AVM A;  4TUY B;  3S0H A;  4BT5 A;  1OAP A;  4ZHQ B;  5HXU A;  4TUY A;  3RYI A;  2H8E A;  2QTP A;  1VQ6 F;  3UT5 B;  3C9U A;  2Z1F A;  1RQ7 A;  2I6D A;  5EYP B;  4BW0 B;  5KX5 B;  1W5F A;  4O2B B;  3M4S A;  1DT9 A;  3E20 B;  2EWC A;  4O2B A;  5G4V C;  1QU9 A;  4O2A A;  3C9T A;  2ALE A;  5GAN K;  4G4W A;  1YGY A;  4X1Y B;  2CZW A;  4C82 A;  4F6R A;  3K2X A;  1N8R H;  2GLZ A;  4ZHV A;  3I55 F;  1CLI A;  3I7T A;  2YXZ A;  2PMP A;  3JVH A;  4YJ2 B;  5EIB C;  3VYU C;  5JH7 B;  5FNV A;  1CK2 A;  3ON1 A;  1ZWZ A;  1W57 A;  3VI6 A;  2VAW A;  5JH7 A;  4B45 A;  2HRY A;  3GHZ A;  3OBY A;  1YHQ F;  1KNK A;  2VGN A;  5GIN C;  1YJN F;  3JAR B;  1KC8 H;  1SZQ A;  5CA0 A;  3KIZ A;  4DXD A;  5CA1 B;  2HVY D;  1T0K B;  1W58 1;  4G4Y A;  5CA1 A;  2FGY A;  3CD6 F;  1VQ4 F;  2GVI A;  4G4Z A;  2NMU A;  3CCV F;  3IR9 A;  4U39 A;  3NVK E;  2LBW A;  3WJQ A;  3J81 M;  1VHA A;  1IV4 A;  1VQM F;  3CB2 A;  4EI7 A;  3ESJ A;  3E22 A;  2Q1X A;  2N48 A;  3JAT B;  1E7K A;  2ZOV A;  4NWO B;  2CSL A;  1ONI A;  3LFO A;  3CCM F;  5B8F A;  3JAT A;  4LCK A;  1IV1 A;  2Q1Y A;  3NK7 A;  3JAW A;  3VIU A;  3KJJ A;  1KNJ A;  1X25 A;  4LNU B;  3S0W A;  3SIV A;  2HS4 A;  5EO3 A;  3WJP A;  3G4S F;  2VAP A;  3F0E A;  3P0Z A;  5J2T A;  4ZOL A;  2OTL F;  2WAL A;  3IEQ A;  3CME F;  1JN1 A;  5JVD B;  5IJ0 A;  3K0T A;  3N4Z A;  5IT9 M;  1TVK B;  3CC2 F;  1VQN F;  1K9M H;  3V4D A;  2QA4 F;  5GON A;  3ZP7 A;  3KE1 A;  5J2U A;  3N4Y A;  1DBF A;  5HP8 A;  4BT4 A;  1W40 A;  3VCZ A;  1VQ9 F;  3WJR A;  3I3F A;  3KJK A;  5IJ9 B;  1CN7 A;  4U3J A;  5KMG B;  3FD5 A;  3D01 A;  4ERH A;  5GAP K;  1RQ2 A;  5LP6 B;  3FPI A;  3HKD A;  5IJ9 A;  3HKB A;  3OBW A;  5KMG A;  4C8I A;  2ZVZ A;  3PAF A;  5LP6 A;  3D54 A;  1QD9 A;  3FFM A;  5LYJ A;  4KWE A;  4TV8 A;  5HY4 A;  4ZI7 B;  1OFU A;  4ZK7 A;  4O4I B;  3RYC B;  1FFX B;  2IG8 A;  3LWV C;  3VO8 A;  3FBA A;  2ZVY A;  5LOV A;  3RYC A;  3HKC A;  2HP0 A;  5HY1 A;  5JCO A;  3RYI B;  3BYQ A;  1VQP F;  1PF5 A;  2Z01 A;  3JAS A;  1PXW A;  3IKE A;  1RLU A;  2W8B C;  4X1K A;  3WGM A;  1UI9 A;  2UYP A;  3CYQ A;  5C8Y A;  5ITZ A;  1YI2 F;  4EB6 B;  1JY8 A;  3K12 A;  3V7E A;  4O2A B;  1GX1 A;  3P10 A;  3LWP C;  3CCL F;  4EB6 A;  3OON A;  1W5B A;  2IQQ A;  3K14 A;  4I55 B;  2G9I A;  4R40 B;  4F6R B;  3QTY A;  4I55 A;  1NMU B;  5FNV B;  5EB1 B;  4B62 A;  2Z1T A;  3CCE F;  5HXZ A;  3NMU C;  1NJI H;  3IEW A;  2UYK A;  3B6N A;  3C9R A;  2AIZ P;  3G6E F;  3RA5 A;  4EI9 A;  5CA0 B;  5EWR A;  2CW4 A; 
#chains in the Genus database with same CATH homology
 5GIO C;  3LFO A;  1K8A H;  3CCM F;  4BY9 D;  4LCK A;  3J80 M;  3CMA F;  3CCR F;  1H7M A;  4X3M A;  3LWR C;  1M90 H;  3NK7 A;  5DCV A;  3HJW C;  3JCM M;  1VQK F;  4X3L A;  3SIV A;  5EO3 A;  3D00 A;  1VQO F;  3LWQ C;  3RA6 A;  1K73 H;  2OTJ F;  1X7O A;  3G4S F;  5G4U C;  2JNB A;  3VMF B;  3E1Y A;  2OHW A;  2KTV A;  4EI8 A;  2OTL F;  3CPW F;  3G71 F;  2WAL A;  4BVR A;  1S72 F;  1VQ7 F;  3CME F;  1VQL F;  1YJ9 F;  3NK6 A;  3N4Z A;  5IT9 M;  3CC2 F;  4BVQ A;  1KD1 H;  5GIP C;  1K9M H;  1VQN F;  2QA4 F;  1W42 A;  1SDS A;  3CCS F;  3CC4 F;  3GYQ A;  1RLG A;  5HWE A;  2AIF A;  2OZB A;  1RA4 A;  3N4Y A;  3LWO C;  3NVI B;  1W40 A;  3OW2 F;  1VQ9 F;  5FJ4 C;  1YIT F;  4XCQ A;  5HXU A;  3PLA C;  1CN7 A;  5GAP K;  2BO1 A;  1Q81 H;  4NQ3 A;  1YJW F;  3AGK A;  1VQ6 F;  3OBW A;  1QVF F;  2KTU A;  3SIU A;  3CCJ F;  5HY0 A;  3PAF A;  1GZ0 A;  2I6D A;  4BW0 B;  1Q86 H;  1DT9 A;  3E20 B;  3FFM A;  1W41 A;  1GO0 A;  1IPA A;  4NUT A;  5HY4 A;  1X52 A;  3HAX D;  2LBX A;  5G4V C;  3LWV C;  4BVS A;  1YIJ F;  2ALE A;  1JJ2 F;  5GAN K;  1KQS F;  4TZZ A;  1Q82 H;  5HY1 A;  1VQ8 F;  2CZW A;  5HY2 A;  3V7Q A;  1N8R H;  2F9Z C;  2GLZ A;  1VQP F;  3I55 F;  2QEX F;  3CG6 A;  3V3T A;  1CK2 A;  1PXW A;  3ON1 A;  1ZWZ A;  3VI6 A;  3CXC F;  3CCU F;  4C4W C;  3OBY A;  1GO1 A;  1YI2 F;  3J7A R;  3JAM M;  1YHQ F;  3V7E A;  3MCA B;  2VGN A;  5GIN C;  3LWP C;  3CCL F;  1YJN F;  1W2B F;  1KC8 H;  2HVY D;  3CPQ A;  1T0K B;  1Q7Y H;  1X7P A;  3CD6 F;  2FGY A;  1VQ4 F;  2QI2 A;  3CCV F;  3I56 F;  3O85 A;  3CCQ F;  3IR9 A;  3WXM B;  2LBW A;  3NVK E;  1NMU B;  3J81 M;  3CCE F;  3CC7 F;  1M1K H;  5HXZ A;  3NMU C;  5FLX M;  1NJI H;  1VQM F;  5A2Q M;  2KG4 A;  4EI7 A;  1W3E X;  4BVT A;  3G6E F;  1VQ5 F;  1QVG F;  1XBI A;  5EWR A;  3RA5 A;  4EI9 A;  1E7K A;  2VGM A;  2FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...