3LWQC

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwqC00
1DT9A 3CC2F 1VQPF 2QA4F 4C4WC 5GINC 3GYQA 5FJ4C 3JAMM 4BW0B 1S72F 3PAFA 3G71F 5GANK 2VGNA 3ON1A 5FLXM 3CPWF 2OTLF 2FC3A 3FFMA 1YJ9F 3VI6A 1QVGF 1NMUB 3PLAC 3J7AR 3IR9A 2OZBA 2QEXF 2VGMA 1VQ7F 1Q81H 3CCLF 3I55F 1CK2A 3E20B 2KG4A 1W3EX 3HAXD 3CCVF 2KTVA 1Q7YH 2BO1A 1ZWZA 2LBWA 5G4VC 4X3MA 3NVIB 1GO1A 2I6DA 5GIPC 3CCSF 2KTUA 1KD1H 1NJIH 3WXMB 1T0KB 5A2QM 2WALA 1YITF 1PXWA 3AGKA 3V7EA 1YJNF 3LWPC 1YHQF 2ALEA 3CCJF 3CMEF 4BY9D 3I56F 5GAPK 1VQ5F 4NUTA 3J80M 3SIVA 2HVYD 1YJWF 1Q86H 1KQSF 1K8AH 3NK6A 1K73H 2CZWA 1Q82H 1VQ4F 1X52A 3G4SF 1VQLF 1IPAA 3CC4F 3LFOA 1SDSA 1VQNF 3RA6A 3G6EF 2QI2A 3LWQC 5G4UC 3OBYA 3NK7A 1W2BF 3HJWC 1VQMF 1YIJF 3CMAF 3OW2F 5EO3A 3CCQF 3MCAB 3LWRC 3CCMF 1VQKF 3CXCF 3SIUA 3CD6F 3E1YA 3NVKE 1KC8H 1GZ0A 3LWOC 3OBWA 2LBXA 1X7OA 3CC7F 3CCEF 2JNBA 2OHWA 1N8RH 3N4YA 3V7QA 1VQOF 3NMUC 4LCKA 1VQ8F 4TZZA 1RA4A 3CG6A 5EWRA 3RA5A 3CPQA 3VMFB 3CCUF 5IT9M 1GO0A 1K9MH 1YI2F 1VQ6F 1QVFF 5GIOC 1E7KA 1RLGA 1H7MA 3J81M 1M1KH 1CN7A 3CCRF 1JJ2F 2OTJF 1W41A 3O85A 1X7PA 1W42A 1XBIA 1M90H 1W40A 2AIFA 3LWVC 1VQ9F 3N4ZA 4X3LA 3JCMM 5DCVA
chains in the Genus database with same CATH superfamily
3LMEA 1VQPF 2QA4F 3IEWA 2ZODA 3JAMM 1TVKA 4EB6B 4BVSA 3G71F 3VO8A 4ZOLA 3OONA 3PLAC 3S06A 4NWOB 2OZBA 2VGMA 1FSZA 4BVTA 1Q81H 1U43A 3JALB 1JD1A 4O4LB 1CK2A 2CSLA 1U40A 1ZWZA 1FNKA 2LBWA 4X3MA 3K14A 1GO1A 2I6DA 4ZHVA 3TD4A 1KD1H 1NJIH 3QHDA 3KJKA 1T0KB 3RYHA 1NQ3A 4YJ2A 2P6YA 3S03A 2F9ZC 3I3FA 2PHNA 3K2XA 1W5EA 3LYBA 4DRXA 3WGKA 5J2UA 3CMEF 5GAPK 2CWJA 3BYQA 3R0PA 4LNUB 3JATB 4BVRA 3J80M 4I55A 5J2TA 1W5FA 3WJRA 3WJPA 4ZI7A 5GONA 1X52A 2H8EA 3WPXA 5MN4A 2H8CA 1IPAA 4FFBB 3HKBA 3LFOA 1KNKA 1R1MA 1W5BA 4YJ3B 4C8EA 2CHSA 4IHJB 3LWQC 1XRGA 3C9UA 3NK7A 1W581 1VQMF 2HS4A 4X20B 5EO3A 3CCQF 3CCMF 1VQKF 3CXCF 4TV9A 2YXZA 4C82A 3S02A 5C8YB 3KE1A 3M4SA 5LP6A 1RQ2A 3HKDA 3JAWB 4O4IA 4BT4A 2Z1TA 4F6RB 3T80A 3C9TA 4TZZA 3CG6A 3QTYA 1W55A 1T0AA 5EWRA 2V9YA 2Z1EA 3N2GA 4X1KB 3CYQA 2B33A 3C8LA 4O2BB 3P0ZA 4I4TB 5LOVA 1RLGA 3QUWA 3WGMA 5BMVB 5CA0A 2GVIA 5LA6A 3ESJA 1RLUA 1SA0A 3HKCA 1JFFB 5CB4A 1ONIA 1M90H 2AIFA 1QD9A 2VAWA 4X1IA 3JCMM 4C81A 2PMPA 2QTPA 5CA0B 3CC2F 2ZVYA 3N2KA 3GYQA 2NMUA 5FJ4C 3S0WA 5EZYA 4KWEA 5GANK 2VGNA 3ON1A 3CPWF 4NQ3A 3JAKA 5EIBD 4ZHQA 4WBNB 2Z1FA 4IIJA 4X1YB 1TUBA 2RHOA 2BTOA 3UT5A 2KG4A 1W3EX 3HAXD 2RHLA 4BT6A 3E22A 4HNAB 3ZO8A 5G4VC 3IEQA 5JCOA 5EYPB 2HP3A 1IV3A 3CCSF 2Q1XA 4IIJB 4RHAA 3WXMB 4EI7A 5IYZB 3AGKA 3P10A 2VAPA 3LWPC 1YHQF 1XV2A 4O4HA 4M8IA 3CCJF 4ZHWA 1VQ5F 4U3JA 4NUTA 3V3TA 5FNVB 5CA1B 3JASB 2GLZA 1TVKB 2VAMA 3ERNA 4O4HB 5HP7A 4ZOLB 1KQSF 3NK6A 2CZWA 1VQ4F 5MN5A 2W8BC 5AVMA 2I6RA 3VCZA 2HRUA 4B5CA 5EAZA 3K12A 1DBFA 4U39A 5JQGA 2BTUA 2UYPA 3CYPB 4TUYA 5LP6C 4B45A 3RYHB 5MN6A 5IJ0A 3OW2F 3IKFA 2RB9A 4YJ2B 1UI9A 1GZ0A 3U0OA 3LWOC 3OBWA 1W5AA 4G4VA 3ZP4A 2HS3A 4TV8A 5J2UB 4DRXB 1VH8A 3HKEA 3V4DA 3KJJA 1N8RH 3NMUC 1VQOF 3JVHA 4BT7A 2IG8A 5LYJA 2HS0A 5EB1B 1RA4A 2CHTA 5HY0A 3CPQA 5IJ9A 4I55B 5J2TB 2EWCA 5IT9M 5LXTA 1GO0A 3VOBA 3C9SA 4ZI7B 5GONB 3DDNA 4G88A 3J81M 1PF5A 3CCRF 4G4YA 3HKBB 2OTJF 1W41A 3IKEA 1X7PA 1IV2A 5KMGA 1H48A 2N48A 1DT9A 4O2AA 2IAFA 3D01A 3JARA 3ZP7A 4PWTA 4TV9B 2FC3A 3FFMA 5B8FA 5JCOC 4ZHYB 4I50A 3M1XA 3J7AR 5LP6B 1VQ7F 2Q1YA 2HX0A 3HKDB 3CCLF 2CW4A 4O4IB 3I55F 3E20B 1QAHA 2Z1UA 3MBMA 2KTVA 1Q7YH 3RYIA 5ITZA 3NVIB 3N2GB 3WGLA 4O4JA 1IV4A 2FGYA 2BTQB 5HY4A 1Z5WA 3Q8HA 5HP8A 5JH7A 5LOVB 1KNJA 2L26A 5A2QM 2WALA 5HXZA 1PXWA 4EI9A 5JVDA 5LA6B 3HKCB 1SA0B 3V7EA 3WJQA 3FD6A 4ERHA 5CB4B 1YJNF 2UYNA 3RYFA 2ALEA 1VK3A 2ZAUA 3FD5A 3I56F 4B46A 4EI8A 5JH7B 3ELCA 4X1IB 3FPIA 1XHOA 2HQSC 2HRYA 3SIVA 2HVYD 3N2KB 3K0TA 3S0YA 5EZYB 1YJWF 2R6R1 2HP0A 3MCQA 5HY2A 3JAKB 4ZHQB 5HWEA 2KGWA 1TUBB 3G4SF 1VQLF 3D54A 3CC4F 3KHNA 1YGYA 2K1SA 3VYSC 1SDSA 3UT5B 1VQNF 3RA6A 3E22B 1FNJA 3G6EF 1FFXA 1W59A 3P4EA 5KX5A 3GHZA 3OBYA 1W2BF 3HJWC 3ZOPA 4EB6A 3MCAB 3SIUA 3CD6F 3E1YA 1U3PA 1X7OA 1X25A 3JALA 2JNBA 4U3JB 2H6LA 4O4LA 1RQ7A 3V7QA 4LCKA 1VQ8F 1VQVA 4C8IA 3RA5A 3VMFB 3HTNA 3CCUF 3MQWA 3F0GA 1VQ6F 1U3LA 5GIOC 1E7KA 2RHJA 4BT3A 1H7MA 3EORA 3WPWA 2ZF8A 1JJ2F 3GTZA 3KIZA 3VOAA 5JQGB 3O85A 1W42A 1XBIA 2IQQA 2ZVZA 1IV1A 3MDOA 4TUYB 4X3LA 2ZOVA 5DCVA 3D00A 4LNUA 3JATA 4RQOA 2RHHA 4C4WC 5GINC 5IJ0B 4BW0B 3I7TA 1S72F 3PAFA 2OTLF 4G4WA 5FLXM 1YJ9F 3VI6A 3IMPA 1QVGF 1NMUB 5HXUA 3F6MA 3IR9A 3RYCA 1VHAA 4TV8B 1JY8A 4FFBA 3HKEB 2QEXF 1SZQA 2DT4A 3F0EA 3F0DA 4YJ3A 3CCVF 5LYJB 2BO1A 4IHJA 2MQEA 4B62A 5IJ9B 3F0FA 3L7QA 5LXTB 5GIPC 2LBTA 2KTUA 2UYKA 1QU9A 3TD5A 3RYCB 4X20A 1YITF 2UZHA 2R751 3DC2A 5EB0A 3VTIC 1OFUA 3VYTC 5C8YA 3RE3A 4E6EA 4BY9D 2LCAA 1GX1A 2AIZP 3JAWA 1COMA 4F6RA 5KMGB 2VXYA 2G9IA 2UYJA 4O2AB 2AMTA 2GZLA 2DYYA 4X1KA 4C8GA 1Q8RA 3JARB 1Q86H 5EIBC 1K8AH 4O2BA 4I4TA 4BVQA 1K73H 3S0HA 1Q82H 5BMVA 1UFYA 4G4XA 4I50B 1W57A 4XCQA 3FBAA 1ODEA 1JFFA 1JN1A 3RYIB 3M84A 4BT5A 5ITZB 2QI2A 4BT2A 5G4UC 4O4JB 3WGNA 1YIJF 3CMAF 1YQNA 4ZK7A 3LWRC 5JVDB 3C9RA 3NVKE 1KC8H 4WBNA 1Z5VA 2UYNB 4X1YA 3HWUA 3RYFB 2LBXA 3CC7F 3WGJA 3CCEF 4G4ZA 2OHWA 1H47A 3N4YA 1OAPA 4HNAA 3B6NA 5EYPA 5HY1A 2Z01A 1K9MH 1YI2F 2HP0B 1QVFF 2OTMA 4R40B 2CVLA 3LDTA 5IYZA 1M1KH 2YYEA 3TD3A 1CN7A 3VYUC 1J7HA 3VIUA 1W40A 3LWVC 1VQ9F 1FFXB 1CLIA 3N4ZA 5KX5B 3CB2A 5FNVA 5CA1A 4DXDA 3JASA
chains in the Genus database with same CATH topology
1DT9A 3CC2F 1VQPF 2QA4F 4C4WC 5GINC 3GYQA 5FJ4C 3JAMM 4BW0B 1S72F 4BVSA 3PAFA 3G71F 5GANK 2VGNA 3ON1A 5FLXM 3CPWF 2OTLF 4NQ3A 2FC3A 3FFMA 1YJ9F 3VI6A 1QVGF 1NMUB 3PLAC 5HXUA 3IR9A 2OZBA 2QEXF 2VGMA 3J7AR 4BVTA 1VQ7F 1Q81H 3CCLF 3I55F 1CK2A 3E20B 2KG4A 1W3EX 3HAXD 3CCVF 2KTVA 1Q7YH 2BO1A 1ZWZA 2LBWA 5G4VC 4X3MA 3NVIB 1GO1A 2I6DA 5GIPC 3CCSF 2FGYA 2KTUA 5HY4A 1KD1H 1NJIH 3WXMB 1T0KB 5A2QM 4EI7A 2WALA 5HXZA 1YITF 1PXWA 3AGKA 4EI9A 2F9ZC 3V7EA 1YJNF 3LWPC 1YHQF 2ALEA 3CCJF 3CMEF 4BY9D 3I56F 4EI8A 5GAPK 1VQ5F 4NUTA 3V3TA 3J80M 4BVRA 3SIVA 2HVYD 2GLZA 1YJWF 1Q86H 1KQSF 5HY2A 1K8AH 4BVQA 3NK6A 1K73H 2CZWA 1Q82H 1VQ4F 1X52A 5HWEA 4XCQA 3G4SF 1VQLF 1IPAA 3CC4F 3LFOA 1SDSA 1VQNF 3RA6A 3G6EF 2QI2A 3LWQC 5G4UC 3OBYA 3NK7A 1W2BF 3HJWC 1VQMF 1YIJF 3CMAF 3OW2F 5EO3A 3CCQF 3MCAB 3LWRC 3CCMF 1VQKF 3CXCF 3SIUA 3CD6F 3E1YA 3NVKE 1KC8H 1GZ0A 3LWOC 3OBWA 2LBXA 1X7OA 3CC7F 3CCEF 2JNBA 2OHWA 1N8RH 3N4YA 3V7QA 1VQOF 3NMUC 4LCKA 1VQ8F 4TZZA 1RA4A 3CG6A 5EWRA 3RA5A 3CPQA 5HY0A 5HY1A 3VMFB 3CCUF 5IT9M 1GO0A 1K9MH 1YI2F 1VQ6F 1QVFF 5GIOC 1E7KA 1RLGA 1H7MA 3J81M 1M1KH 1CN7A 3CCRF 1JJ2F 2OTJF 1W41A 3O85A 1X7PA 1W42A 1XBIA 1M90H 1W40A 2AIFA 3LWVC 1VQ9F 3N4ZA 4X3LA 3JCMM 5DCVA 3D00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT9 A;  3CC2 F;  1VQP F;  2QA4 F;  4C4W C;  5GIN C;  3GYQ A;  5FJ4 C;  3JAM M;  4BW0 B;  1S72 F;  3PAF A;  3G71 F;  5GAN K;  2VGN A;  3ON1 A;  5FLX M;  3CPW F;  2OTL F;  2FC3 A;  3FFM A;  1YJ9 F;  3VI6 A;  1QVG F;  1NMU B;  3PLA C;  3J7A R;  3IR9 A;  2OZB A;  2QEX F;  2VGM A;  1VQ7 F;  1Q81 H;  3CCL F;  3I55 F;  1CK2 A;  3E20 B;  2KG4 A;  1W3E X;  3HAX D;  3CCV F;  2KTV A;  1Q7Y H;  2BO1 A;  1ZWZ A;  2LBW A;  5G4V C;  4X3M A;  3NVI B;  1GO1 A;  2I6D A;  5GIP C;  3CCS F;  2KTU A;  1KD1 H;  1NJI H;  3WXM B;  1T0K B;  5A2Q M;  2WAL A;  1YIT F;  1PXW A;  3AGK A;  3V7E A;  1YJN F;  3LWP C;  1YHQ F;  2ALE A;  3CCJ F;  3CME F;  4BY9 D;  3I56 F;  5GAP K;  1VQ5 F;  4NUT A;  3J80 M;  3SIV A;  2HVY D;  1YJW F;  1Q86 H;  1KQS F;  1K8A H;  3NK6 A;  1K73 H;  2CZW A;  1Q82 H;  1VQ4 F;  1X52 A;  3G4S F;  1VQL F;  1IPA A;  3CC4 F;  3LFO A;  1SDS A;  1VQN F;  3RA6 A;  3G6E F;  2QI2 A;  3LWQ C;  5G4U C;  3OBY A;  3NK7 A;  1W2B F;  3HJW C;  1VQM F;  1YIJ F;  3CMA F;  3OW2 F;  5EO3 A;  3CCQ F;  3MCA B;  3LWR C;  3CCM F;  1VQK F;  3CXC F;  3SIU A;  3CD6 F;  3E1Y A;  3NVK E;  1KC8 H;  1GZ0 A;  3LWO C;  3OBW A;  2LBX A;  1X7O A;  3CC7 F;  3CCE F;  2JNB A;  2OHW A;  1N8R H;  3N4Y A;  3V7Q A;  1VQO F;  3NMU C;  4LCK A;  1VQ8 F;  4TZZ A;  1RA4 A;  3CG6 A;  5EWR A;  3RA5 A;  3CPQ A;  3VMF B;  3CCU F;  5IT9 M;  1GO0 A;  1K9M H;  1YI2 F;  1VQ6 F;  1QVF F;  5GIO C;  1E7K A;  1RLG A;  1H7M A;  3J81 M;  1M1K H;  1CN7 A;  3CCR F;  1JJ2 F;  2OTJ F;  1W41 A;  3O85 A;  1X7P A;  1W42 A;  1XBI A;  1M90 H;  1W40 A;  2AIF A;  3LWV C;  1VQ9 F;  3N4Z A;  4X3L A;  3JCM M;  5DCV A; 
#chains in the Genus database with same CATH topology
 3LME A;  1VQP F;  2QA4 F;  3IEW A;  2ZOD A;  3JAM M;  1TVK A;  4EB6 B;  4BVS A;  3G71 F;  3VO8 A;  4ZOL A;  3OON A;  3PLA C;  3S06 A;  4NWO B;  2OZB A;  2VGM A;  1FSZ A;  4BVT A;  1Q81 H;  1U43 A;  3JAL B;  1JD1 A;  4O4L B;  1CK2 A;  2CSL A;  1U40 A;  1ZWZ A;  1FNK A;  2LBW A;  4X3M A;  3K14 A;  1GO1 A;  2I6D A;  4ZHV A;  3TD4 A;  1KD1 H;  1NJI H;  3QHD A;  3KJK A;  1T0K B;  3RYH A;  1NQ3 A;  4YJ2 A;  2P6Y A;  3S03 A;  2F9Z C;  3I3F A;  2PHN A;  3K2X A;  1W5E A;  3LYB A;  4DRX A;  3WGK A;  5J2U A;  3CME F;  5GAP K;  2CWJ A;  3BYQ A;  3R0P A;  4LNU B;  3JAT B;  4BVR A;  3J80 M;  4I55 A;  5J2T A;  1W5F A;  3WJR A;  3WJP A;  4ZI7 A;  5GON A;  1X52 A;  2H8E A;  3WPX A;  5MN4 A;  2H8C A;  1IPA A;  4FFB B;  3HKB A;  3LFO A;  1KNK A;  1R1M A;  1W5B A;  4YJ3 B;  4C8E A;  2CHS A;  4IHJ B;  3LWQ C;  1XRG A;  3C9U A;  3NK7 A;  1W58 1;  1VQM F;  2HS4 A;  4X20 B;  5EO3 A;  3CCQ F;  3CCM F;  1VQK F;  3CXC F;  4TV9 A;  2YXZ A;  4C82 A;  3S02 A;  5C8Y B;  3KE1 A;  3M4S A;  5LP6 A;  1RQ2 A;  3HKD A;  3JAW B;  4O4I A;  4BT4 A;  2Z1T A;  4F6R B;  3T80 A;  3C9T A;  4TZZ A;  3CG6 A;  3QTY A;  1W55 A;  1T0A A;  5EWR A;  2V9Y A;  2Z1E A;  3N2G A;  4X1K B;  3CYQ A;  2B33 A;  3C8L A;  4O2B B;  3P0Z A;  4I4T B;  5LOV A;  1RLG A;  3QUW A;  3WGM A;  5BMV B;  5CA0 A;  2GVI A;  5LA6 A;  3ESJ A;  1RLU A;  1SA0 A;  3HKC A;  1JFF B;  5CB4 A;  1ONI A;  1M90 H;  2AIF A;  1QD9 A;  2VAW A;  4X1I A;  3JCM M;  4C81 A;  2PMP A;  2QTP A;  5CA0 B;  3CC2 F;  2ZVY A;  3N2K A;  3GYQ A;  2NMU A;  5FJ4 C;  3S0W A;  5EZY A;  4KWE A;  5GAN K;  2VGN A;  3ON1 A;  3CPW F;  4NQ3 A;  3JAK A;  5EIB D;  4ZHQ A;  4WBN B;  2Z1F A;  4IIJ A;  4X1Y B;  1TUB A;  2RHO A;  2BTO A;  3UT5 A;  2KG4 A;  1W3E X;  3HAX D;  2RHL A;  4BT6 A;  3E22 A;  4HNA B;  3ZO8 A;  5G4V C;  3IEQ A;  5JCO A;  5EYP B;  2HP3 A;  1IV3 A;  3CCS F;  2Q1X A;  4IIJ B;  4RHA A;  3WXM B;  4EI7 A;  5IYZ B;  3AGK A;  3P10 A;  2VAP A;  3LWP C;  1YHQ F;  1XV2 A;  4O4H A;  4M8I A;  3CCJ F;  4ZHW A;  1VQ5 F;  4U3J A;  4NUT A;  3V3T A;  5FNV B;  5CA1 B;  3JAS B;  2GLZ A;  1TVK B;  2VAM A;  3ERN A;  4O4H B;  5HP7 A;  4ZOL B;  1KQS F;  3NK6 A;  2CZW A;  1VQ4 F;  5MN5 A;  2W8B C;  5AVM A;  2I6R A;  3VCZ A;  2HRU A;  4B5C A;  5EAZ A;  3K12 A;  1DBF A;  4U39 A;  5JQG A;  2BTU A;  2UYP A;  3CYP B;  4TUY A;  5LP6 C;  4B45 A;  3RYH B;  5MN6 A;  5IJ0 A;  3OW2 F;  3IKF A;  2RB9 A;  4YJ2 B;  1UI9 A;  1GZ0 A;  3U0O A;  3LWO C;  3OBW A;  1W5A A;  4G4V A;  3ZP4 A;  2HS3 A;  4TV8 A;  5J2U B;  4DRX B;  1VH8 A;  3HKE A;  3V4D A;  3KJJ A;  1N8R H;  3NMU C;  1VQO F;  3JVH A;  4BT7 A;  2IG8 A;  5LYJ A;  2HS0 A;  5EB1 B;  1RA4 A;  2CHT A;  5HY0 A;  3CPQ A;  5IJ9 A;  4I55 B;  5J2T B;  2EWC A;  5IT9 M;  5LXT A;  1GO0 A;  3VOB A;  3C9S A;  4ZI7 B;  5GON B;  3DDN A;  4G88 A;  3J81 M;  1PF5 A;  3CCR F;  4G4Y A;  3HKB B;  2OTJ F;  1W41 A;  3IKE A;  1X7P A;  1IV2 A;  5KMG A;  1H48 A;  2N48 A;  1DT9 A;  4O2A A;  2IAF A;  3D01 A;  3JAR A;  3ZP7 A;  4PWT A;  4TV9 B;  2FC3 A;  3FFM A;  5B8F A;  5JCO C;  4ZHY B;  4I50 A;  3M1X A;  3J7A R;  5LP6 B;  1VQ7 F;  2Q1Y A;  2HX0 A;  3HKD B;  3CCL F;  2CW4 A;  4O4I B;  3I55 F;  3E20 B;  1QAH A;  2Z1U A;  3MBM A;  2KTV A;  1Q7Y H;  3RYI A;  5ITZ A;  3NVI B;  3N2G B;  3WGL A;  4O4J A;  1IV4 A;  2FGY A;  2BTQ B;  5HY4 A;  1Z5W A;  3Q8H A;  5HP8 A;  5JH7 A;  5LOV B;  1KNJ A;  2L26 A;  5A2Q M;  2WAL A;  5HXZ A;  1PXW A;  4EI9 A;  5JVD A;  5LA6 B;  3HKC B;  1SA0 B;  3V7E A;  3WJQ A;  3FD6 A;  4ERH A;  5CB4 B;  1YJN F;  2UYN A;  3RYF A;  2ALE A;  1VK3 A;  2ZAU A;  3FD5 A;  3I56 F;  4B46 A;  4EI8 A;  5JH7 B;  3ELC A;  4X1I B;  3FPI A;  1XHO A;  2HQS C;  2HRY A;  3SIV A;  2HVY D;  3N2K B;  3K0T A;  3S0Y A;  5EZY B;  1YJW F;  2R6R 1;  2HP0 A;  3MCQ A;  5HY2 A;  3JAK B;  4ZHQ B;  5HWE A;  2KGW A;  1TUB B;  3G4S F;  1VQL F;  3D54 A;  3CC4 F;  3KHN A;  1YGY A;  2K1S A;  3VYS C;  1SDS A;  3UT5 B;  1VQN F;  3RA6 A;  3E22 B;  1FNJ A;  3G6E F;  1FFX A;  1W59 A;  3P4E A;  5KX5 A;  3GHZ A;  3OBY A;  1W2B F;  3HJW C;  3ZOP A;  4EB6 A;  3MCA B;  3SIU A;  3CD6 F;  3E1Y A;  1U3P A;  1X7O A;  1X25 A;  3JAL A;  2JNB A;  4U3J B;  2H6L A;  4O4L A;  1RQ7 A;  3V7Q A;  4LCK A;  1VQ8 F;  1VQV A;  4C8I A;  3RA5 A;  3VMF B;  3HTN A;  3CCU F;  3MQW A;  3F0G A;  1VQ6 F;  1U3L A;  5GIO C;  1E7K A;  2RHJ A;  4BT3 A;  1H7M A;  3EOR A;  3WPW A;  2ZF8 A;  1JJ2 F;  3GTZ A;  3KIZ A;  3VOA A;  5JQG B;  3O85 A;  1W42 A;  1XBI A;  2IQQ A;  2ZVZ A;  1IV1 A;  3MDO A;  4TUY B;  4X3L A;  2ZOV A;  5DCV A;  3D00 A;  4LNU A;  3JAT A;  4RQO A;  2RHH A;  4C4W C;  5GIN C;  5IJ0 B;  4BW0 B;  3I7T A;  1S72 F;  3PAF A;  2OTL F;  4G4W A;  5FLX M;  1YJ9 F;  3VI6 A;  3IMP A;  1QVG F;  1NMU B;  5HXU A;  3F6M A;  3IR9 A;  3RYC A;  1VHA A;  4TV8 B;  1JY8 A;  4FFB A;  3HKE B;  2QEX F;  1SZQ A;  2DT4 A;  3F0E A;  3F0D A;  4YJ3 A;  3CCV F;  5LYJ B;  2BO1 A;  4IHJ A;  2MQE A;  4B62 A;  5IJ9 B;  3F0F A;  3L7Q A;  5LXT B;  5GIP C;  2LBT A;  2KTU A;  2UYK A;  1QU9 A;  3TD5 A;  3RYC B;  4X20 A;  1YIT F;  2UZH A;  2R75 1;  3DC2 A;  5EB0 A;  3VTI C;  1OFU A;  3VYT C;  5C8Y A;  3RE3 A;  4E6E A;  4BY9 D;  2LCA A;  1GX1 A;  2AIZ P;  3JAW A;  1COM A;  4F6R A;  5KMG B;  2VXY A;  2G9I A;  2UYJ A;  4O2A B;  2AMT A;  2GZL A;  2DYY A;  4X1K A;  4C8G A;  1Q8R A;  3JAR B;  1Q86 H;  5EIB C;  1K8A H;  4O2B A;  4I4T A;  4BVQ A;  1K73 H;  3S0H A;  1Q82 H;  5BMV A;  1UFY A;  4G4X A;  4I50 B;  1W57 A;  4XCQ A;  3FBA A;  1ODE A;  1JFF A;  1JN1 A;  3RYI B;  3M84 A;  4BT5 A;  5ITZ B;  2QI2 A;  4BT2 A;  5G4U C;  4O4J B;  3WGN A;  1YIJ F;  3CMA F;  1YQN A;  4ZK7 A;  3LWR C;  5JVD B;  3C9R A;  3NVK E;  1KC8 H;  4WBN A;  1Z5V A;  2UYN B;  4X1Y A;  3HWU A;  3RYF B;  2LBX A;  3CC7 F;  3WGJ A;  3CCE F;  4G4Z A;  2OHW A;  1H47 A;  3N4Y A;  1OAP A;  4HNA A;  3B6N A;  5EYP A;  5HY1 A;  2Z01 A;  1K9M H;  1YI2 F;  2HP0 B;  1QVF F;  2OTM A;  4R40 B;  2CVL A;  3LDT A;  5IYZ A;  1M1K H;  2YYE A;  3TD3 A;  1CN7 A;  3VYU C;  1J7H A;  3VIU A;  1W40 A;  3LWV C;  1VQ9 F;  1FFX B;  1CLI A;  3N4Z A;  5KX5 B;  3CB2 A;  5FNV A;  5CA1 A;  4DXD A;  3JAS A; 
#chains in the Genus database with same CATH homology
 1DT9 A;  3CC2 F;  1VQP F;  2QA4 F;  4C4W C;  5GIN C;  3GYQ A;  5FJ4 C;  3JAM M;  4BW0 B;  1S72 F;  4BVS A;  3PAF A;  3G71 F;  5GAN K;  2VGN A;  3ON1 A;  5FLX M;  3CPW F;  2OTL F;  4NQ3 A;  2FC3 A;  3FFM A;  1YJ9 F;  3VI6 A;  1QVG F;  1NMU B;  3PLA C;  5HXU A;  3IR9 A;  2OZB A;  2QEX F;  2VGM A;  3J7A R;  4BVT A;  1VQ7 F;  1Q81 H;  3CCL F;  3I55 F;  1CK2 A;  3E20 B;  2KG4 A;  1W3E X;  3HAX D;  3CCV F;  2KTV A;  1Q7Y H;  2BO1 A;  1ZWZ A;  2LBW A;  5G4V C;  4X3M A;  3NVI B;  1GO1 A;  2I6D A;  5GIP C;  3CCS F;  2FGY A;  2KTU A;  5HY4 A;  1KD1 H;  1NJI H;  3WXM B;  1T0K B;  5A2Q M;  4EI7 A;  2WAL A;  5HXZ A;  1YIT F;  1PXW A;  3AGK A;  4EI9 A;  2F9Z C;  3V7E A;  1YJN F;  3LWP C;  1YHQ F;  2ALE A;  3CCJ F;  3CME F;  4BY9 D;  3I56 F;  4EI8 A;  5GAP K;  1VQ5 F;  4NUT A;  3V3T A;  3J80 M;  4BVR A;  3SIV A;  2HVY D;  2GLZ A;  1YJW F;  1Q86 H;  1KQS F;  5HY2 A;  1K8A H;  4BVQ A;  3NK6 A;  1K73 H;  2CZW A;  1Q82 H;  1VQ4 F;  1X52 A;  5HWE A;  4XCQ A;  3G4S F;  1VQL F;  1IPA A;  3CC4 F;  3LFO A;  1SDS A;  1VQN F;  3RA6 A;  3G6E F;  2QI2 A;  3LWQ C;  5G4U C;  3OBY A;  3NK7 A;  1W2B F;  3HJW C;  1VQM F;  1YIJ F;  3CMA F;  3OW2 F;  5EO3 A;  3CCQ F;  3MCA B;  3LWR C;  3CCM F;  1VQK F;  3CXC F;  3SIU A;  3CD6 F;  3E1Y A;  3NVK E;  1KC8 H;  1GZ0 A;  3LWO C;  3OBW A;  2LBX A;  1X7O A;  3CC7 F;  3CCE F;  2JNB A;  2OHW A;  1N8R H;  3N4Y A;  3V7Q A;  1VQO F;  3NMU C;  4LCK A;  1VQ8 F;  4TZZ A;  1RA4 A;  3CG6 A;  5EWR A;  3RA5 A;  3CPQ A;  5HY0 A;  5HY1 A;  3VMF B;  3CCU F;  5IT9 M;  1GO0 A;  1K9M H;  1YI2 F;  1VQ6 F;  1QVF F;  5GIO C;  1E7K A;  1RLG A;  1H7M A;  3J81 M;  1M1K H;  1CN7 A;  3CCR F;  1JJ2 F;  2OTJ F;  1W41 A;  3O85 A;  1X7P A;  1W42 A;  1XBI A;  1M90 H;  1W40 A;  2AIF A;  3LWV C;  1VQ9 F;  3N4Z A;  4X3L A;  3JCM M;  5DCV A;  3D00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...