3CCUF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccuF00
5DCVA 1Q86H 1VQMF 5FJ4C 3CCVF 3IR9A 3N4YA 2LBWA 3GYQA 5GINC 3O85A 2WALA 3RA5A 5GIPC 3G71F 1W3EX 1VQ8F 3CC4F 3CCRF 3CCLF 4BW0B 2KTUA 3LWVC 1RLGA 3I55F 3CCJF 3JCMM 3CMAF 3G4SF 1YITF 3FFMA 1CN7A 3CCQF 1H7MA 3PLAC 3HAXD 3CG6A 3LWOC 5G4UC 1QVGF 3CC7F 1VQPF 1M1KH 1X7OA 1VQLF 1VQ6F 5EWRA 2KG4A 1M90H 3LFOA 3LWPC 5FLXM 3LWRC 3VI6A 1K73H 4X3LA 2OZBA 3CCEF 5GAPK 2BO1A 3CCMF 3OW2F 2QEXF 1YHQF 2KTVA 3CXCF 1VQKF 1KD1H 1VQ4F 5IT9M 1GO0A 3N4ZA 3VMFB 4LCKA 1W2BF 3ON1A 1Q81H 3J7AR 4NUTA 1DT9A 5EO3A 1VQNF 1VQ5F 2OTLF 3CD6F 1IPAA 2OHWA 2QA4F 5G4VC 1QVFF 1NMUB 1CK2A 3CC2F 3J81M 1KQSF 2LBXA 3E20B 2VGNA 3V7QA 1VQOF 1Q82H 1K9MH 2OTJF 3CMEF 3MCAB 3NVIB 3PAFA 5GANK 4C4WC 1S72F 3AGKA 3NVKE 4TZZA 3CPWF 1E7KA 3SIUA 3E1YA 1N8RH 1X52A 1GO1A 4X3MA 2JNBA 3NK6A 2AIFA 3NK7A 1Q7YH 3HJWC 5GIOC 3OBWA 1W41A 3V7EA 1T0KB 4BY9D 2FC3A 3G6EF 1NJIH 2CZWA 3JAMM 1KC8H 3I56F 1SDSA 1X7PA 1YIJF 3RA6A 3J80M 5A2QM 3OBYA 3CCUF 2VGMA 1YJWF 1YI2F 1YJNF 3CPQA 1PXWA 3LWQC 2HVYD 2I6DA 1RA4A 1ZWZA 3WXMB 3NMUC 2QI2A 1W42A 1YJ9F 1W40A 1K8AH 1JJ2F 1VQ9F 2ALEA 3CCSF 1XBIA 1VQ7F 1GZ0A 3SIVA
chains in the Genus database with same CATH superfamily
1FFXB 3IMPA 1VQMF 5HP7A 4ZHYB 4IIJB 2LBWA 1H47A 4PWTA 5KX5A 1RQ2A 5JCOC 4B5CA 1IV2A 4I50A 3ZO8A 3VOAA 1NQ3A 2KTUA 4ZK7A 3V3TA 3I7TA 3P4EA 3CCJF 2EWCA 4F6RA 2Z1EA 1YITF 2ZVYA 1SZQA 5FNVA 5J2TB 2P6YA 3R0PA 5IJ0A 3CG6A 4X20B 1U3LA 3LWOC 4TV9B 1VQLF 4BT5A 4TUYB 4FFBB 4O4IB 2VXYA 3LWPC 2HS0A 1TVKA 4E6EA 5JQGB 4X3LA 1K73H 2OZBA 3CCMF 2B33A 3RYHA 3RYCA 2R6R1 3CXCF 5HY0A 3F6MA 4TV8A 1KD1H 5IT9M 4O2AB 4EI8A 3RYFB 3ON1A 4NUTA 3L7QA 4X1KA 1VQNF 3K2XA 1W5AA 5LA6A 3WGLA 1QVFF 3KHNA 3JARA 1CK2A 3C9TA 3V7QA 4G4WA 3CMEF 2VAPA 3RYIB 3VIUA 5JCOA 3NVIB 5GANK 3WPXA 5C8YB 3AGKA 3DDNA 3NVKE 3FD6A 5IYZA 2UZHA 3CPWF 3IEQA 1N8RH 4G4VA 1X52A 2F9ZC 1Q7YH 2AIFA 5GIOC 3OBWA 1U40A 5MN6A 1W41A 4ERHA 3ERNA 3G6EF 4LNUA 1NJIH 2CZWA 1ODEA 3JALA 2CWJA 3ZP7A 1YIJF 3WJQA 3JASA 3S0YA 3OBYA 3CCUF 4C8IA 3P0ZA 3F0DA 5EIBC 4B46A 4B45A 5JVDA 3IKEA 5JH7B 4BVRA 4ZHQB 3Q8HA 5EB1B 2GVIA 3VYSC 1K8AH 3VYUC 1SA0A 4X1IA 1GZ0A 3KJJA 2RHOA 3JAKA 5IJ9B 3N2KA 2Z1FA 1JY8A 2ZVZA 3HKEA 3IR9A 3N4YA 2UYNA 2FGYA 3O85A 4KWEA 4EB6A 5LOVB 5GINC 3RA5A 2CSLA 5GIPC 1DBFA 2R751 1VQ8F 5EAZA 3LDTA 4C81A 3CC4F 3JVHA 5CA1B 1J7HA 4BW0B 1IV1A 3LWVC 4ZI7A 5EZYB 1GX1A 3CMAF 2I6RA 3G4SF 1FFXA 2CVLA 2BTUA 2YYEA 3C8LA 3HKCB 4IIJA 4O4LB 3U0OA 5HWEA 3HAXD 2H8EA 1QVGF 3D01A 3CC7F 3KIZA 1M1KH 1VQ6F 1M90H 1COMA 3WGJA 4BT3A 5KMGA 5J2TA 5LYJB 5J2UA 3WPWA 3WJRA 4X20A 1VQVA 2BTQB 2W8BC 4I55B 2KTVA 4TV9A 3HKBB 3IEWA 4O2BB 2IG8A 4TUYA 1FSZA 4FFBA 4O4IA 3MCQA 5KMGB 3F0GA 2ZODA 2Q1YA 5J2UB 5ITZB 3JATB 2OTLF 2HS4A 5JQGA 2OHWA 5G4VC 2MQEA 3KE1A 5LP6C 3S0HA 4ZOLB 3CC2F 1VQOF 3QTYA 3QHDA 4BVSA 1YGYA 5CA0B 3K14A 4O2AA 4C4WC 1S72F 3RYFA 4X1YA 1CLIA 1R1MA 1OAPA 3SIUA 5BMVB 2PMPA 3BYQA 4U3JB 4BT6A 5MN5A 3WGNA 3UT5B 4X1YB 2FC3A 1KC8H 2ZF8A 4BT7A 1X7PA 3C9SA 3RYIA 3RA6A 5A2QM 5C8YA 3CYPB 1YJWF 1YI2F 1YJNF 4BVTA 1PXWA 3LWQC 1RA4A 3WXMB 1JD1A 4YJ3B 1PF5A 2CW4A 3F0EA 1KNKA 3K12A 3CCSF 3GHZA 1VQ7F 1XV2A 4DRXB 3N2GB 3VOBA 1UFYA 2RHLA 3S03A 2ZOVA 2LBTA 3C9UA 3VO8A 5JH7A 3GYQA 5LP6A 2WALA 4NWOB 4ZHQA 4YJ2B 3G71F 5EYPB 3QUWA 2UYKA 3ZOPA 5B8FA 3CCLF 3B6NA 4C8EA 3JCMM 5LP6B 3EORA 4BT4A 2HP0B 5IJ9A 3FFMA 2IAFA 2H8CA 3PLAC 2DT4A 5LOVA 3WGKA 5G4UC 2RB9A 2RHJA 2H6LA 1TUBA 1X7OA 1XHOA 2L26A 4HNAB 5CA1A 2DYYA 2KG4A 2N48A 2AMTA 3LFOA 5EZYA 4U39A 1W5BA 3HKDB 5FLXM 3LWRC 2GLZA 3CYQA 3VI6A 4I4TA 2YXZA 3T80A 3VTIC 5LXTB 3S06A 1TUBB 3HWUA 5GAPK 2BO1A 3CCEF 2UYPA 2K1SA 3HKCA 3IKFA 4O4LA 4WBNB 5CB4B 2QEXF 1QAHA 3F0FA 1W59A 1VQ4F 3VMFB 4I4TB 4LCKA 3ESJA 3WJPA 1W2BF 3J7AR 2UYJA 1VK3A 5EO3A 1VQ5F 5HP8A 3MQWA 5LYJA 3FD5A 1JN1A 2Q1XA 3HTNA 3JAWA 3E20B 4I55A 1K9MH 4ZHWA 3E22B 2OTJF 3HKBA 1W581 4O2BA 3PAFA 2HQSC 2BTOA 3LMEA 4TZZA 1RQ7A 3E1YA 3JAWB 5ITZA 3JATA 1Z5VA 2V9YA 5GONB 2JNBA 3M84A 4X3MA 4ZOLA 4IHJB 5HY2A 4O4HB 3C9RA 3JAMM 1FNJA 5CA0A 4O4JB 1RLUA 1W55A 3CB2A 4R40B 4BT2A 1W5FA 1X25A 2QTPA 5BMVA 3CPQA 2CHTA 3S02A 1U3PA 2I6DA 1KNJA 4U3JA 1ZWZA 4RQOA 4G4YA 2HX0A 2QI2A 3UT5A 1QU9A 1W40A 2HS3A 3MBMA 5KX5B 1VH8A 1UI9A 1JJ2F 1VQ9F 4C8GA 4I50B 2OTMA 3VCZA 2ALEA 2PHNA 1XBIA 5HXZA 1ONIA 4F6RB 3SIVA 2VAWA 2GZLA 5DCVA 1VHAA 1Q86H 1T0AA 5FNVB 5FJ4C 3CCVF 4B62A 5IJ0B 2HP3A 4YJ3A 3LYBA 3FPIA 4BVQA 1W3EX 3FBAA 5HY1A 5MN4A 2AIZP 3CCRF 3DC2A 1JFFA 3V4DA 3TD4A 1RLGA 2NMUA 3I55F 4G4XA 1W5EA 4G4ZA 1W57A 3N2GA 4DRXA 1TVKB 1CN7A 3CCQF 1H7MA 1JFFB 3RYHB 3RYCB 4YJ2A 1VQPF 4TV8B 3TD5A 1H48A 2Z01A 5EYPA 5EWRA 3MDOA 3TD3A 5EB0A 4X1KB 2RHHA 4G88A 5LA6B 2HP0A 2IQQA 1QD9A 3JARB 2HRUA 3OW2F 3I3FA 1YHQF 2Z1UA 1VQKF 1OFUA 4NQ3A 1GO0A 3N4ZA 3M4SA 4HNAA 3D54A 1Q81H 1YQNA 4M8IA 5IYZB 2Z1TA 1DT9A 1IV4A 1U43A 3HKDA 3RE3A 3K0TA 3CD6F 2HRYA 1IPAA 2QA4F 4RHAA 5LXTA 1NMUB 5CB4A 2VAMA 4WBNA 3J81M 1KQSF 2LBXA 1Q82H 2VGNA 4LNUB 3WGMA 3D00A 3MCAB 3JALB 1IV3A 1Q8RA 2CHSA 3JASB 2G9IA 3M1XA 1E7KA 1Z5WA 2LCAA 1GO1A 5JVDB 3NK6A 1XRGA 3NK7A 4XCQA 3HJWC 3V7EA 1T0KB 3KJKA 4BY9D 3S0WA 3E22A 4DXDA 3I56F 1SDSA 5AVMA 5EIBD 1SA0B 3J80M 4X1IB 3ZP4A 2VGMA 4EI7A 3GTZA 3JAKB 3VYTC 4ZHVA 2HVYD 2ZAUA 3N2KB 5GONA 3HKEB 3NMUC 2UYNB 4EI9A 4EB6B 1W42A 1YJ9F 4IHJA 5HXUA 4O4HA 4C82A 3ELCA 3P10A 2KGWA 4O4JA 1FNKA 4ZI7B 5HY4A 3OONA
chains in the Genus database with same CATH topology
5DCVA 1Q86H 1VQMF 5FJ4C 3CCVF 3IR9A 3N4YA 2LBWA 3GYQA 2FGYA 3O85A 2WALA 5GINC 3RA5A 5GIPC 3G71F 4BVQA 1W3EX 5HY1A 1VQ8F 3CC4F 3CCRF 3CCLF 4BW0B 2KTUA 3LWVC 3V3TA 1RLGA 3I55F 3CCJF 3JCMM 3CMAF 3G4SF 1YITF 3FFMA 1CN7A 3CCQF 1H7MA 3PLAC 3HAXD 3CG6A 5HWEA 3LWOC 5G4UC 1QVGF 3CC7F 1VQPF 1M1KH 1X7OA 1VQLF 1VQ6F 5EWRA 2KG4A 1M90H 3LFOA 3LWPC 5FLXM 3LWRC 2GLZA 3VI6A 1K73H 4X3LA 2OZBA 3CCEF 5GAPK 2BO1A 3CCMF 3OW2F 2QEXF 1YHQF 2KTVA 3CXCF 5HY0A 1VQKF 4NQ3A 1KD1H 1VQ4F 5IT9M 1GO0A 3N4ZA 3VMFB 4LCKA 4EI8A 1W2BF 3ON1A 1Q81H 3J7AR 4NUTA 1DT9A 5EO3A 1VQNF 1VQ5F 2OTLF 3CD6F 1IPAA 2OHWA 2QA4F 5G4VC 1QVFF 1NMUB 1CK2A 3CC2F 3J81M 1KQSF 2LBXA 3E20B 2VGNA 3V7QA 4BVSA 1VQOF 1Q82H 1K9MH 2OTJF 3CMEF 3D00A 3MCAB 3NVIB 3PAFA 5GANK 4C4WC 1S72F 3AGKA 3NVKE 4TZZA 3CPWF 1E7KA 3SIUA 3E1YA 1N8RH 1X52A 1GO1A 4X3MA 2F9ZC 2JNBA 2AIFA 3NK6A 3NK7A 4XCQA 5GIOC 3OBWA 1Q7YH 3HJWC 1W41A 3V7EA 5HY2A 4BY9D 2FC3A 3G6EF 1NJIH 1T0KB 2CZWA 3JAMM 1KC8H 3I56F 1SDSA 1X7PA 1YIJF 3RA6A 3J80M 5A2QM 3OBYA 3CCUF 2VGMA 4EI7A 1YJWF 1YI2F 1YJNF 3CPQA 4BVTA 1PXWA 3LWQC 2HVYD 2I6DA 1RA4A 1ZWZA 3WXMB 3NMUC 2QI2A 4EI9A 1W42A 1YJ9F 4BVRA 1W40A 5HXUA 1K8AH 1JJ2F 1VQ9F 2ALEA 3CCSF 1XBIA 5HXZA 1VQ7F 1GZ0A 5HY4A 3SIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCV A;  1Q86 H;  1VQM F;  5FJ4 C;  3CCV F;  3IR9 A;  3N4Y A;  2LBW A;  3GYQ A;  5GIN C;  3O85 A;  2WAL A;  3RA5 A;  5GIP C;  3G71 F;  1W3E X;  1VQ8 F;  3CC4 F;  3CCR F;  3CCL F;  4BW0 B;  2KTU A;  3LWV C;  1RLG A;  3I55 F;  3CCJ F;  3JCM M;  3CMA F;  3G4S F;  1YIT F;  3FFM A;  1CN7 A;  3CCQ F;  1H7M A;  3PLA C;  3HAX D;  3CG6 A;  3LWO C;  5G4U C;  1QVG F;  3CC7 F;  1VQP F;  1M1K H;  1X7O A;  1VQL F;  1VQ6 F;  5EWR A;  2KG4 A;  1M90 H;  3LFO A;  3LWP C;  5FLX M;  3LWR C;  3VI6 A;  1K73 H;  4X3L A;  2OZB A;  3CCE F;  5GAP K;  2BO1 A;  3CCM F;  3OW2 F;  2QEX F;  1YHQ F;  2KTV A;  3CXC F;  1VQK F;  1KD1 H;  1VQ4 F;  5IT9 M;  1GO0 A;  3N4Z A;  3VMF B;  4LCK A;  1W2B F;  3ON1 A;  1Q81 H;  3J7A R;  4NUT A;  1DT9 A;  5EO3 A;  1VQN F;  1VQ5 F;  2OTL F;  3CD6 F;  1IPA A;  2OHW A;  2QA4 F;  5G4V C;  1QVF F;  1NMU B;  1CK2 A;  3CC2 F;  3J81 M;  1KQS F;  2LBX A;  3E20 B;  2VGN A;  3V7Q A;  1VQO F;  1Q82 H;  1K9M H;  2OTJ F;  3CME F;  3MCA B;  3NVI B;  3PAF A;  5GAN K;  4C4W C;  1S72 F;  3AGK A;  3NVK E;  4TZZ A;  3CPW F;  1E7K A;  3SIU A;  3E1Y A;  1N8R H;  1X52 A;  1GO1 A;  4X3M A;  2JNB A;  3NK6 A;  2AIF A;  3NK7 A;  1Q7Y H;  3HJW C;  5GIO C;  3OBW A;  1W41 A;  3V7E A;  1T0K B;  4BY9 D;  2FC3 A;  3G6E F;  1NJI H;  2CZW A;  3JAM M;  1KC8 H;  3I56 F;  1SDS A;  1X7P A;  1YIJ F;  3RA6 A;  3J80 M;  5A2Q M;  3OBY A;  3CCU F;  2VGM A;  1YJW F;  1YI2 F;  1YJN F;  3CPQ A;  1PXW A;  3LWQ C;  2HVY D;  2I6D A;  1RA4 A;  1ZWZ A;  3WXM B;  3NMU C;  2QI2 A;  1W42 A;  1YJ9 F;  1W40 A;  1K8A H;  1JJ2 F;  1VQ9 F;  2ALE A;  3CCS F;  1XBI A;  1VQ7 F;  1GZ0 A;  3SIV A; 
#chains in the Genus database with same CATH topology
 1FFX B;  3IMP A;  1VQM F;  5HP7 A;  4ZHY B;  4IIJ B;  2LBW A;  1H47 A;  4PWT A;  5KX5 A;  1RQ2 A;  5JCO C;  4B5C A;  1IV2 A;  4I50 A;  3ZO8 A;  3VOA A;  1NQ3 A;  2KTU A;  4ZK7 A;  3V3T A;  3I7T A;  3P4E A;  3CCJ F;  2EWC A;  4F6R A;  2Z1E A;  1YIT F;  2ZVY A;  1SZQ A;  5FNV A;  5J2T B;  2P6Y A;  3R0P A;  5IJ0 A;  3CG6 A;  4X20 B;  1U3L A;  3LWO C;  4TV9 B;  1VQL F;  4BT5 A;  4TUY B;  4FFB B;  4O4I B;  2VXY A;  3LWP C;  2HS0 A;  1TVK A;  4E6E A;  5JQG B;  4X3L A;  1K73 H;  2OZB A;  3CCM F;  2B33 A;  3RYH A;  3RYC A;  2R6R 1;  3CXC F;  5HY0 A;  3F6M A;  4TV8 A;  1KD1 H;  5IT9 M;  4O2A B;  4EI8 A;  3RYF B;  3ON1 A;  4NUT A;  3L7Q A;  4X1K A;  1VQN F;  3K2X A;  1W5A A;  5LA6 A;  3WGL A;  1QVF F;  3KHN A;  3JAR A;  1CK2 A;  3C9T A;  3V7Q A;  4G4W A;  3CME F;  2VAP A;  3RYI B;  3VIU A;  5JCO A;  3NVI B;  5GAN K;  3WPX A;  5C8Y B;  3AGK A;  3DDN A;  3NVK E;  3FD6 A;  5IYZ A;  2UZH A;  3CPW F;  3IEQ A;  1N8R H;  4G4V A;  1X52 A;  2F9Z C;  1Q7Y H;  2AIF A;  5GIO C;  3OBW A;  1U40 A;  5MN6 A;  1W41 A;  4ERH A;  3ERN A;  3G6E F;  4LNU A;  1NJI H;  2CZW A;  1ODE A;  3JAL A;  2CWJ A;  3ZP7 A;  1YIJ F;  3WJQ A;  3JAS A;  3S0Y A;  3OBY A;  3CCU F;  4C8I A;  3P0Z A;  3F0D A;  5EIB C;  4B46 A;  4B45 A;  5JVD A;  3IKE A;  5JH7 B;  4BVR A;  4ZHQ B;  3Q8H A;  5EB1 B;  2GVI A;  3VYS C;  1K8A H;  3VYU C;  1SA0 A;  4X1I A;  1GZ0 A;  3KJJ A;  2RHO A;  3JAK A;  5IJ9 B;  3N2K A;  2Z1F A;  1JY8 A;  2ZVZ A;  3HKE A;  3IR9 A;  3N4Y A;  2UYN A;  2FGY A;  3O85 A;  4KWE A;  4EB6 A;  5LOV B;  5GIN C;  3RA5 A;  2CSL A;  5GIP C;  1DBF A;  2R75 1;  1VQ8 F;  5EAZ A;  3LDT A;  4C81 A;  3CC4 F;  3JVH A;  5CA1 B;  1J7H A;  4BW0 B;  1IV1 A;  3LWV C;  4ZI7 A;  5EZY B;  1GX1 A;  3CMA F;  2I6R A;  3G4S F;  1FFX A;  2CVL A;  2BTU A;  2YYE A;  3C8L A;  3HKC B;  4IIJ A;  4O4L B;  3U0O A;  5HWE A;  3HAX D;  2H8E A;  1QVG F;  3D01 A;  3CC7 F;  3KIZ A;  1M1K H;  1VQ6 F;  1M90 H;  1COM A;  3WGJ A;  4BT3 A;  5KMG A;  5J2T A;  5LYJ B;  5J2U A;  3WPW A;  3WJR A;  4X20 A;  1VQV A;  2BTQ B;  2W8B C;  4I55 B;  2KTV A;  4TV9 A;  3HKB B;  3IEW A;  4O2B B;  2IG8 A;  4TUY A;  1FSZ A;  4FFB A;  4O4I A;  3MCQ A;  5KMG B;  3F0G A;  2ZOD A;  2Q1Y A;  5J2U B;  5ITZ B;  3JAT B;  2OTL F;  2HS4 A;  5JQG A;  2OHW A;  5G4V C;  2MQE A;  3KE1 A;  5LP6 C;  3S0H A;  4ZOL B;  3CC2 F;  1VQO F;  3QTY A;  3QHD A;  4BVS A;  1YGY A;  5CA0 B;  3K14 A;  4O2A A;  4C4W C;  1S72 F;  3RYF A;  4X1Y A;  1CLI A;  1R1M A;  1OAP A;  3SIU A;  5BMV B;  2PMP A;  3BYQ A;  4U3J B;  4BT6 A;  5MN5 A;  3WGN A;  3UT5 B;  4X1Y B;  2FC3 A;  1KC8 H;  2ZF8 A;  4BT7 A;  1X7P A;  3C9S A;  3RYI A;  3RA6 A;  5A2Q M;  5C8Y A;  3CYP B;  1YJW F;  1YI2 F;  1YJN F;  4BVT A;  1PXW A;  3LWQ C;  1RA4 A;  3WXM B;  1JD1 A;  4YJ3 B;  1PF5 A;  2CW4 A;  3F0E A;  1KNK A;  3K12 A;  3CCS F;  3GHZ A;  1VQ7 F;  1XV2 A;  4DRX B;  3N2G B;  3VOB A;  1UFY A;  2RHL A;  3S03 A;  2ZOV A;  2LBT A;  3C9U A;  3VO8 A;  5JH7 A;  3GYQ A;  5LP6 A;  2WAL A;  4NWO B;  4ZHQ A;  4YJ2 B;  3G71 F;  5EYP B;  3QUW A;  2UYK A;  3ZOP A;  5B8F A;  3CCL F;  3B6N A;  4C8E A;  3JCM M;  5LP6 B;  3EOR A;  4BT4 A;  2HP0 B;  5IJ9 A;  3FFM A;  2IAF A;  2H8C A;  3PLA C;  2DT4 A;  5LOV A;  3WGK A;  5G4U C;  2RB9 A;  2RHJ A;  2H6L A;  1TUB A;  1X7O A;  1XHO A;  2L26 A;  4HNA B;  5CA1 A;  2DYY A;  2KG4 A;  2N48 A;  2AMT A;  3LFO A;  5EZY A;  4U39 A;  1W5B A;  3HKD B;  5FLX M;  3LWR C;  2GLZ A;  3CYQ A;  3VI6 A;  4I4T A;  2YXZ A;  3T80 A;  3VTI C;  5LXT B;  3S06 A;  1TUB B;  3HWU A;  5GAP K;  2BO1 A;  3CCE F;  2UYP A;  2K1S A;  3HKC A;  3IKF A;  4O4L A;  4WBN B;  5CB4 B;  2QEX F;  1QAH A;  3F0F A;  1W59 A;  1VQ4 F;  3VMF B;  4I4T B;  4LCK A;  3ESJ A;  3WJP A;  1W2B F;  3J7A R;  2UYJ A;  1VK3 A;  5EO3 A;  1VQ5 F;  5HP8 A;  3MQW A;  5LYJ A;  3FD5 A;  1JN1 A;  2Q1X A;  3HTN A;  3JAW A;  3E20 B;  4I55 A;  1K9M H;  4ZHW A;  3E22 B;  2OTJ F;  3HKB A;  1W58 1;  4O2B A;  3PAF A;  2HQS C;  2BTO A;  3LME A;  4TZZ A;  1RQ7 A;  3E1Y A;  3JAW B;  5ITZ A;  3JAT A;  1Z5V A;  2V9Y A;  5GON B;  2JNB A;  3M84 A;  4X3M A;  4ZOL A;  4IHJ B;  5HY2 A;  4O4H B;  3C9R A;  3JAM M;  1FNJ A;  5CA0 A;  4O4J B;  1RLU A;  1W55 A;  3CB2 A;  4R40 B;  4BT2 A;  1W5F A;  1X25 A;  2QTP A;  5BMV A;  3CPQ A;  2CHT A;  3S02 A;  1U3P A;  2I6D A;  1KNJ A;  4U3J A;  1ZWZ A;  4RQO A;  4G4Y A;  2HX0 A;  2QI2 A;  3UT5 A;  1QU9 A;  1W40 A;  2HS3 A;  3MBM A;  5KX5 B;  1VH8 A;  1UI9 A;  1JJ2 F;  1VQ9 F;  4C8G A;  4I50 B;  2OTM A;  3VCZ A;  2ALE A;  2PHN A;  1XBI A;  5HXZ A;  1ONI A;  4F6R B;  3SIV A;  2VAW A;  2GZL A;  5DCV A;  1VHA A;  1Q86 H;  1T0A A;  5FNV B;  5FJ4 C;  3CCV F;  4B62 A;  5IJ0 B;  2HP3 A;  4YJ3 A;  3LYB A;  3FPI A;  4BVQ A;  1W3E X;  3FBA A;  5HY1 A;  5MN4 A;  2AIZ P;  3CCR F;  3DC2 A;  1JFF A;  3V4D A;  3TD4 A;  1RLG A;  2NMU A;  3I55 F;  4G4X A;  1W5E A;  4G4Z A;  1W57 A;  3N2G A;  4DRX A;  1TVK B;  1CN7 A;  3CCQ F;  1H7M A;  1JFF B;  3RYH B;  3RYC B;  4YJ2 A;  1VQP F;  4TV8 B;  3TD5 A;  1H48 A;  2Z01 A;  5EYP A;  5EWR A;  3MDO A;  3TD3 A;  5EB0 A;  4X1K B;  2RHH A;  4G88 A;  5LA6 B;  2HP0 A;  2IQQ A;  1QD9 A;  3JAR B;  2HRU A;  3OW2 F;  3I3F A;  1YHQ F;  2Z1U A;  1VQK F;  1OFU A;  4NQ3 A;  1GO0 A;  3N4Z A;  3M4S A;  4HNA A;  3D54 A;  1Q81 H;  1YQN A;  4M8I A;  5IYZ B;  2Z1T A;  1DT9 A;  1IV4 A;  1U43 A;  3HKD A;  3RE3 A;  3K0T A;  3CD6 F;  2HRY A;  1IPA A;  2QA4 F;  4RHA A;  5LXT A;  1NMU B;  5CB4 A;  2VAM A;  4WBN A;  3J81 M;  1KQS F;  2LBX A;  1Q82 H;  2VGN A;  4LNU B;  3WGM A;  3D00 A;  3MCA B;  3JAL B;  1IV3 A;  1Q8R A;  2CHS A;  3JAS B;  2G9I A;  3M1X A;  1E7K A;  1Z5W A;  2LCA A;  1GO1 A;  5JVD B;  3NK6 A;  1XRG A;  3NK7 A;  4XCQ A;  3HJW C;  3V7E A;  1T0K B;  3KJK A;  4BY9 D;  3S0W A;  3E22 A;  4DXD A;  3I56 F;  1SDS A;  5AVM A;  5EIB D;  1SA0 B;  3J80 M;  4X1I B;  3ZP4 A;  2VGM A;  4EI7 A;  3GTZ A;  3JAK B;  3VYT C;  4ZHV A;  2HVY D;  2ZAU A;  3N2K B;  5GON A;  3HKE B;  3NMU C;  2UYN B;  4EI9 A;  4EB6 B;  1W42 A;  1YJ9 F;  4IHJ A;  5HXU A;  4O4H A;  4C82 A;  3ELC A;  3P10 A;  2KGW A;  4O4J A;  1FNK A;  4ZI7 B;  5HY4 A;  3OON A; 
#chains in the Genus database with same CATH homology
 5DCV A;  1Q86 H;  1VQM F;  5FJ4 C;  3CCV F;  3IR9 A;  3N4Y A;  2LBW A;  3GYQ A;  2FGY A;  3O85 A;  2WAL A;  5GIN C;  3RA5 A;  5GIP C;  3G71 F;  4BVQ A;  1W3E X;  5HY1 A;  1VQ8 F;  3CC4 F;  3CCR F;  3CCL F;  4BW0 B;  2KTU A;  3LWV C;  3V3T A;  1RLG A;  3I55 F;  3CCJ F;  3JCM M;  3CMA F;  3G4S F;  1YIT F;  3FFM A;  1CN7 A;  3CCQ F;  1H7M A;  3PLA C;  3HAX D;  3CG6 A;  5HWE A;  3LWO C;  5G4U C;  1QVG F;  3CC7 F;  1VQP F;  1M1K H;  1X7O A;  1VQL F;  1VQ6 F;  5EWR A;  2KG4 A;  1M90 H;  3LFO A;  3LWP C;  5FLX M;  3LWR C;  2GLZ A;  3VI6 A;  1K73 H;  4X3L A;  2OZB A;  3CCE F;  5GAP K;  2BO1 A;  3CCM F;  3OW2 F;  2QEX F;  1YHQ F;  2KTV A;  3CXC F;  5HY0 A;  1VQK F;  4NQ3 A;  1KD1 H;  1VQ4 F;  5IT9 M;  1GO0 A;  3N4Z A;  3VMF B;  4LCK A;  4EI8 A;  1W2B F;  3ON1 A;  1Q81 H;  3J7A R;  4NUT A;  1DT9 A;  5EO3 A;  1VQN F;  1VQ5 F;  2OTL F;  3CD6 F;  1IPA A;  2OHW A;  2QA4 F;  5G4V C;  1QVF F;  1NMU B;  1CK2 A;  3CC2 F;  3J81 M;  1KQS F;  2LBX A;  3E20 B;  2VGN A;  3V7Q A;  4BVS A;  1VQO F;  1Q82 H;  1K9M H;  2OTJ F;  3CME F;  3D00 A;  3MCA B;  3NVI B;  3PAF A;  5GAN K;  4C4W C;  1S72 F;  3AGK A;  3NVK E;  4TZZ A;  3CPW F;  1E7K A;  3SIU A;  3E1Y A;  1N8R H;  1X52 A;  1GO1 A;  4X3M A;  2F9Z C;  2JNB A;  2AIF A;  3NK6 A;  3NK7 A;  4XCQ A;  5GIO C;  3OBW A;  1Q7Y H;  3HJW C;  1W41 A;  3V7E A;  5HY2 A;  4BY9 D;  2FC3 A;  3G6E F;  1NJI H;  1T0K B;  2CZW A;  3JAM M;  1KC8 H;  3I56 F;  1SDS A;  1X7P A;  1YIJ F;  3RA6 A;  3J80 M;  5A2Q M;  3OBY A;  3CCU F;  2VGM A;  4EI7 A;  1YJW F;  1YI2 F;  1YJN F;  3CPQ A;  4BVT A;  1PXW A;  3LWQ C;  2HVY D;  2I6D A;  1RA4 A;  1ZWZ A;  3WXM B;  3NMU C;  2QI2 A;  4EI9 A;  1W42 A;  1YJ9 F;  4BVR A;  1W40 A;  5HXU A;  1K8A H;  1JJ2 F;  1VQ9 F;  2ALE A;  3CCS F;  1XBI A;  5HXZ A;  1VQ7 F;  1GZ0 A;  5HY4 A;  3SIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...