3LWQC

Structure of h/aca rnp bound to a substrate rna containing 3mu
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwqC00
1X52A 1RA4A 3GYQA 1KD1H 1K8AH 2KTUA 5GINC 3OBWA 1Q81H 1Q82H 4X3LA 4BY9D 1VQ4F 1PXWA 1S72F 1VQNF 3OW2F 1QVGF 3NVKE 1Q7YH 4LCKA 3J81M 5GIOC 3N4ZA 4TZZA 1W42A 2I6DA 3PLAC 1K73H 5FJ4C 1E7KA 1X7PA 3NK7A 4X3MA 1X7OA 3CG6A 3ON1A 1VQ5F 1YI2F 3J7AR 2OTJF 1DT9A 2FC3A 5EO3A 1VQ8F 3CCUF 3JAMM 3G71F 3AGKA 1QVFF 3CCJF 3CD6F 3LWOC 4C4WC 1VQLF 2JNBA 3CCSF 3NMUC 1GO0A 3RA6A 5G4VC 2AIFA 3JCMM 1YJ9F 1VQ7F 3E1YA 1VQOF 2LBXA 5GAPK 3HJWC 3G4SF 1K9MH 5GIPC 2QI2A 1GO1A 3LFOA 3VI6A 3CCMF 3NVIB 3CPWF 1CK2A 3CCVF 2ALEA 1Q86H 5GANK 3CCEF 1YJWF 1VQKF 5DCVA 1ZWZA 1SDSA 2QA4F 2CZWA 1H7MA 3CMAF 1VQ9F 1VQMF 2KTVA 3OBYA 4BW0B 2WALA 4NUTA 3HAXD 3VMFB 3RA5A 2OTLF 1T0KB 3CMEF 1NMUB 3LWQC 1YHQF 2KG4A 3CCQF 1JJ2F 5IT9M 3WXMB 3G6EF 3MCAB 1XBIA 1W41A 1VQPF 1M1KH 1YJNF 1KQSF 3IR9A 3I56F 3LWVC 2OHWA 1W40A 2QEXF 1VQ6F 1YIJF 1W2BF 3N4YA 3LWRC 3NK6A 3SIVA 3I55F 3CC2F 3CC7F 2VGNA 3E20B 1YITF 3FFMA 3CCRF 3CCLF 2LBWA 2BO1A 5G4UC 3O85A 1N8RH 3SIUA 5EWRA 3J80M 5A2QM 2HVYD 3CPQA 1NJIH 5FLXM 3CXCF 1W3EX 3V7QA 1IPAA 1RLGA 2OZBA 1KC8H 2VGMA 3V7EA 1GZ0A 3CC4F 1M90H 3LWPC 1CN7A 3PAFA
chains in the Genus database with same CATH superfamily
3JAWA 4C8GA 4YJ2B 2CWJA 3DC2A 4BY9D 3D01A 2AIZP 2HS4A 4NWOB 2ZF8A 2UYNB 3HKDA 4U39A 4TUYA 2ZVZA 3JATB 2RHJA 2V9YA 5IYZA 1IV4A 1Q7YH 5EZYB 3NVKE 5LXTB 4O4JA 3C9RA 3FD5A 3N4ZA 3UT5B 3RE3A 5C8YB 5GIOC 4O2BB 1FNJA 1W42A 2I6DA 3RYCB 3JALA 4X20B 5LYJB 4F6RA 1TUBB 3ELCA 3S03A 1VQ5F 1QD9A 3CCUF 3JAMM 1IV3A 3D54A 3CB2A 3JASB 1W581 3CCJF 3LWOC 2PMPA 1GO0A 3OONA 5CA0A 3WGJA 5KX5B 2KGWA 5JQGB 1YQNA 3HJWC 5MN4A 1W57A 2QI2A 4G4YA 1GO1A 4ZI7A 3CCMF 3CPWF 4I50A 5IYZB 1FFXA 4BT4A 4O4JB 1VQKF 5DCVA 4G4VA 4FFBB 1SZQA 3IKFA 3S0YA 3CMAF 1VQ9F 2KTVA 4F6RB 4TV8B 2HP3A 2OTLF 3LWQC 2BTUA 3N2KA 1YHQF 4M8IA 1XBIA 3QUWA 1W41A 5EAZA 2DYYA 3E22A 4BT7A 1COMA 2L26A 1Z5WA 1UI9A 1W40A 1YIJF 5CA0B 3LWRC 3VYTC 2R751 3RYIA 2GVIA 5AVMA 3GHZA 3E20B 3JARA 4WBNB 4ZI7B 4BVSA 3R0PA 1T0AA 3CCLF 2LBWA 2BO1A 2VAWA 3WJPA 4ZHQA 4BVTA 3F0DA 4BT6A 5CA1B 3SIUA 1KNJA 3J80M 5HP8A 1JN1A 3CPQA 5HY4A 4IHJA 3IEQA 2HRUA 2H6LA 3DDNA 3V7QA 3D00A 2FGYA 3N2KB 2VAPA 1TVKA 1RQ2A 2VGMA 1Z5VA 4EI7A 1Q8RA 2ZAUA 3E22B 3LWPC 3FD6A 5HY1A 4O4LA 4DXDA 3HWUA 1RA4A 3V4DA 3GYQA 2Q1XA 3RYIB 3WGKA 2LBTA 5IJ9A 1SA0A 3JARB 1PXWA 2Z1EA 1VK3A 1VQNF 5BMVB 1CLIA 4G88A 2RHLA 3HTNA 3WJRA 5J2UA 3MQWA 3PLAC 3ESJA 2N48A 1K73H 5LP6C 3IKEA 4IHJB 4I4TA 3FPIA 3ZP7A 5FJ4C 3JAKA 4X1YA 3NK7A 1X7OA 2H8EA 3GTZA 1H48A 3P0ZA 2FC3A 5EO3A 4BT2A 4BVQA 4O4IB 4ZK7A 3NMUC 5JH7A 5G4VC 3JCMM 3ERNA 3ZO8A 1VQ7F 3E1YA 2LBXA 5IJ9B 2RHOA 5ITZB 1YGYA 5HWEA 4ZHWA 4ERHA 3C9TA 3NVIB 2YYEA 3VYSC 3JVHA 1YJWF 1ZWZA 3HKCA 4TV9B 1KNKA 4I4TB 2ZVYA 3WPWA 3B6NA 3JAKB 5GONB 4BW0B 3TD5A 4X1YB 1VQMF 3HAXD 3KJKA 3CMEF 2KG4A 3JAWB 2CSLA 3MCAB 3S0HA 2UYPA 1M1KH 3K2XA 2IG8A 1KQSF 2GZLA 1VQ6F 3HKDB 3N4YA 5MN6A 1W2BF 3SIVA 4TUYB 5CB4A 3CC2F 3CC7F 4U3JA 2YXZA 1W59A 1W5FA 1J7HA 2UYKA 1YITF 4C8IA 1R1MA 3F0FA 4EB6A 3CCRF 4I55A 3JALB 5KMGA 3LYBA 3VOBA 5G4UC 3O85A 2NMUA 1N8RH 1W5BA 5JCOC 3HKCB 1JFFA 3QTYA 1RLUA 1W5EA 2PHNA 3QHDA 1XHOA 3KHNA 4BT3A 2GLZA 3KJJA 3VYUC 2UYJA 5EYPA 4G4ZA 4RHAA 3V7EA 3MCQA 3F0EA 3N2GA 3L7QA 2HX0A 5EB0A 4ZOLA 1K8AH 4I50B 5CB4B 3OBWA 3RYFA 1FFXB 5J2TA 4X3LA 3TD4A 1VQ4F 4EB6B 1S72F 3K12A 1U40A 3MBMA 5EIBC 4I55B 5KMGB 2MQEA 1W5AA 5EIBD 2B33A 4LCKA 1QU9A 3VIUA 3T80A 4TZZA 4G4WA 1VQVA 4EI9A 4C81A 2VXYA 4X3MA 3ON1A 1IV1A 1YI2F 2R6R1 5LOVA 2G9IA 4YJ3A 3VTIC 2Z1UA 3G71F 3AGKA 1QVFF 3CD6F 4C4WC 1VQLF 4ZOLB 3CCSF 4G4XA 5LA6A 1W55A 2LCAA 4NQ3A 1YJ9F 3C9UA 5J2TB 4ZHQB 3G4SF 1K9MH 4YJ2A 3LFOA 2CVLA 4PWTA 3C9SA 5B8FA 1CK2A 3VCZA 1Q86H 3TD3A 5GANK 1U3PA 4B5CA 1TVKB 2QA4F 3JATA 2CZWA 3HKEA 1NQ3A 1H7MA 2IAFA 2QTPA 4IIJA 3OBYA 3KE1A 2WALA 5EZYA 5LXTA 3VMFB 4ZHYB 3UT5A 4O4LB 3RA5A 1T0KB 4O2BA 3ZOPA 2DT4A 4XCQA 3RYCA 1JJ2F 5IT9M 3WXMB 3G6EF 5HY2A 4C82A 1VQPF 1YJNF 1TUBA 4O4HA 3HKBA 3RYHA 1SA0B 5HP7A 3LWVC 2QEXF 3M84A 2BTQB 3NK6A 2W8BC 3I55F 5IJ0A 2ZOVA 5J2UB 4DRXA 3FFMA 5MN5A 5KX5A 1FSZA 5JQGA 5FNVA 3S06A 3HKEB 5EWRA 1XV2A 2HQSC 2HVYD 4IIJB 2AMTA 5FLXM 5JVDA 3V3TA 5HXUA 4X1IA 1DBFA 2K1SA 1IPAA 4FFBA 3BYQA 5LP6A 3F6MA 1RLGA 1KC8H 1UFYA 5JH7B 1M90H 2ZODA 1IV2A 4TV8A 4O4HB 3CYQA 3LDTA 1CN7A 1VH8A 3HKBB 3RYHB 4B62A 4BT5A 1X52A 2HRYA 5HXZA 1KD1H 1U3LA 3VO8A 2KTUA 3IMPA 5IJ0B 5GINC 3IEWA 1Q81H 1Q82H 4BVRA 5HY0A 1FNKA 4DRXB 3LMEA 2RHHA 3CYPB 3OW2F 1QVGF 5FNVB 3FBAA 3J81M 4WBNA 2HS3A 2EWCA 3F0GA 2UZHA 2VAMA 5JVDB 1E7KA 1X7PA 2CW4A 4X1IB 3CG6A 5LP6B 3KIZA 5CA1A 3J7AR 2OTJF 3I7TA 1DT9A 3MDOA 3ZP4A 1VQ8F 3P10A 1XRGA 2Z1FA 4U3JB 3K14A 2CHSA 3P4EA 2JNBA 3RA6A 4B46A 2AIFA 4C8EA 3WJQA 1VQOF 1X25A 4X1KA 5GAPK 4O2AA 1QAHA 5GIPC 1H47A 2OTMA 3VI6A 1JFFB 3M4SA 1ONIA 3CCVF 2ALEA 3WGMA 2Q1YA 2Z01A 3I3FA 3CCEF 1OAPA 1SDSA 1VHAA 5EYPB 4EI8A 4KWEA 2CHTA 5BMVA 4LNUA 1OFUA 1RQ7A 3N2GB 4NUTA 5JCOA 3C8LA 2HP0A 1NMUB 3WGLA 4HNAA 3CCQF 2Z1TA 2F9ZC 2BTOA 3U0OA 3WGNA 3RYFB 2IQQA 3IR9A 3I56F 2H8CA 3VOAA 2OHWA 1JD1A 3S02A 4X1KB 2VGNA 4O2AB 3Q8HA 3K0TA 4O4IA 3WPXA 2UYNA 1GX1A 3M1XA 1U43A 2I6RA 2HS0A 5EB1B 5ITZA 1ODEA 1JY8A 5C8YA 5LOVB 4LNUB 4YJ3B 5A2QM 4B45A 1NJIH 4E6EA 4X20A 2RB9A 1PF5A 2P6YA 5LYJA 3CXCF 1W3EX 2HP0B 4R40B 4HNAB 2OZBA 4TV9A 3S0WA 1GZ0A 5LA6B 4ZHVA 3CC4F 5GONA 3EORA 4RQOA 3JASA 3PAFA
chains in the Genus database with same CATH topology
1X52A 1RA4A 3GYQA 5HXZA 1KD1H 1K8AH 2KTUA 5GINC 3OBWA 1Q81H 1Q82H 4BVRA 4X3LA 4BY9D 5HY0A 1VQ4F 1PXWA 1S72F 1VQNF 3OW2F 1QVGF 3NVKE 1Q7YH 4LCKA 3J81M 5GIOC 3N4ZA 4TZZA 1W42A 2I6DA 3PLAC 1K73H 4EI9A 5FJ4C 1E7KA 1X7PA 3NK7A 4X3MA 1X7OA 3CG6A 3ON1A 1VQ5F 1YI2F 3J7AR 2OTJF 1DT9A 2FC3A 5EO3A 1VQ8F 3CCUF 3JAMM 4BVQA 3G71F 3AGKA 1QVFF 3CCJF 3CD6F 3LWOC 4C4WC 1VQLF 2JNBA 3CCSF 3NMUC 1GO0A 3RA6A 5G4VC 2AIFA 3JCMM 4NQ3A 1YJ9F 1VQ7F 3E1YA 1VQOF 2LBXA 5GAPK 3HJWC 3G4SF 1K9MH 5HWEA 5GIPC 2QI2A 1GO1A 3LFOA 3VI6A 3CCMF 3NVIB 3CPWF 1CK2A 3CCVF 2ALEA 1Q86H 5GANK 3CCEF 1YJWF 1VQKF 5DCVA 1ZWZA 1SDSA 4EI8A 2QA4F 2CZWA 1H7MA 3CMAF 1VQ9F 1VQMF 2KTVA 3OBYA 4BW0B 2WALA 4NUTA 3HAXD 3VMFB 3RA5A 2OTLF 1T0KB 3CMEF 1NMUB 3LWQC 1YHQF 2KG4A 3CCQF 4XCQA 1JJ2F 5IT9M 3WXMB 3G6EF 2F9ZC 3MCAB 5HY2A 1XBIA 1W41A 1VQPF 1M1KH 1YJNF 1KQSF 3IR9A 3I56F 3LWVC 2OHWA 1W40A 2QEXF 1VQ6F 1YIJF 1W2BF 3N4YA 3LWRC 3NK6A 3SIVA 3I55F 3CC2F 3CC7F 2VGNA 3E20B 1YITF 4BVSA 3FFMA 3CCRF 3CCLF 2LBWA 2BO1A 5G4UC 3O85A 1N8RH 4BVTA 3SIUA 5EWRA 3J80M 5A2QM 2HVYD 3CPQA 5HY4A 1NJIH 5FLXM 3V3TA 3CXCF 5HXUA 2GLZA 1W3EX 3V7QA 1IPAA 3D00A 2FGYA 1RLGA 2OZBA 1KC8H 2VGMA 3V7EA 1GZ0A 4EI7A 3CC4F 1M90H 3LWPC 1CN7A 5HY1A 3PAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X52 A;  1RA4 A;  3GYQ A;  1KD1 H;  1K8A H;  2KTU A;  5GIN C;  3OBW A;  1Q81 H;  1Q82 H;  4X3L A;  4BY9 D;  1VQ4 F;  1PXW A;  1S72 F;  1VQN F;  3OW2 F;  1QVG F;  3NVK E;  1Q7Y H;  4LCK A;  3J81 M;  5GIO C;  3N4Z A;  4TZZ A;  1W42 A;  2I6D A;  3PLA C;  1K73 H;  5FJ4 C;  1E7K A;  1X7P A;  3NK7 A;  4X3M A;  1X7O A;  3CG6 A;  3ON1 A;  1VQ5 F;  1YI2 F;  3J7A R;  2OTJ F;  1DT9 A;  2FC3 A;  5EO3 A;  1VQ8 F;  3CCU F;  3JAM M;  3G71 F;  3AGK A;  1QVF F;  3CCJ F;  3CD6 F;  3LWO C;  4C4W C;  1VQL F;  2JNB A;  3CCS F;  3NMU C;  1GO0 A;  3RA6 A;  5G4V C;  2AIF A;  3JCM M;  1YJ9 F;  1VQ7 F;  3E1Y A;  1VQO F;  2LBX A;  5GAP K;  3HJW C;  3G4S F;  1K9M H;  5GIP C;  2QI2 A;  1GO1 A;  3LFO A;  3VI6 A;  3CCM F;  3NVI B;  3CPW F;  1CK2 A;  3CCV F;  2ALE A;  1Q86 H;  5GAN K;  3CCE F;  1YJW F;  1VQK F;  5DCV A;  1ZWZ A;  1SDS A;  2QA4 F;  2CZW A;  1H7M A;  3CMA F;  1VQ9 F;  1VQM F;  2KTV A;  3OBY A;  4BW0 B;  2WAL A;  4NUT A;  3HAX D;  3VMF B;  3RA5 A;  2OTL F;  1T0K B;  3CME F;  1NMU B;  3LWQ C;  1YHQ F;  2KG4 A;  3CCQ F;  1JJ2 F;  5IT9 M;  3WXM B;  3G6E F;  3MCA B;  1XBI A;  1W41 A;  1VQP F;  1M1K H;  1YJN F;  1KQS F;  3IR9 A;  3I56 F;  3LWV C;  2OHW A;  1W40 A;  2QEX F;  1VQ6 F;  1YIJ F;  1W2B F;  3N4Y A;  3LWR C;  3NK6 A;  3SIV A;  3I55 F;  3CC2 F;  3CC7 F;  2VGN A;  3E20 B;  1YIT F;  3FFM A;  3CCR F;  3CCL F;  2LBW A;  2BO1 A;  5G4U C;  3O85 A;  1N8R H;  3SIU A;  5EWR A;  3J80 M;  5A2Q M;  2HVY D;  3CPQ A;  1NJI H;  5FLX M;  3CXC F;  1W3E X;  3V7Q A;  1IPA A;  1RLG A;  2OZB A;  1KC8 H;  2VGM A;  3V7E A;  1GZ0 A;  3CC4 F;  1M90 H;  3LWP C;  1CN7 A;  3PAF A; 
#chains in the Genus database with same CATH topology
 3JAW A;  4C8G A;  4YJ2 B;  2CWJ A;  3DC2 A;  4BY9 D;  3D01 A;  2AIZ P;  2HS4 A;  4NWO B;  2ZF8 A;  2UYN B;  3HKD A;  4U39 A;  4TUY A;  2ZVZ A;  3JAT B;  2RHJ A;  2V9Y A;  5IYZ A;  1IV4 A;  1Q7Y H;  5EZY B;  3NVK E;  5LXT B;  4O4J A;  3C9R A;  3FD5 A;  3N4Z A;  3UT5 B;  3RE3 A;  5C8Y B;  5GIO C;  4O2B B;  1FNJ A;  1W42 A;  2I6D A;  3RYC B;  3JAL A;  4X20 B;  5LYJ B;  4F6R A;  1TUB B;  3ELC A;  3S03 A;  1VQ5 F;  1QD9 A;  3CCU F;  3JAM M;  1IV3 A;  3D54 A;  3CB2 A;  3JAS B;  1W58 1;  3CCJ F;  3LWO C;  2PMP A;  1GO0 A;  3OON A;  5CA0 A;  3WGJ A;  5KX5 B;  2KGW A;  5JQG B;  1YQN A;  3HJW C;  5MN4 A;  1W57 A;  2QI2 A;  4G4Y A;  1GO1 A;  4ZI7 A;  3CCM F;  3CPW F;  4I50 A;  5IYZ B;  1FFX A;  4BT4 A;  4O4J B;  1VQK F;  5DCV A;  4G4V A;  4FFB B;  1SZQ A;  3IKF A;  3S0Y A;  3CMA F;  1VQ9 F;  2KTV A;  4F6R B;  4TV8 B;  2HP3 A;  2OTL F;  3LWQ C;  2BTU A;  3N2K A;  1YHQ F;  4M8I A;  1XBI A;  3QUW A;  1W41 A;  5EAZ A;  2DYY A;  3E22 A;  4BT7 A;  1COM A;  2L26 A;  1Z5W A;  1UI9 A;  1W40 A;  1YIJ F;  5CA0 B;  3LWR C;  3VYT C;  2R75 1;  3RYI A;  2GVI A;  5AVM A;  3GHZ A;  3E20 B;  3JAR A;  4WBN B;  4ZI7 B;  4BVS A;  3R0P A;  1T0A A;  3CCL F;  2LBW A;  2BO1 A;  2VAW A;  3WJP A;  4ZHQ A;  4BVT A;  3F0D A;  4BT6 A;  5CA1 B;  3SIU A;  1KNJ A;  3J80 M;  5HP8 A;  1JN1 A;  3CPQ A;  5HY4 A;  4IHJ A;  3IEQ A;  2HRU A;  2H6L A;  3DDN A;  3V7Q A;  3D00 A;  2FGY A;  3N2K B;  2VAP A;  1TVK A;  1RQ2 A;  2VGM A;  1Z5V A;  4EI7 A;  1Q8R A;  2ZAU A;  3E22 B;  3LWP C;  3FD6 A;  5HY1 A;  4O4L A;  4DXD A;  3HWU A;  1RA4 A;  3V4D A;  3GYQ A;  2Q1X A;  3RYI B;  3WGK A;  2LBT A;  5IJ9 A;  1SA0 A;  3JAR B;  1PXW A;  2Z1E A;  1VK3 A;  1VQN F;  5BMV B;  1CLI A;  4G88 A;  2RHL A;  3HTN A;  3WJR A;  5J2U A;  3MQW A;  3PLA C;  3ESJ A;  2N48 A;  1K73 H;  5LP6 C;  3IKE A;  4IHJ B;  4I4T A;  3FPI A;  3ZP7 A;  5FJ4 C;  3JAK A;  4X1Y A;  3NK7 A;  1X7O A;  2H8E A;  3GTZ A;  1H48 A;  3P0Z A;  2FC3 A;  5EO3 A;  4BT2 A;  4BVQ A;  4O4I B;  4ZK7 A;  3NMU C;  5JH7 A;  5G4V C;  3JCM M;  3ERN A;  3ZO8 A;  1VQ7 F;  3E1Y A;  2LBX A;  5IJ9 B;  2RHO A;  5ITZ B;  1YGY A;  5HWE A;  4ZHW A;  4ERH A;  3C9T A;  3NVI B;  2YYE A;  3VYS C;  3JVH A;  1YJW F;  1ZWZ A;  3HKC A;  4TV9 B;  1KNK A;  4I4T B;  2ZVY A;  3WPW A;  3B6N A;  3JAK B;  5GON B;  4BW0 B;  3TD5 A;  4X1Y B;  1VQM F;  3HAX D;  3KJK A;  3CME F;  2KG4 A;  3JAW B;  2CSL A;  3MCA B;  3S0H A;  2UYP A;  1M1K H;  3K2X A;  2IG8 A;  1KQS F;  2GZL A;  1VQ6 F;  3HKD B;  3N4Y A;  5MN6 A;  1W2B F;  3SIV A;  4TUY B;  5CB4 A;  3CC2 F;  3CC7 F;  4U3J A;  2YXZ A;  1W59 A;  1W5F A;  1J7H A;  2UYK A;  1YIT F;  4C8I A;  1R1M A;  3F0F A;  4EB6 A;  3CCR F;  4I55 A;  3JAL B;  5KMG A;  3LYB A;  3VOB A;  5G4U C;  3O85 A;  2NMU A;  1N8R H;  1W5B A;  5JCO C;  3HKC B;  1JFF A;  3QTY A;  1RLU A;  1W5E A;  2PHN A;  3QHD A;  1XHO A;  3KHN A;  4BT3 A;  2GLZ A;  3KJJ A;  3VYU C;  2UYJ A;  5EYP A;  4G4Z A;  4RHA A;  3V7E A;  3MCQ A;  3F0E A;  3N2G A;  3L7Q A;  2HX0 A;  5EB0 A;  4ZOL A;  1K8A H;  4I50 B;  5CB4 B;  3OBW A;  3RYF A;  1FFX B;  5J2T A;  4X3L A;  3TD4 A;  1VQ4 F;  4EB6 B;  1S72 F;  3K12 A;  1U40 A;  3MBM A;  5EIB C;  4I55 B;  5KMG B;  2MQE A;  1W5A A;  5EIB D;  2B33 A;  4LCK A;  1QU9 A;  3VIU A;  3T80 A;  4TZZ A;  4G4W A;  1VQV A;  4EI9 A;  4C81 A;  2VXY A;  4X3M A;  3ON1 A;  1IV1 A;  1YI2 F;  2R6R 1;  5LOV A;  2G9I A;  4YJ3 A;  3VTI C;  2Z1U A;  3G71 F;  3AGK A;  1QVF F;  3CD6 F;  4C4W C;  1VQL F;  4ZOL B;  3CCS F;  4G4X A;  5LA6 A;  1W55 A;  2LCA A;  4NQ3 A;  1YJ9 F;  3C9U A;  5J2T B;  4ZHQ B;  3G4S F;  1K9M H;  4YJ2 A;  3LFO A;  2CVL A;  4PWT A;  3C9S A;  5B8F A;  1CK2 A;  3VCZ A;  1Q86 H;  3TD3 A;  5GAN K;  1U3P A;  4B5C A;  1TVK B;  2QA4 F;  3JAT A;  2CZW A;  3HKE A;  1NQ3 A;  1H7M A;  2IAF A;  2QTP A;  4IIJ A;  3OBY A;  3KE1 A;  2WAL A;  5EZY A;  5LXT A;  3VMF B;  4ZHY B;  3UT5 A;  4O4L B;  3RA5 A;  1T0K B;  4O2B A;  3ZOP A;  2DT4 A;  4XCQ A;  3RYC A;  1JJ2 F;  5IT9 M;  3WXM B;  3G6E F;  5HY2 A;  4C82 A;  1VQP F;  1YJN F;  1TUB A;  4O4H A;  3HKB A;  3RYH A;  1SA0 B;  5HP7 A;  3LWV C;  2QEX F;  3M84 A;  2BTQ B;  3NK6 A;  2W8B C;  3I55 F;  5IJ0 A;  2ZOV A;  5J2U B;  4DRX A;  3FFM A;  5MN5 A;  5KX5 A;  1FSZ A;  5JQG A;  5FNV A;  3S06 A;  3HKE B;  5EWR A;  1XV2 A;  2HQS C;  2HVY D;  4IIJ B;  2AMT A;  5FLX M;  5JVD A;  3V3T A;  5HXU A;  4X1I A;  1DBF A;  2K1S A;  1IPA A;  4FFB A;  3BYQ A;  5LP6 A;  3F6M A;  1RLG A;  1KC8 H;  1UFY A;  5JH7 B;  1M90 H;  2ZOD A;  1IV2 A;  4TV8 A;  4O4H B;  3CYQ A;  3LDT A;  1CN7 A;  1VH8 A;  3HKB B;  3RYH B;  4B62 A;  4BT5 A;  1X52 A;  2HRY A;  5HXZ A;  1KD1 H;  1U3L A;  3VO8 A;  2KTU A;  3IMP A;  5IJ0 B;  5GIN C;  3IEW A;  1Q81 H;  1Q82 H;  4BVR A;  5HY0 A;  1FNK A;  4DRX B;  3LME A;  2RHH A;  3CYP B;  3OW2 F;  1QVG F;  5FNV B;  3FBA A;  3J81 M;  4WBN A;  2HS3 A;  2EWC A;  3F0G A;  2UZH A;  2VAM A;  5JVD B;  1E7K A;  1X7P A;  2CW4 A;  4X1I B;  3CG6 A;  5LP6 B;  3KIZ A;  5CA1 A;  3J7A R;  2OTJ F;  3I7T A;  1DT9 A;  3MDO A;  3ZP4 A;  1VQ8 F;  3P10 A;  1XRG A;  2Z1F A;  4U3J B;  3K14 A;  2CHS A;  3P4E A;  2JNB A;  3RA6 A;  4B46 A;  2AIF A;  4C8E A;  3WJQ A;  1VQO F;  1X25 A;  4X1K A;  5GAP K;  4O2A A;  1QAH A;  5GIP C;  1H47 A;  2OTM A;  3VI6 A;  1JFF B;  3M4S A;  1ONI A;  3CCV F;  2ALE A;  3WGM A;  2Q1Y A;  2Z01 A;  3I3F A;  3CCE F;  1OAP A;  1SDS A;  1VHA A;  5EYP B;  4EI8 A;  4KWE A;  2CHT A;  5BMV A;  4LNU A;  1OFU A;  1RQ7 A;  3N2G B;  4NUT A;  5JCO A;  3C8L A;  2HP0 A;  1NMU B;  3WGL A;  4HNA A;  3CCQ F;  2Z1T A;  2F9Z C;  2BTO A;  3U0O A;  3WGN A;  3RYF B;  2IQQ A;  3IR9 A;  3I56 F;  2H8C A;  3VOA A;  2OHW A;  1JD1 A;  3S02 A;  4X1K B;  2VGN A;  4O2A B;  3Q8H A;  3K0T A;  4O4I A;  3WPX A;  2UYN A;  1GX1 A;  3M1X A;  1U43 A;  2I6R A;  2HS0 A;  5EB1 B;  5ITZ A;  1ODE A;  1JY8 A;  5C8Y A;  5LOV B;  4LNU B;  4YJ3 B;  5A2Q M;  4B45 A;  1NJI H;  4E6E A;  4X20 A;  2RB9 A;  1PF5 A;  2P6Y A;  5LYJ A;  3CXC F;  1W3E X;  2HP0 B;  4R40 B;  4HNA B;  2OZB A;  4TV9 A;  3S0W A;  1GZ0 A;  5LA6 B;  4ZHV A;  3CC4 F;  5GON A;  3EOR A;  4RQO A;  3JAS A;  3PAF A; 
#chains in the Genus database with same CATH homology
 1X52 A;  1RA4 A;  3GYQ A;  5HXZ A;  1KD1 H;  1K8A H;  2KTU A;  5GIN C;  3OBW A;  1Q81 H;  1Q82 H;  4BVR A;  4X3L A;  4BY9 D;  5HY0 A;  1VQ4 F;  1PXW A;  1S72 F;  1VQN F;  3OW2 F;  1QVG F;  3NVK E;  1Q7Y H;  4LCK A;  3J81 M;  5GIO C;  3N4Z A;  4TZZ A;  1W42 A;  2I6D A;  3PLA C;  1K73 H;  4EI9 A;  5FJ4 C;  1E7K A;  1X7P A;  3NK7 A;  4X3M A;  1X7O A;  3CG6 A;  3ON1 A;  1VQ5 F;  1YI2 F;  3J7A R;  2OTJ F;  1DT9 A;  2FC3 A;  5EO3 A;  1VQ8 F;  3CCU F;  3JAM M;  4BVQ A;  3G71 F;  3AGK A;  1QVF F;  3CCJ F;  3CD6 F;  3LWO C;  4C4W C;  1VQL F;  2JNB A;  3CCS F;  3NMU C;  1GO0 A;  3RA6 A;  5G4V C;  2AIF A;  3JCM M;  4NQ3 A;  1YJ9 F;  1VQ7 F;  3E1Y A;  1VQO F;  2LBX A;  5GAP K;  3HJW C;  3G4S F;  1K9M H;  5HWE A;  5GIP C;  2QI2 A;  1GO1 A;  3LFO A;  3VI6 A;  3CCM F;  3NVI B;  3CPW F;  1CK2 A;  3CCV F;  2ALE A;  1Q86 H;  5GAN K;  3CCE F;  1YJW F;  1VQK F;  5DCV A;  1ZWZ A;  1SDS A;  4EI8 A;  2QA4 F;  2CZW A;  1H7M A;  3CMA F;  1VQ9 F;  1VQM F;  2KTV A;  3OBY A;  4BW0 B;  2WAL A;  4NUT A;  3HAX D;  3VMF B;  3RA5 A;  2OTL F;  1T0K B;  3CME F;  1NMU B;  3LWQ C;  1YHQ F;  2KG4 A;  3CCQ F;  4XCQ A;  1JJ2 F;  5IT9 M;  3WXM B;  3G6E F;  2F9Z C;  3MCA B;  5HY2 A;  1XBI A;  1W41 A;  1VQP F;  1M1K H;  1YJN F;  1KQS F;  3IR9 A;  3I56 F;  3LWV C;  2OHW A;  1W40 A;  2QEX F;  1VQ6 F;  1YIJ F;  1W2B F;  3N4Y A;  3LWR C;  3NK6 A;  3SIV A;  3I55 F;  3CC2 F;  3CC7 F;  2VGN A;  3E20 B;  1YIT F;  4BVS A;  3FFM A;  3CCR F;  3CCL F;  2LBW A;  2BO1 A;  5G4U C;  3O85 A;  1N8R H;  4BVT A;  3SIU A;  5EWR A;  3J80 M;  5A2Q M;  2HVY D;  3CPQ A;  5HY4 A;  1NJI H;  5FLX M;  3V3T A;  3CXC F;  5HXU A;  2GLZ A;  1W3E X;  3V7Q A;  1IPA A;  3D00 A;  2FGY A;  1RLG A;  2OZB A;  1KC8 H;  2VGM A;  3V7E A;  1GZ0 A;  4EI7 A;  3CC4 F;  1M90 H;  3LWP C;  1CN7 A;  5HY1 A;  3PAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...