3CCUF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccuF00
3CCRF 3VI6A 3NK6A 3CC7F 2OTJF 2OTLF 3CCJF 4NUTA 3CG6A 5A2QM 5GANK 1VQNF 1QVFF 4C4WC 1SDSA 3GYQA 1QVGF 5GIPC 3LWQC 5GINC 1H7MA 2JNBA 4TZZA 3JCMM 5GIOC 1YHQF 3HJWC 1X7PA 1RLGA 3CD6F 1IPAA 3NK7A 3CMEF 1ZWZA 1VQ9F 3LWRC 3G71F 1W3EX 1Q7YH 1W40A 2OHWA 4X3MA 3LWVC 1PXWA 1CK2A 3AGKA 1VQ4F 3CCSF 1YITF 3CC4F 1RA4A 5G4VC 1VQ8F 1M90H 3OBYA 1DT9A 3CCLF 3SIUA 1Q81H 3JAMM 3CC2F 1X7OA 1XBIA 3O85A 1X52A 3E20B 3N4ZA 2BO1A 4BW0B 3LFOA 1M1KH 1VQ6F 1Q86H 3LWOC 1Q82H 3CMAF 2KTVA 4X3LA 2LBXA 3CXCF 1YI2F 2QI2A 3RA6A 1VQOF 3J80M 1KD1H 1YJ9F 1CN7A 3RA5A 1GO0A 2LBWA 2VGNA 2WALA 3V7EA 3WXMB 4BY9D 1W41A 3CPWF 1YJNF 1GO1A 5EWRA 1N8RH 3OW2F 3OBWA 1KC8H 1KQSF 3CCVF 3CPQA 2ALEA 5DCVA 1K73H 1VQPF 5IT9M 3CCQF 1T0KB 3J81M 3VMFB 3IR9A 3NMUC 1VQKF 4LCKA 1GZ0A 5FJ4C 5G4UC 3LWPC 2CZWA 1NMUB 1NJIH 1W42A 1YJWF 2QA4F 3I56F 3HAXD 3G4SF 2QEXF 3V7QA 1K8AH 3G6EF 3NVKE 3E1YA 3MCAB 1VQ5F 3CCEF 1VQLF 3J7AR 3CCUF 3I55F 3SIVA 1K9MH 2FC3A 1VQMF 2KG4A 5FLXM 2VGMA 5EO3A 3PAFA 2OZBA 1VQ7F 3FFMA 2AIFA 3PLAC 1S72F 3CCMF 1YIJF 2I6DA 1E7KA 1JJ2F 1W2BF 3NVIB 3N4YA 3ON1A 2HVYD 5GAPK 2KTUA
chains in the Genus database with same CATH superfamily
3CCRF 3JARA 5LYJB 1JFFA 3S02A 3CCJF 2N48A 1CLIA 2HS0A 5EIBD 5GANK 2L26A 4TUYB 4C82A 3S03A 1QVGF 4X20B 4LNUA 5ITZA 3HJWC 3RYHA 4BT4A 1W5AA 4TV8B 1ONIA 3D01A 1VHAA 3D00A 5HY2A 3HKEB 4HNAA 1UI9A 2UYKA 3NK7A 2MQEA 5IJ0B 3CMEF 1VQ9F 2IG8A 4ZHYB 2FGYA 3N2KB 3WGKA 2ZF8A 3C8LA 3N2GA 2HP3A 2NMUA 5C8YA 4BVSA 5LOVB 2DYYA 3C9UA 3WGLA 3P0ZA 2P6YA 5CA0B 1Z5VA 3FD6A 4EB6B 3CCLF 2RHOA 5LXTA 1IV4A 1Q81H 2G9IA 2HQSC 1XBIA 3KJKA 4YJ2B 3E20B 3N4ZA 3LFOA 1M1KH 2GZLA 4O2AA 4G4WA 3JALA 3LWOC 1RQ7A 2QTPA 3TD3A 5KX5B 3VOAA 3I3FA 2KTVA 3L7QA 3LYBA 3HKBA 3T80A 4X3LA 3F0DA 3C9TA 3LDTA 2LBWA 3EORA 2VGNA 1U43A 1W41A 5EYPB 5CB4A 4X1KA 3OW2F 3WGJA 2HX0A 2VXYA 3C9RA 1W581 1RQ2A 2ALEA 4BT5A 2RHLA 3MCQA 1H47A 4IHJB 4X1IB 3MDOA 5IT9M 3BYQA 3CCQF 2IQQA 4ZOLA 3WGNA 3IR9A 3D54A 5FJ4C 5HWEA 3HWUA 5EZYB 2CZWA 2V9YA 4ZHVA 3RYCB 3RYFB 5KMGA 2QA4F 3IKFA 3S0HA 2QEXF 3WPXA 3G6EF 3V3TA 3F0FA 1VQ5F 5B8FA 3CCEF 3SIVA 1K9MH 4O4JB 2GLZA 1W5FA 4E6EA 5HP8A 2H6LA 4X1YA 1VQ7F 4EI8A 5LP6A 3Q8HA 2Z1FA 3ELCA 3VYSC 1SZQA 3JARB 1JFFB 3UT5B 3CCMF 1W55A 1E7KA 3FD5A 5HP7A 3F0GA 3N4YA 1KNJA 3S0YA 3ZP4A 2HVYD 3IKEA 1UFYA 3NK6A 3CC7F 2CW4A 1PF5A 1FFXA 5GONA 2OTJF 2OTLF 2Z1EA 5AVMA 4B62A 4LNUB 1J7HA 5J2TA 2ZVYA 5ITZB 2VAPA 4O4HA 3RYHB 3R0PA 3C9SA 2CSLA 3M4SA 2CWJA 1QVFF 4HNAB 2VAMA 1SDSA 2HP0B 3VTIC 5BMVA 3S0WA 3N2GB 4TZZA 5C8YB 1JD1A 3VO8A 3CD6F 1IPAA 1FSZA 1VQVA 3JATA 5LXTB 4I4TA 4BT7A 3AGKA 5CA1A 3CC4F 1COMA 1KNKA 1RA4A 4O2AB 3JALB 3E22A 3OBYA 5JQGA 3VYTC 1DT9A 2CVLA 4F6RA 1W5BA 3HKBB 3ZOPA 3RE3A 3IEQA 2I6RA 3LMEA 4BT3A 4BT6A 1X52A 4B5CA 2BO1A 4YJ3A 1Q86H 4FFBA 1NQ3A 2HS4A 4IIJA 1GX1A 2HRYA 5CB4B 3CYPB 4X1KB 2IAFA 3MBMA 1YI2F 2QI2A 1VQOF 1KD1H 4C8GA 2UYPA 3KHNA 1SA0A 2Q1YA 4ZOLB 2HS3A 3OBWA 2OTMA 4C81A 3CCVF 2Q1XA 2ZAUA 1OFUA 5KMGB 2AMTA 3NMUC 1VQKF 4BVQA 1GZ0A 5G4UC 3K14A 1W42A 2HRUA 3QHDA 5IYZA 4ERHA 3IMPA 3I56F 4X1YB 3V7QA 1K8AH 5JCOC 5LP6B 2RHHA 3I7TA 2W8BC 4I50A 1FNJA 1T0AA 3I55F 4PWTA 1QU9A 3P4EA 4DRXB 3JVHA 2VGMA 2PHNA 3PAFA 1XV2A 1FFXB 5GONB 3TD4A 3HKCA 3PLAC 1S72F 1IV3A 3JAKA 3JASA 5J2TB 3WGMA 4O4HB 3P10A 1JJ2F 2KTUA 4U39A 2ZVZA 4U3JA 5J2UA 5HY1A 5HY0A 5BMVB 3FPIA 5LA6A 4R40B 4WBNA 1R1MA 2ZOVA 3K2XA 4O4LA 4NUTA 3B6NA 3CG6A 3S06A 1VQNF 5JH7A 4NQ3A 4ZI7A 3JATB 1Q8RA 3GYQA 4O2BA 5GIPC 2UZHA 4I4TB 5GINC 2BTUA 2EWCA 3FBAA 1X7PA 5CA1B 3F6MA 2RB9A 1RLUA 3E22B 1ZWZA 5JQGB 1TVKA 4ZHQA 1U3PA 1W3EX 4F6RB 2OHWA 3LWVC 1PXWA 1CK2A 2CHSA 5JVDA 1VQ4F 2ZODA 5KX5A 2LCAA 2Z1UA 1YITF 4YJ3B 5G4VC 4O4IA 3HKDA 1ODEA 4FFBB 4IIJB 3RYIA 2B33A 3SIUA 2R751 4G4VA 3IEWA 4BW0B 4M8IA 1X25A 3DDNA 2DT4A 4B45A 3CMAF 1DBFA 2LBTA 2RHJA 1Q82H 1JY8A 1SA0B 2LBXA 4G4YA 4DXDA 4BVRA 3CXCF 2BTQB 1W5EA 1YJ9F 1CN7A 5HY4A 4BT2A 2WALA 1U40A 3WXMB 5IJ9A 1OAPA 5MN4A 3CPWF 1YJNF 4ZHWA 3VCZA 5MN5A 3KJJA 3RYFA 1N8RH 3OONA 4I55A 2KGWA 1KC8H 4RHAA 1YGYA 3CPQA 2K1SA 5DCVA 4XCQA 5IYZB 3MQWA 4G4XA 2YXZA 3J81M 3ZP7A 3VMFB 1FNKA 3KIZA 4I50B 4B46A 2UYNA 1YJWF 4EI7A 3G4SF 1QD9A 3WPWA 3UT5A 2PMPA 4EI9A 3MCAB 4TV9A 1VQLF 3HKCB 3CCUF 2F9ZC 3JAKB 3JASB 1W57A 3ZO8A 3QUWA 3V4DA 2OZBA 2GVIA 5EAZA 4U3JB 5J2UB 3JAWA 5LA6B 3WJPA 2HP0A 2I6DA 4WBNB 5FNVA 4O4LB 4RQOA 5GAPK 5JH7B 4ZI7B 3VI6A 1U3LA 4O2BB 2AIZP 3ESJA 3VIUA 2BTOA 3GTZA 1TUBA 5A2QM 4C4WC 5EB0A 3HTNA 2YYEA 1H48A 1TVKB 4ZHQB 3LWQC 1H7MA 5LYJA 2JNBA 1Z5WA 3VOBA 5JVDB 3JCMM 5GIOC 1YHQF 3M84A 1RLGA 5LP6C 4O4IB 4TUYA 3HKDB 1VH8A 4NWOB 2VAWA 4G88A 5EB1B 1YQNA 3LWRC 4X20A 3RYIB 3G71F 1Q7YH 1W40A 1QAHA 4X3MA 3CCSF 4TV8A 3QTYA 3HKEA 1VQ8F 1M90H 5IJ0A 3N2KA 3CYQA 1XHOA 3JAMM 1W59A 3CC2F 4C8IA 5LOVA 1X7OA 3O85A 1VQ6F 5HXZA 5CA0A 4KWEA 4EB6A 5IJ9B 2H8CA 3M1XA 4YJ2A 2CHTA 4I55B 3RA6A 3J80M 5JCOA 3RA5A 1GO0A 3V7EA 2Z01A 4BY9D 5HXUA 1GO1A 5EWRA 2R6R1 3F0EA 1KQSF 3WJRA 1IV1A 2UYNB 1K73H 2Z1TA 3K12A 5EYPA 1VQPF 1T0KB 3KE1A 3ERNA 4LCKA 4DRXA 3LWPC 4TV9B 1NMUB 1XRGA 3WJQA 1NJIH 1VK3A 4IHJA 3CB2A 4X1IA 2UYJA 3HAXD 4G4ZA 3NVKE 3E1YA 5EZYA 3J7AR 3RYCA 3JAWB 2FC3A 1VQMF 5FNVB 3VYUC 2KG4A 3U0OA 5FLXM 5EO3A 3TD5A 2H8EA 1IV2A 3FFMA 4ZK7A 2AIFA 3K0TA 1JN1A 3DC2A 4O4JA 4BVTA 1YIJF 3GHZA 5MN6A 1TUBB 4C8EA 1W2BF 3NVIB 3ON1A 5EIBC
chains in the Genus database with same CATH topology
3CCRF 3VI6A 3NK6A 3CC7F 2OTJF 5HY1A 2OTLF 5HY0A 3CCJF 4NUTA 3CG6A 5A2QM 5GANK 1VQNF 1QVFF 4C4WC 4NQ3A 1SDSA 3GYQA 1QVGF 5GIPC 3LWQC 5GINC 1H7MA 2JNBA 4TZZA 3JCMM 5GIOC 1YHQF 3HJWC 1X7PA 3D00A 5HY2A 1RLGA 3CD6F 1IPAA 3NK7A 3CMEF 1ZWZA 1VQ9F 3LWRC 2FGYA 3G71F 1W3EX 1Q7YH 1W40A 2OHWA 4X3MA 3LWVC 1PXWA 1CK2A 3AGKA 4BVSA 1VQ4F 3CCSF 1YITF 3CC4F 1RA4A 5G4VC 1VQ8F 1M90H 3OBYA 1DT9A 3CCLF 3SIUA 1Q81H 3JAMM 3CC2F 1X7OA 1XBIA 3O85A 1X52A 3E20B 3N4ZA 2BO1A 4BW0B 3LFOA 1M1KH 1VQ6F 1Q86H 3LWOC 5HXZA 1Q82H 3CMAF 2KTVA 4X3LA 2LBXA 3CXCF 4BVRA 1YI2F 2QI2A 3RA6A 1VQOF 3J80M 1KD1H 1YJ9F 1CN7A 3RA5A 5HY4A 2LBWA 1GO0A 2VGNA 2WALA 3V7EA 3WXMB 4BY9D 1W41A 5HXUA 3CPWF 1GO1A 5EWRA 1YJNF 1N8RH 3OW2F 3OBWA 1KC8H 1KQSF 3CCVF 3CPQA 2ALEA 5DCVA 4XCQA 1K73H 1VQPF 5IT9M 3CCQF 1T0KB 3J81M 3VMFB 3IR9A 3NMUC 1VQKF 4LCKA 4BVQA 1GZ0A 5FJ4C 5HWEA 3LWPC 5G4UC 2CZWA 1NMUB 1NJIH 1W42A 1YJWF 2QA4F 3I56F 3HAXD 4EI7A 3G4SF 2QEXF 3V7QA 1K8AH 3G6EF 3V3TA 3NVKE 4EI9A 3E1YA 3MCAB 1VQ5F 3CCEF 1VQLF 3J7AR 3CCUF 3I55F 3SIVA 1K9MH 2F9ZC 2GLZA 2FC3A 1VQMF 2KG4A 5FLXM 2VGMA 5EO3A 3PAFA 2OZBA 1VQ7F 3FFMA 4EI8A 2AIFA 3PLAC 1S72F 4BVTA 3CCMF 1YIJF 2I6DA 1E7KA 1JJ2F 1W2BF 3NVIB 3N4YA 3ON1A 2HVYD 5GAPK 2KTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR F;  3VI6 A;  3NK6 A;  3CC7 F;  2OTJ F;  2OTL F;  3CCJ F;  4NUT A;  3CG6 A;  5A2Q M;  5GAN K;  1VQN F;  1QVF F;  4C4W C;  1SDS A;  3GYQ A;  1QVG F;  5GIP C;  3LWQ C;  5GIN C;  1H7M A;  2JNB A;  4TZZ A;  3JCM M;  5GIO C;  1YHQ F;  3HJW C;  1X7P A;  1RLG A;  3CD6 F;  1IPA A;  3NK7 A;  3CME F;  1ZWZ A;  1VQ9 F;  3LWR C;  3G71 F;  1W3E X;  1Q7Y H;  1W40 A;  2OHW A;  4X3M A;  3LWV C;  1PXW A;  1CK2 A;  3AGK A;  1VQ4 F;  3CCS F;  1YIT F;  3CC4 F;  1RA4 A;  5G4V C;  1VQ8 F;  1M90 H;  3OBY A;  1DT9 A;  3CCL F;  3SIU A;  1Q81 H;  3JAM M;  3CC2 F;  1X7O A;  1XBI A;  3O85 A;  1X52 A;  3E20 B;  3N4Z A;  2BO1 A;  4BW0 B;  3LFO A;  1M1K H;  1VQ6 F;  1Q86 H;  3LWO C;  1Q82 H;  3CMA F;  2KTV A;  4X3L A;  2LBX A;  3CXC F;  1YI2 F;  2QI2 A;  3RA6 A;  1VQO F;  3J80 M;  1KD1 H;  1YJ9 F;  1CN7 A;  3RA5 A;  1GO0 A;  2LBW A;  2VGN A;  2WAL A;  3V7E A;  3WXM B;  4BY9 D;  1W41 A;  3CPW F;  1YJN F;  1GO1 A;  5EWR A;  1N8R H;  3OW2 F;  3OBW A;  1KC8 H;  1KQS F;  3CCV F;  3CPQ A;  2ALE A;  5DCV A;  1K73 H;  1VQP F;  5IT9 M;  3CCQ F;  1T0K B;  3J81 M;  3VMF B;  3IR9 A;  3NMU C;  1VQK F;  4LCK A;  1GZ0 A;  5FJ4 C;  5G4U C;  3LWP C;  2CZW A;  1NMU B;  1NJI H;  1W42 A;  1YJW F;  2QA4 F;  3I56 F;  3HAX D;  3G4S F;  2QEX F;  3V7Q A;  1K8A H;  3G6E F;  3NVK E;  3E1Y A;  3MCA B;  1VQ5 F;  3CCE F;  1VQL F;  3J7A R;  3CCU F;  3I55 F;  3SIV A;  1K9M H;  2FC3 A;  1VQM F;  2KG4 A;  5FLX M;  2VGM A;  5EO3 A;  3PAF A;  2OZB A;  1VQ7 F;  3FFM A;  2AIF A;  3PLA C;  1S72 F;  3CCM F;  1YIJ F;  2I6D A;  1E7K A;  1JJ2 F;  1W2B F;  3NVI B;  3N4Y A;  3ON1 A;  2HVY D;  5GAP K;  2KTU A; 
#chains in the Genus database with same CATH topology
 3CCR F;  3JAR A;  5LYJ B;  1JFF A;  3S02 A;  3CCJ F;  2N48 A;  1CLI A;  2HS0 A;  5EIB D;  5GAN K;  2L26 A;  4TUY B;  4C82 A;  3S03 A;  1QVG F;  4X20 B;  4LNU A;  5ITZ A;  3HJW C;  3RYH A;  4BT4 A;  1W5A A;  4TV8 B;  1ONI A;  3D01 A;  1VHA A;  3D00 A;  5HY2 A;  3HKE B;  4HNA A;  1UI9 A;  2UYK A;  3NK7 A;  2MQE A;  5IJ0 B;  3CME F;  1VQ9 F;  2IG8 A;  4ZHY B;  2FGY A;  3N2K B;  3WGK A;  2ZF8 A;  3C8L A;  3N2G A;  2HP3 A;  2NMU A;  5C8Y A;  4BVS A;  5LOV B;  2DYY A;  3C9U A;  3WGL A;  3P0Z A;  2P6Y A;  5CA0 B;  1Z5V A;  3FD6 A;  4EB6 B;  3CCL F;  2RHO A;  5LXT A;  1IV4 A;  1Q81 H;  2G9I A;  2HQS C;  1XBI A;  3KJK A;  4YJ2 B;  3E20 B;  3N4Z A;  3LFO A;  1M1K H;  2GZL A;  4O2A A;  4G4W A;  3JAL A;  3LWO C;  1RQ7 A;  2QTP A;  3TD3 A;  5KX5 B;  3VOA A;  3I3F A;  2KTV A;  3L7Q A;  3LYB A;  3HKB A;  3T80 A;  4X3L A;  3F0D A;  3C9T A;  3LDT A;  2LBW A;  3EOR A;  2VGN A;  1U43 A;  1W41 A;  5EYP B;  5CB4 A;  4X1K A;  3OW2 F;  3WGJ A;  2HX0 A;  2VXY A;  3C9R A;  1W58 1;  1RQ2 A;  2ALE A;  4BT5 A;  2RHL A;  3MCQ A;  1H47 A;  4IHJ B;  4X1I B;  3MDO A;  5IT9 M;  3BYQ A;  3CCQ F;  2IQQ A;  4ZOL A;  3WGN A;  3IR9 A;  3D54 A;  5FJ4 C;  5HWE A;  3HWU A;  5EZY B;  2CZW A;  2V9Y A;  4ZHV A;  3RYC B;  3RYF B;  5KMG A;  2QA4 F;  3IKF A;  3S0H A;  2QEX F;  3WPX A;  3G6E F;  3V3T A;  3F0F A;  1VQ5 F;  5B8F A;  3CCE F;  3SIV A;  1K9M H;  4O4J B;  2GLZ A;  1W5F A;  4E6E A;  5HP8 A;  2H6L A;  4X1Y A;  1VQ7 F;  4EI8 A;  5LP6 A;  3Q8H A;  2Z1F A;  3ELC A;  3VYS C;  1SZQ A;  3JAR B;  1JFF B;  3UT5 B;  3CCM F;  1W55 A;  1E7K A;  3FD5 A;  5HP7 A;  3F0G A;  3N4Y A;  1KNJ A;  3S0Y A;  3ZP4 A;  2HVY D;  3IKE A;  1UFY A;  3NK6 A;  3CC7 F;  2CW4 A;  1PF5 A;  1FFX A;  5GON A;  2OTJ F;  2OTL F;  2Z1E A;  5AVM A;  4B62 A;  4LNU B;  1J7H A;  5J2T A;  2ZVY A;  5ITZ B;  2VAP A;  4O4H A;  3RYH B;  3R0P A;  3C9S A;  2CSL A;  3M4S A;  2CWJ A;  1QVF F;  4HNA B;  2VAM A;  1SDS A;  2HP0 B;  3VTI C;  5BMV A;  3S0W A;  3N2G B;  4TZZ A;  5C8Y B;  1JD1 A;  3VO8 A;  3CD6 F;  1IPA A;  1FSZ A;  1VQV A;  3JAT A;  5LXT B;  4I4T A;  4BT7 A;  3AGK A;  5CA1 A;  3CC4 F;  1COM A;  1KNK A;  1RA4 A;  4O2A B;  3JAL B;  3E22 A;  3OBY A;  5JQG A;  3VYT C;  1DT9 A;  2CVL A;  4F6R A;  1W5B A;  3HKB B;  3ZOP A;  3RE3 A;  3IEQ A;  2I6R A;  3LME A;  4BT3 A;  4BT6 A;  1X52 A;  4B5C A;  2BO1 A;  4YJ3 A;  1Q86 H;  4FFB A;  1NQ3 A;  2HS4 A;  4IIJ A;  1GX1 A;  2HRY A;  5CB4 B;  3CYP B;  4X1K B;  2IAF A;  3MBM A;  1YI2 F;  2QI2 A;  1VQO F;  1KD1 H;  4C8G A;  2UYP A;  3KHN A;  1SA0 A;  2Q1Y A;  4ZOL B;  2HS3 A;  3OBW A;  2OTM A;  4C81 A;  3CCV F;  2Q1X A;  2ZAU A;  1OFU A;  5KMG B;  2AMT A;  3NMU C;  1VQK F;  4BVQ A;  1GZ0 A;  5G4U C;  3K14 A;  1W42 A;  2HRU A;  3QHD A;  5IYZ A;  4ERH A;  3IMP A;  3I56 F;  4X1Y B;  3V7Q A;  1K8A H;  5JCO C;  5LP6 B;  2RHH A;  3I7T A;  2W8B C;  4I50 A;  1FNJ A;  1T0A A;  3I55 F;  4PWT A;  1QU9 A;  3P4E A;  4DRX B;  3JVH A;  2VGM A;  2PHN A;  3PAF A;  1XV2 A;  1FFX B;  5GON B;  3TD4 A;  3HKC A;  3PLA C;  1S72 F;  1IV3 A;  3JAK A;  3JAS A;  5J2T B;  3WGM A;  4O4H B;  3P10 A;  1JJ2 F;  2KTU A;  4U39 A;  2ZVZ A;  4U3J A;  5J2U A;  5HY1 A;  5HY0 A;  5BMV B;  3FPI A;  5LA6 A;  4R40 B;  4WBN A;  1R1M A;  2ZOV A;  3K2X A;  4O4L A;  4NUT A;  3B6N A;  3CG6 A;  3S06 A;  1VQN F;  5JH7 A;  4NQ3 A;  4ZI7 A;  3JAT B;  1Q8R A;  3GYQ A;  4O2B A;  5GIP C;  2UZH A;  4I4T B;  5GIN C;  2BTU A;  2EWC A;  3FBA A;  1X7P A;  5CA1 B;  3F6M A;  2RB9 A;  1RLU A;  3E22 B;  1ZWZ A;  5JQG B;  1TVK A;  4ZHQ A;  1U3P A;  1W3E X;  4F6R B;  2OHW A;  3LWV C;  1PXW A;  1CK2 A;  2CHS A;  5JVD A;  1VQ4 F;  2ZOD A;  5KX5 A;  2LCA A;  2Z1U A;  1YIT F;  4YJ3 B;  5G4V C;  4O4I A;  3HKD A;  1ODE A;  4FFB B;  4IIJ B;  3RYI A;  2B33 A;  3SIU A;  2R75 1;  4G4V A;  3IEW A;  4BW0 B;  4M8I A;  1X25 A;  3DDN A;  2DT4 A;  4B45 A;  3CMA F;  1DBF A;  2LBT A;  2RHJ A;  1Q82 H;  1JY8 A;  1SA0 B;  2LBX A;  4G4Y A;  4DXD A;  4BVR A;  3CXC F;  2BTQ B;  1W5E A;  1YJ9 F;  1CN7 A;  5HY4 A;  4BT2 A;  2WAL A;  1U40 A;  3WXM B;  5IJ9 A;  1OAP A;  5MN4 A;  3CPW F;  1YJN F;  4ZHW A;  3VCZ A;  5MN5 A;  3KJJ A;  3RYF A;  1N8R H;  3OON A;  4I55 A;  2KGW A;  1KC8 H;  4RHA A;  1YGY A;  3CPQ A;  2K1S A;  5DCV A;  4XCQ A;  5IYZ B;  3MQW A;  4G4X A;  2YXZ A;  3J81 M;  3ZP7 A;  3VMF B;  1FNK A;  3KIZ A;  4I50 B;  4B46 A;  2UYN A;  1YJW F;  4EI7 A;  3G4S F;  1QD9 A;  3WPW A;  3UT5 A;  2PMP A;  4EI9 A;  3MCA B;  4TV9 A;  1VQL F;  3HKC B;  3CCU F;  2F9Z C;  3JAK B;  3JAS B;  1W57 A;  3ZO8 A;  3QUW A;  3V4D A;  2OZB A;  2GVI A;  5EAZ A;  4U3J B;  5J2U B;  3JAW A;  5LA6 B;  3WJP A;  2HP0 A;  2I6D A;  4WBN B;  5FNV A;  4O4L B;  4RQO A;  5GAP K;  5JH7 B;  4ZI7 B;  3VI6 A;  1U3L A;  4O2B B;  2AIZ P;  3ESJ A;  3VIU A;  2BTO A;  3GTZ A;  1TUB A;  5A2Q M;  4C4W C;  5EB0 A;  3HTN A;  2YYE A;  1H48 A;  1TVK B;  4ZHQ B;  3LWQ C;  1H7M A;  5LYJ A;  2JNB A;  1Z5W A;  3VOB A;  5JVD B;  3JCM M;  5GIO C;  1YHQ F;  3M84 A;  1RLG A;  5LP6 C;  4O4I B;  4TUY A;  3HKD B;  1VH8 A;  4NWO B;  2VAW A;  4G88 A;  5EB1 B;  1YQN A;  3LWR C;  4X20 A;  3RYI B;  3G71 F;  1Q7Y H;  1W40 A;  1QAH A;  4X3M A;  3CCS F;  4TV8 A;  3QTY A;  3HKE A;  1VQ8 F;  1M90 H;  5IJ0 A;  3N2K A;  3CYQ A;  1XHO A;  3JAM M;  1W59 A;  3CC2 F;  4C8I A;  5LOV A;  1X7O A;  3O85 A;  1VQ6 F;  5HXZ A;  5CA0 A;  4KWE A;  4EB6 A;  5IJ9 B;  2H8C A;  3M1X A;  4YJ2 A;  2CHT A;  4I55 B;  3RA6 A;  3J80 M;  5JCO A;  3RA5 A;  1GO0 A;  3V7E A;  2Z01 A;  4BY9 D;  5HXU A;  1GO1 A;  5EWR A;  2R6R 1;  3F0E A;  1KQS F;  3WJR A;  1IV1 A;  2UYN B;  1K73 H;  2Z1T A;  3K12 A;  5EYP A;  1VQP F;  1T0K B;  3KE1 A;  3ERN A;  4LCK A;  4DRX A;  3LWP C;  4TV9 B;  1NMU B;  1XRG A;  3WJQ A;  1NJI H;  1VK3 A;  4IHJ A;  3CB2 A;  4X1I A;  2UYJ A;  3HAX D;  4G4Z A;  3NVK E;  3E1Y A;  5EZY A;  3J7A R;  3RYC A;  3JAW B;  2FC3 A;  1VQM F;  5FNV B;  3VYU C;  2KG4 A;  3U0O A;  5FLX M;  5EO3 A;  3TD5 A;  2H8E A;  1IV2 A;  3FFM A;  4ZK7 A;  2AIF A;  3K0T A;  1JN1 A;  3DC2 A;  4O4J A;  4BVT A;  1YIJ F;  3GHZ A;  5MN6 A;  1TUB B;  4C8E A;  1W2B F;  3NVI B;  3ON1 A;  5EIB C; 
#chains in the Genus database with same CATH homology
 3CCR F;  3VI6 A;  3NK6 A;  3CC7 F;  2OTJ F;  5HY1 A;  2OTL F;  5HY0 A;  3CCJ F;  4NUT A;  3CG6 A;  5A2Q M;  5GAN K;  1VQN F;  1QVF F;  4C4W C;  4NQ3 A;  1SDS A;  3GYQ A;  1QVG F;  5GIP C;  3LWQ C;  5GIN C;  1H7M A;  2JNB A;  4TZZ A;  3JCM M;  5GIO C;  1YHQ F;  3HJW C;  1X7P A;  3D00 A;  5HY2 A;  1RLG A;  3CD6 F;  1IPA A;  3NK7 A;  3CME F;  1ZWZ A;  1VQ9 F;  3LWR C;  2FGY A;  3G71 F;  1W3E X;  1Q7Y H;  1W40 A;  2OHW A;  4X3M A;  3LWV C;  1PXW A;  1CK2 A;  3AGK A;  4BVS A;  1VQ4 F;  3CCS F;  1YIT F;  3CC4 F;  1RA4 A;  5G4V C;  1VQ8 F;  1M90 H;  3OBY A;  1DT9 A;  3CCL F;  3SIU A;  1Q81 H;  3JAM M;  3CC2 F;  1X7O A;  1XBI A;  3O85 A;  1X52 A;  3E20 B;  3N4Z A;  2BO1 A;  4BW0 B;  3LFO A;  1M1K H;  1VQ6 F;  1Q86 H;  3LWO C;  5HXZ A;  1Q82 H;  3CMA F;  2KTV A;  4X3L A;  2LBX A;  3CXC F;  4BVR A;  1YI2 F;  2QI2 A;  3RA6 A;  1VQO F;  3J80 M;  1KD1 H;  1YJ9 F;  1CN7 A;  3RA5 A;  5HY4 A;  2LBW A;  1GO0 A;  2VGN A;  2WAL A;  3V7E A;  3WXM B;  4BY9 D;  1W41 A;  5HXU A;  3CPW F;  1GO1 A;  5EWR A;  1YJN F;  1N8R H;  3OW2 F;  3OBW A;  1KC8 H;  1KQS F;  3CCV F;  3CPQ A;  2ALE A;  5DCV A;  4XCQ A;  1K73 H;  1VQP F;  5IT9 M;  3CCQ F;  1T0K B;  3J81 M;  3VMF B;  3IR9 A;  3NMU C;  1VQK F;  4LCK A;  4BVQ A;  1GZ0 A;  5FJ4 C;  5HWE A;  3LWP C;  5G4U C;  2CZW A;  1NMU B;  1NJI H;  1W42 A;  1YJW F;  2QA4 F;  3I56 F;  3HAX D;  4EI7 A;  3G4S F;  2QEX F;  3V7Q A;  1K8A H;  3G6E F;  3V3T A;  3NVK E;  4EI9 A;  3E1Y A;  3MCA B;  1VQ5 F;  3CCE F;  1VQL F;  3J7A R;  3CCU F;  3I55 F;  3SIV A;  1K9M H;  2F9Z C;  2GLZ A;  2FC3 A;  1VQM F;  2KG4 A;  5FLX M;  2VGM A;  5EO3 A;  3PAF A;  2OZB A;  1VQ7 F;  3FFM A;  4EI8 A;  2AIF A;  3PLA C;  1S72 F;  4BVT A;  3CCM F;  1YIJ F;  2I6D A;  1E7K A;  1JJ2 F;  1W2B F;  3NVI B;  3N4Y A;  3ON1 A;  2HVY D;  5GAP K;  2KTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...