3RA5A

Crystal structure of t. celer l30e e6a/r92a variant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MVDFAFALRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 26
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra5A00
2WALA 1VQOF 3LFOA 4X3MA 3I55F 1K8AH 1VQ6F 3J7AR 3SIUA 3PAFA 1PXWA 1IPAA 3N4YA 3CC7F 1QVFF 3RA5A 3LWPC 5EO3A 2JNBA 3CCMF 3CPQA 3NK6A 3OBWA 1VQ8F 3CMAF 3CCQF 3J80M 1GO1A 1VQPF 4C4WC 1GZ0A 3V7EA 2OTJF 2AIFA 3J81M 3WXMB 4BW0B 1YJNF 3V7QA 1W2BF 1NJIH 2I6DA 1KD1H 1W41A 1W3EX 1VQ7F 3NMUC 4BY9D 2LBWA 2VGMA 3CC2F 5GAPK 4LCKA 2LBXA 2KTUA 5GANK 3PLAC 1GO0A 4NUTA 3OBYA 5IT9M 3HJWC 1VQKF 1YIJF 3NVIB 1Q7YH 3VMFB 5DCVA 5GINC 2KTVA 1RA4A 3MCAB 3RA6A 2OZBA 2QEXF 5GIOC 5FLXM 3OW2F 1ZWZA 1T0KB 3E20B 3AGKA 1CN7A 1E7KA 5G4VC 2BO1A 3CPWF 3IR9A 1YHQF 2QA4F 1Q86H 5GIPC 1JJ2F 3HAXD 3N4ZA 1VQLF 1X7OA 1DT9A 1Q81H 3ON1A 5FJ4C 2OTLF 3CMEF 1YITF 1K9MH 3CCJF 5EWRA 4TZZA 2CZWA 3FFMA 1VQ9F 1W40A 3CXCF 1K73H 3JCMM 3G4SF 3LWQC 5A2QM 1M90H 1VQ4F 2ALEA 1KC8H 3NVKE 1X7PA 1Q82H 1RLGA 5G4UC 1YJ9F 1SDSA 3I56F 3VI6A 2HVYD 3GYQA 3G6EF 2VGNA 3CCSF 4X3LA 3CD6F 1VQMF 3E1YA 1CK2A 1W42A 1NMUB 3LWOC 3CCVF 3SIVA 1H7MA 3CCUF 3NK7A 1XBIA 3JAMM 3CCRF 3CCEF 3LWRC 2OHWA 3G71F 1YJWF 1YI2F 2QI2A 1VQ5F 1VQNF 1KQSF 1N8RH 3O85A 1QVGF 3CCLF 1X52A 1S72F 1M1KH 2KG4A 3LWVC 2FC3A 3CG6A 3CC4F
chains in the Genus database with same CATH superfamily
2WALA 5CA0B 1Z5VA 4TUYB 2Z1FA 4X3MA 3J7AR 3SIUA 2L26A 1H48A 3BYQA 3K12A 3RA5A 2BTQB 4HNAB 1XHOA 4E6EA 5BMVB 5IJ9A 3K14A 1NQ3A 3K2XA 3OBWA 3F0GA 5ITZB 5B8FA 1VQ8F 5CA1B 3CMAF 1VQPF 2R751 2HRUA 3WXMB 1NJIH 3CYPB 3V7QA 3WJQA 3MBMA 2OTMA 4ZI7A 1KD1H 3WGJA 5EB0A 4ZHVA 2AMTA 2LBTA 1VQ7F 3NMUC 1RQ2A 3GHZA 1TUBB 2VGMA 4TV8A 5GAPK 3TD3A 2KTUA 5GANK 5IYZA 4O2BB 4ZOLA 3MCQA 2Q1XA 4O4JB 5EZYB 5IT9M 1JD1A 5LYJA 3NVIB 2ZODA 3C9RA 5DCVA 4G4WA 3MCAB 3RA6A 2QEXF 3WGKA 3OW2F 3S03A 5HY1A 1T0KB 1FFXA 1E7KA 1W5EA 3IR9A 1YHQF 3N2GA 1PF5A 4O4LA 1JJ2F 2BTUA 3JAWA 1DT9A 1X7OA 3RYFB 1Q81H 3ON1A 4FFBA 5FJ4C 4I50A 1SA0A 3RYIA 3F0EA 1VK3A 4O4IA 4B46A 3IMPA 4TV9A 1W40A 3LWQC 1VQ4F 4KWEA 5G4UC 3RYHA 4C81A 4C8GA 1SDSA 2UYNB 2DYYA 5FNVA 2HVYD 2KGWA 1W5AA 3GYQA 5LP6C 3WJPA 3G6EF 4I55A 1JFFA 2IAFA 3CCSF 3P0ZA 3JVHA 4BT4A 5J2TB 2PMPA 1CK2A 3E1YA 1NMUB 3SIVA 3NK7A 4YJ3A 5LXTA 3CCRF 1TVKA 3JATB 3LWRC 5GONB 4G4YA 2I6RA 5CA1A 1QAHA 3WGMA 4G4VA 4B45A 5JQGA 4PWTA 4RQOA 1QVGF 3CCLF 4O2AA 3LDTA 4X1KB 3CYQA 4WBNB 1M1KH 3IKEA 2FC3A 5KMGB 1TUBA 1VHAA 3CG6A 1ODEA 4C82A 5LOVA 2IQQA 3HKDB 1QD9A 3WJRA 2R6R1 4O2BA 1K8AH 2HP0A 1VQ6F 3LMEA 3I7TA 3PAFA 4X20A 3N4YA 3CC7F 4U3JA 2AIZP 4ERHA 2JNBA 2CHTA 4F6RA 1Q8RA 3FD5A 4EI8A 5KX5B 1JY8A 4C8EA 3U0OA 2GLZA 3HKBA 4IHJA 1GO1A 3WPWA 3VYSC 2OTJF 5CB4A 5EIBD 1Z5WA 4M8IA 4BW0B 3DC2A 4O4HA 2VAPA 4ZHQB 3MQWA 3JARA 3KHNA 2I6DA 2RHOA 1W41A 2HS3A 3KJJA 5MN6A 3DDNA 3QTYA 3ZP7A 3CC2F 2LBXA 3D54A 3FBAA 1ONIA 2UZHA 3RYCB 1GO0A 1FSZA 2V9YA 2RB9A 2MQEA 3RE3A 2Q1YA 5C8YA 4RHAA 4BVRA 4DRXA 4EB6B 3JALA 2RHHA 1JN1A 2UYNA 1VQKF 3ZP4A 5JH7B 3F6MA 4BVTA 3VMFB 2ZOVA 5GINC 1YQNA 2ZAUA 3ERNA 2UYKA 3S02A 1FNJA 5FLXM 3Q8HA 1ZWZA 4IIJA 5J2TA 3AGKA 5IJ0A 3LYBA 1KNKA 4LNUB 3HAXD 4BVSA 5JVDA 3JATA 3EORA 3HKCA 2OTLF 3CMEF 3ZO8A 3CCJF 4X1YB 1U3PA 4TZZA 5LP6A 1VQ9F 1H47A 3JCMM 3G4SF 3S0WA 4WBNA 3NVKE 3WGLA 3C9TA 3JASA 5EYPA 2Z1UA 3I56F 3HKDA 3UT5A 3E22B 5HY4A 2Z1EA 4BT2A 1IV1A 2VGNA 2PHNA 1RQ7A 3M84A 3VOAA 2GZLA 4ZK7A 1H7MA 3JAMM 3KE1A 2OHWA 1VH8A 4YJ2B 4I4TB 1YI2F 4R40B 1R1MA 1N8RH 3QHDA 4BT5A 3WPXA 4ZHQA 3O85A 1X52A 5AVMA 4X1IB 1S72F 1IV4A 5EAZA 2KG4A 3IEQA 5CA0A 3N2KB 3VIUA 4TUYA 2Z1TA 2CWJA 2DT4A 5JCOC 4NWOB 1W5BA 2CSLA 3VTIC 4EB6A 3GTZA 4HNAA 1PXWA 1IPAA 3HTNA 5BMVA 3LWPC 2W8BC 5EO3A 3ELCA 5ITZA 5JH7A 1W581 3NK6A 2EWCA 3VOBA 5IJ9B 1X25A 3KIZA 2HRYA 3V4DA 2NMUA 1GZ0A 3V7EA 4DXDA 2AIFA 2LCAA 3J81M 2G9IA 3F0FA 1IV2A 2P6YA 1W3EX 5LA6B 4G4ZA 3FD6A 5EIBC 5HP7A 4TV8B 1FNKA 4BVQA 3HKEB 4O4JA 2HS0A 5EZYA 1OFUA 2K1SA 2VAWA 1J7HA 5IYZB 5HXUA 4NUTA 4ZOLB 3VCZA 1U43A 5EB1B 1YIJF 3I3FA 3C9SA 3VO8A 3E22A 2ZF8A 1Q7YH 3OONA 1GX1A 5LYJB 2KTVA 1RA4A 5GIOC 1CN7A 2QTPA 3VYTC 3T80A 5G4VC 1W59A 2BO1A 4BT6A 3CPWF 3VYUC 4ZHYB 3RYFA 1FFXB 5GIPC 3N4ZA 1VQLF 3N2GB 4O4LB 5HXZA 4YJ2A 3JAWB 5J2UB 1YITF 4FFBB 4I50B 1SA0B 3RYIB 3C9UA 2H6LA 3P10A 2HS4A 3CXCF 4O4IB 1M90H 2CVLA 1RLGA 1YJ9F 3VI6A 1RLUA 2N48A 3RYHB 3D01A 2RHJA 5FNVB 1QU9A 2HQSC 5HWEA 3CB2A 3CD6F 4I55B 1JFFB 3S0HA 4BT3A 5GONA 2CW4A 3JAKB 3CCUF 2B33A 2Z01A 3CCEF 4YJ3B 5LXTB 1TVKB 1UFYA 3G71F 1YJWF 3K0TA 1VQ5F 1KQSF 5JCOA 3KJKA 4X1KA 1VQVA 5KMGA 5JQGB 5LA6A 3LWVC 4O2AB 2ZVZA 5LOVB 2YYEA 2ZVYA 3P4EA 1VQOF 3LFOA 5MN4A 4BT7A 3HKEA 3I55F 2RHLA 2FGYA 3FPIA 2HP0B 1QVFF 4X20B 5KX5A 2CHSA 3CCMF 3CPQA 1T0AA 4U3JB 3L7QA 4F6RB 2HP3A 3C8LA 3CCQF 3J80M 2GVIA 4C4WC 3HKBB 3IKFA 4IHJB 1W2BF 1YJNF 4ZHWA 3ZOPA 5CB4B 4O4HB 3B6NA 4EI7A 3JARB 4BY9D 3M1XA 2LBWA 1UI9A 4LCKA 5J2UA 4B62A 1DBFA 3RYCA 3MDOA 3PLAC 2UYPA 2BTOA 2F9ZC 1W5FA 3TD4A 3OBYA 3HJWC 5C8YB 4DRXB 3JALB 1OAPA 3QUWA 4B5CA 1U40A 2OZBA 4NQ3A 4LNUA 3E20B 5HY0A 5HY2A 1IV3A 4U39A 4IIJB 3M4SA 3JAKA 2QA4F 1Q86H 3D00A 3V3TA 4ZI7B 5IJ0B 1KNJA 2VXYA 4X1YA 4XCQA 5JVDB 3HWUA 3F0DA 1K9MH 3HKCB 3S06A 2IG8A 5EWRA 2CZWA 1U3LA 3FFMA 1K73H 5LP6B 4C8IA 5A2QM 2ALEA 1KC8H 1X7PA 1Q82H 1COMA 2H8EA 3WGNA 3JASB 2YXZA 5EYPB 2H8CA 3UT5B 4X3LA 1VQMF 3CCVF 1W42A 3LWOC 1XBIA 1SZQA 4I4TA 1XV2A 1XRGA 3IEWA 2QI2A 1VQNF 5MN5A 3S0YA 3ESJA 2VAMA 4G88A 4TV9B 4X1IA 3R0PA 1YGYA 4EI9A 1CLIA 3N2KA 4G4XA 3CC4F 2UYJA 5HP8A 2HX0A 1W55A 3TD5A 1W57A
chains in the Genus database with same CATH topology
2WALA 1VQOF 3LFOA 4X3MA 3I55F 2FGYA 1K8AH 1VQ6F 3J7AR 3SIUA 3PAFA 1PXWA 1IPAA 3N4YA 3CC7F 1QVFF 3RA5A 3LWPC 5EO3A 2JNBA 3CCMF 3CPQA 3NK6A 3OBWA 4EI8A 1VQ8F 2GLZA 3CMAF 3CCQF 3J80M 1GO1A 1VQPF 4C4WC 1GZ0A 3V7EA 2OTJF 2AIFA 3J81M 3WXMB 4BW0B 1YJNF 3V7QA 1W2BF 1NJIH 2I6DA 1KD1H 1W41A 1W3EX 4EI7A 1VQ7F 3NMUC 4BY9D 2LBWA 2VGMA 3CC2F 5GAPK 4LCKA 2LBXA 2KTUA 5GANK 4BVQA 3PLAC 1GO0A 2F9ZC 4BVRA 5HXUA 4NUTA 3OBYA 5IT9M 3HJWC 1VQKF 1YIJF 3NVIB 1Q7YH 4BVTA 3VMFB 5DCVA 5GINC 2KTVA 1RA4A 3MCAB 3RA6A 2OZBA 2QEXF 4NQ3A 5GIOC 5FLXM 3OW2F 1ZWZA 5HY1A 1T0KB 3E20B 3AGKA 5HY0A 5HY2A 1CN7A 1E7KA 5G4VC 2BO1A 3CPWF 3IR9A 1YHQF 2QA4F 1Q86H 3D00A 3V3TA 4BVSA 5GIPC 1JJ2F 3HAXD 3N4ZA 1VQLF 1X7OA 1DT9A 1Q81H 3ON1A 5FJ4C 4XCQA 5HXZA 2OTLF 3CMEF 1YITF 1K9MH 3CCJF 5EWRA 4TZZA 2CZWA 3FFMA 1VQ9F 1W40A 3CXCF 1K73H 3JCMM 3G4SF 3LWQC 5A2QM 1M90H 1VQ4F 2ALEA 1KC8H 3NVKE 1X7PA 1Q82H 1RLGA 5G4UC 1YJ9F 1SDSA 3I56F 3VI6A 2HVYD 5HY4A 3GYQA 3G6EF 2VGNA 5HWEA 3CCSF 4X3LA 3CD6F 1VQMF 3E1YA 1CK2A 1W42A 1NMUB 3LWOC 3CCVF 3SIVA 1H7MA 3CCUF 3NK7A 1XBIA 3JAMM 3CCRF 3CCEF 3LWRC 2OHWA 3G71F 1YJWF 1YI2F 2QI2A 1VQ5F 1VQNF 1KQSF 1N8RH 3O85A 1QVGF 3CCLF 4EI9A 1X52A 1S72F 1M1KH 2KG4A 3LWVC 2FC3A 3CG6A 3CC4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAL A;  1VQO F;  3LFO A;  4X3M A;  3I55 F;  1K8A H;  1VQ6 F;  3J7A R;  3SIU A;  3PAF A;  1PXW A;  1IPA A;  3N4Y A;  3CC7 F;  1QVF F;  3RA5 A;  3LWP C;  5EO3 A;  2JNB A;  3CCM F;  3CPQ A;  3NK6 A;  3OBW A;  1VQ8 F;  3CMA F;  3CCQ F;  3J80 M;  1GO1 A;  1VQP F;  4C4W C;  1GZ0 A;  3V7E A;  2OTJ F;  2AIF A;  3J81 M;  3WXM B;  4BW0 B;  1YJN F;  3V7Q A;  1W2B F;  1NJI H;  2I6D A;  1KD1 H;  1W41 A;  1W3E X;  1VQ7 F;  3NMU C;  4BY9 D;  2LBW A;  2VGM A;  3CC2 F;  5GAP K;  4LCK A;  2LBX A;  2KTU A;  5GAN K;  3PLA C;  1GO0 A;  4NUT A;  3OBY A;  5IT9 M;  3HJW C;  1VQK F;  1YIJ F;  3NVI B;  1Q7Y H;  3VMF B;  5DCV A;  5GIN C;  2KTV A;  1RA4 A;  3MCA B;  3RA6 A;  2OZB A;  2QEX F;  5GIO C;  5FLX M;  3OW2 F;  1ZWZ A;  1T0K B;  3E20 B;  3AGK A;  1CN7 A;  1E7K A;  5G4V C;  2BO1 A;  3CPW F;  3IR9 A;  1YHQ F;  2QA4 F;  1Q86 H;  5GIP C;  1JJ2 F;  3HAX D;  3N4Z A;  1VQL F;  1X7O A;  1DT9 A;  1Q81 H;  3ON1 A;  5FJ4 C;  2OTL F;  3CME F;  1YIT F;  1K9M H;  3CCJ F;  5EWR A;  4TZZ A;  2CZW A;  3FFM A;  1VQ9 F;  1W40 A;  3CXC F;  1K73 H;  3JCM M;  3G4S F;  3LWQ C;  5A2Q M;  1M90 H;  1VQ4 F;  2ALE A;  1KC8 H;  3NVK E;  1X7P A;  1Q82 H;  1RLG A;  5G4U C;  1YJ9 F;  1SDS A;  3I56 F;  3VI6 A;  2HVY D;  3GYQ A;  3G6E F;  2VGN A;  3CCS F;  4X3L A;  3CD6 F;  1VQM F;  3E1Y A;  1CK2 A;  1W42 A;  1NMU B;  3LWO C;  3CCV F;  3SIV A;  1H7M A;  3CCU F;  3NK7 A;  1XBI A;  3JAM M;  3CCR F;  3CCE F;  3LWR C;  2OHW A;  3G71 F;  1YJW F;  1YI2 F;  2QI2 A;  1VQ5 F;  1VQN F;  1KQS F;  1N8R H;  3O85 A;  1QVG F;  3CCL F;  1X52 A;  1S72 F;  1M1K H;  2KG4 A;  3LWV C;  2FC3 A;  3CG6 A;  3CC4 F; 
#chains in the Genus database with same CATH topology
 2WAL A;  5CA0 B;  1Z5V A;  4TUY B;  2Z1F A;  4X3M A;  3J7A R;  3SIU A;  2L26 A;  1H48 A;  3BYQ A;  3K12 A;  3RA5 A;  2BTQ B;  4HNA B;  1XHO A;  4E6E A;  5BMV B;  5IJ9 A;  3K14 A;  1NQ3 A;  3K2X A;  3OBW A;  3F0G A;  5ITZ B;  5B8F A;  1VQ8 F;  5CA1 B;  3CMA F;  1VQP F;  2R75 1;  2HRU A;  3WXM B;  1NJI H;  3CYP B;  3V7Q A;  3WJQ A;  3MBM A;  2OTM A;  4ZI7 A;  1KD1 H;  3WGJ A;  5EB0 A;  4ZHV A;  2AMT A;  2LBT A;  1VQ7 F;  3NMU C;  1RQ2 A;  3GHZ A;  1TUB B;  2VGM A;  4TV8 A;  5GAP K;  3TD3 A;  2KTU A;  5GAN K;  5IYZ A;  4O2B B;  4ZOL A;  3MCQ A;  2Q1X A;  4O4J B;  5EZY B;  5IT9 M;  1JD1 A;  5LYJ A;  3NVI B;  2ZOD A;  3C9R A;  5DCV A;  4G4W A;  3MCA B;  3RA6 A;  2QEX F;  3WGK A;  3OW2 F;  3S03 A;  5HY1 A;  1T0K B;  1FFX A;  1E7K A;  1W5E A;  3IR9 A;  1YHQ F;  3N2G A;  1PF5 A;  4O4L A;  1JJ2 F;  2BTU A;  3JAW A;  1DT9 A;  1X7O A;  3RYF B;  1Q81 H;  3ON1 A;  4FFB A;  5FJ4 C;  4I50 A;  1SA0 A;  3RYI A;  3F0E A;  1VK3 A;  4O4I A;  4B46 A;  3IMP A;  4TV9 A;  1W40 A;  3LWQ C;  1VQ4 F;  4KWE A;  5G4U C;  3RYH A;  4C81 A;  4C8G A;  1SDS A;  2UYN B;  2DYY A;  5FNV A;  2HVY D;  2KGW A;  1W5A A;  3GYQ A;  5LP6 C;  3WJP A;  3G6E F;  4I55 A;  1JFF A;  2IAF A;  3CCS F;  3P0Z A;  3JVH A;  4BT4 A;  5J2T B;  2PMP A;  1CK2 A;  3E1Y A;  1NMU B;  3SIV A;  3NK7 A;  4YJ3 A;  5LXT A;  3CCR F;  1TVK A;  3JAT B;  3LWR C;  5GON B;  4G4Y A;  2I6R A;  5CA1 A;  1QAH A;  3WGM A;  4G4V A;  4B45 A;  5JQG A;  4PWT A;  4RQO A;  1QVG F;  3CCL F;  4O2A A;  3LDT A;  4X1K B;  3CYQ A;  4WBN B;  1M1K H;  3IKE A;  2FC3 A;  5KMG B;  1TUB A;  1VHA A;  3CG6 A;  1ODE A;  4C82 A;  5LOV A;  2IQQ A;  3HKD B;  1QD9 A;  3WJR A;  2R6R 1;  4O2B A;  1K8A H;  2HP0 A;  1VQ6 F;  3LME A;  3I7T A;  3PAF A;  4X20 A;  3N4Y A;  3CC7 F;  4U3J A;  2AIZ P;  4ERH A;  2JNB A;  2CHT A;  4F6R A;  1Q8R A;  3FD5 A;  4EI8 A;  5KX5 B;  1JY8 A;  4C8E A;  3U0O A;  2GLZ A;  3HKB A;  4IHJ A;  1GO1 A;  3WPW A;  3VYS C;  2OTJ F;  5CB4 A;  5EIB D;  1Z5W A;  4M8I A;  4BW0 B;  3DC2 A;  4O4H A;  2VAP A;  4ZHQ B;  3MQW A;  3JAR A;  3KHN A;  2I6D A;  2RHO A;  1W41 A;  2HS3 A;  3KJJ A;  5MN6 A;  3DDN A;  3QTY A;  3ZP7 A;  3CC2 F;  2LBX A;  3D54 A;  3FBA A;  1ONI A;  2UZH A;  3RYC B;  1GO0 A;  1FSZ A;  2V9Y A;  2RB9 A;  2MQE A;  3RE3 A;  2Q1Y A;  5C8Y A;  4RHA A;  4BVR A;  4DRX A;  4EB6 B;  3JAL A;  2RHH A;  1JN1 A;  2UYN A;  1VQK F;  3ZP4 A;  5JH7 B;  3F6M A;  4BVT A;  3VMF B;  2ZOV A;  5GIN C;  1YQN A;  2ZAU A;  3ERN A;  2UYK A;  3S02 A;  1FNJ A;  5FLX M;  3Q8H A;  1ZWZ A;  4IIJ A;  5J2T A;  3AGK A;  5IJ0 A;  3LYB A;  1KNK A;  4LNU B;  3HAX D;  4BVS A;  5JVD A;  3JAT A;  3EOR A;  3HKC A;  2OTL F;  3CME F;  3ZO8 A;  3CCJ F;  4X1Y B;  1U3P A;  4TZZ A;  5LP6 A;  1VQ9 F;  1H47 A;  3JCM M;  3G4S F;  3S0W A;  4WBN A;  3NVK E;  3WGL A;  3C9T A;  3JAS A;  5EYP A;  2Z1U A;  3I56 F;  3HKD A;  3UT5 A;  3E22 B;  5HY4 A;  2Z1E A;  4BT2 A;  1IV1 A;  2VGN A;  2PHN A;  1RQ7 A;  3M84 A;  3VOA A;  2GZL A;  4ZK7 A;  1H7M A;  3JAM M;  3KE1 A;  2OHW A;  1VH8 A;  4YJ2 B;  4I4T B;  1YI2 F;  4R40 B;  1R1M A;  1N8R H;  3QHD A;  4BT5 A;  3WPX A;  4ZHQ A;  3O85 A;  1X52 A;  5AVM A;  4X1I B;  1S72 F;  1IV4 A;  5EAZ A;  2KG4 A;  3IEQ A;  5CA0 A;  3N2K B;  3VIU A;  4TUY A;  2Z1T A;  2CWJ A;  2DT4 A;  5JCO C;  4NWO B;  1W5B A;  2CSL A;  3VTI C;  4EB6 A;  3GTZ A;  4HNA A;  1PXW A;  1IPA A;  3HTN A;  5BMV A;  3LWP C;  2W8B C;  5EO3 A;  3ELC A;  5ITZ A;  5JH7 A;  1W58 1;  3NK6 A;  2EWC A;  3VOB A;  5IJ9 B;  1X25 A;  3KIZ A;  2HRY A;  3V4D A;  2NMU A;  1GZ0 A;  3V7E A;  4DXD A;  2AIF A;  2LCA A;  3J81 M;  2G9I A;  3F0F A;  1IV2 A;  2P6Y A;  1W3E X;  5LA6 B;  4G4Z A;  3FD6 A;  5EIB C;  5HP7 A;  4TV8 B;  1FNK A;  4BVQ A;  3HKE B;  4O4J A;  2HS0 A;  5EZY A;  1OFU A;  2K1S A;  2VAW A;  1J7H A;  5IYZ B;  5HXU A;  4NUT A;  4ZOL B;  3VCZ A;  1U43 A;  5EB1 B;  1YIJ F;  3I3F A;  3C9S A;  3VO8 A;  3E22 A;  2ZF8 A;  1Q7Y H;  3OON A;  1GX1 A;  5LYJ B;  2KTV A;  1RA4 A;  5GIO C;  1CN7 A;  2QTP A;  3VYT C;  3T80 A;  5G4V C;  1W59 A;  2BO1 A;  4BT6 A;  3CPW F;  3VYU C;  4ZHY B;  3RYF A;  1FFX B;  5GIP C;  3N4Z A;  1VQL F;  3N2G B;  4O4L B;  5HXZ A;  4YJ2 A;  3JAW B;  5J2U B;  1YIT F;  4FFB B;  4I50 B;  1SA0 B;  3RYI B;  3C9U A;  2H6L A;  3P10 A;  2HS4 A;  3CXC F;  4O4I B;  1M90 H;  2CVL A;  1RLG A;  1YJ9 F;  3VI6 A;  1RLU A;  2N48 A;  3RYH B;  3D01 A;  2RHJ A;  5FNV B;  1QU9 A;  2HQS C;  5HWE A;  3CB2 A;  3CD6 F;  4I55 B;  1JFF B;  3S0H A;  4BT3 A;  5GON A;  2CW4 A;  3JAK B;  3CCU F;  2B33 A;  2Z01 A;  3CCE F;  4YJ3 B;  5LXT B;  1TVK B;  1UFY A;  3G71 F;  1YJW F;  3K0T A;  1VQ5 F;  1KQS F;  5JCO A;  3KJK A;  4X1K A;  1VQV A;  5KMG A;  5JQG B;  5LA6 A;  3LWV C;  4O2A B;  2ZVZ A;  5LOV B;  2YYE A;  2ZVY A;  3P4E A;  1VQO F;  3LFO A;  5MN4 A;  4BT7 A;  3HKE A;  3I55 F;  2RHL A;  2FGY A;  3FPI A;  2HP0 B;  1QVF F;  4X20 B;  5KX5 A;  2CHS A;  3CCM F;  3CPQ A;  1T0A A;  4U3J B;  3L7Q A;  4F6R B;  2HP3 A;  3C8L A;  3CCQ F;  3J80 M;  2GVI A;  4C4W C;  3HKB B;  3IKF A;  4IHJ B;  1W2B F;  1YJN F;  4ZHW A;  3ZOP A;  5CB4 B;  4O4H B;  3B6N A;  4EI7 A;  3JAR B;  4BY9 D;  3M1X A;  2LBW A;  1UI9 A;  4LCK A;  5J2U A;  4B62 A;  1DBF A;  3RYC A;  3MDO A;  3PLA C;  2UYP A;  2BTO A;  2F9Z C;  1W5F A;  3TD4 A;  3OBY A;  3HJW C;  5C8Y B;  4DRX B;  3JAL B;  1OAP A;  3QUW A;  4B5C A;  1U40 A;  2OZB A;  4NQ3 A;  4LNU A;  3E20 B;  5HY0 A;  5HY2 A;  1IV3 A;  4U39 A;  4IIJ B;  3M4S A;  3JAK A;  2QA4 F;  1Q86 H;  3D00 A;  3V3T A;  4ZI7 B;  5IJ0 B;  1KNJ A;  2VXY A;  4X1Y A;  4XCQ A;  5JVD B;  3HWU A;  3F0D A;  1K9M H;  3HKC B;  3S06 A;  2IG8 A;  5EWR A;  2CZW A;  1U3L A;  3FFM A;  1K73 H;  5LP6 B;  4C8I A;  5A2Q M;  2ALE A;  1KC8 H;  1X7P A;  1Q82 H;  1COM A;  2H8E A;  3WGN A;  3JAS B;  2YXZ A;  5EYP B;  2H8C A;  3UT5 B;  4X3L A;  1VQM F;  3CCV F;  1W42 A;  3LWO C;  1XBI A;  1SZQ A;  4I4T A;  1XV2 A;  1XRG A;  3IEW A;  2QI2 A;  1VQN F;  5MN5 A;  3S0Y A;  3ESJ A;  2VAM A;  4G88 A;  4TV9 B;  4X1I A;  3R0P A;  1YGY A;  4EI9 A;  1CLI A;  3N2K A;  4G4X A;  3CC4 F;  2UYJ A;  5HP8 A;  2HX0 A;  1W55 A;  3TD5 A;  1W57 A; 
#chains in the Genus database with same CATH homology
 2WAL A;  1VQO F;  3LFO A;  4X3M A;  3I55 F;  2FGY A;  1K8A H;  1VQ6 F;  3J7A R;  3SIU A;  3PAF A;  1PXW A;  1IPA A;  3N4Y A;  3CC7 F;  1QVF F;  3RA5 A;  3LWP C;  5EO3 A;  2JNB A;  3CCM F;  3CPQ A;  3NK6 A;  3OBW A;  4EI8 A;  1VQ8 F;  2GLZ A;  3CMA F;  3CCQ F;  3J80 M;  1GO1 A;  1VQP F;  4C4W C;  1GZ0 A;  3V7E A;  2OTJ F;  2AIF A;  3J81 M;  3WXM B;  4BW0 B;  1YJN F;  3V7Q A;  1W2B F;  1NJI H;  2I6D A;  1KD1 H;  1W41 A;  1W3E X;  4EI7 A;  1VQ7 F;  3NMU C;  4BY9 D;  2LBW A;  2VGM A;  3CC2 F;  5GAP K;  4LCK A;  2LBX A;  2KTU A;  5GAN K;  4BVQ A;  3PLA C;  1GO0 A;  2F9Z C;  4BVR A;  5HXU A;  4NUT A;  3OBY A;  5IT9 M;  3HJW C;  1VQK F;  1YIJ F;  3NVI B;  1Q7Y H;  4BVT A;  3VMF B;  5DCV A;  5GIN C;  2KTV A;  1RA4 A;  3MCA B;  3RA6 A;  2OZB A;  2QEX F;  4NQ3 A;  5GIO C;  5FLX M;  3OW2 F;  1ZWZ A;  5HY1 A;  1T0K B;  3E20 B;  3AGK A;  5HY0 A;  5HY2 A;  1CN7 A;  1E7K A;  5G4V C;  2BO1 A;  3CPW F;  3IR9 A;  1YHQ F;  2QA4 F;  1Q86 H;  3D00 A;  3V3T A;  4BVS A;  5GIP C;  1JJ2 F;  3HAX D;  3N4Z A;  1VQL F;  1X7O A;  1DT9 A;  1Q81 H;  3ON1 A;  5FJ4 C;  4XCQ A;  5HXZ A;  2OTL F;  3CME F;  1YIT F;  1K9M H;  3CCJ F;  5EWR A;  4TZZ A;  2CZW A;  3FFM A;  1VQ9 F;  1W40 A;  3CXC F;  1K73 H;  3JCM M;  3G4S F;  3LWQ C;  5A2Q M;  1M90 H;  1VQ4 F;  2ALE A;  1KC8 H;  3NVK E;  1X7P A;  1Q82 H;  1RLG A;  5G4U C;  1YJ9 F;  1SDS A;  3I56 F;  3VI6 A;  2HVY D;  5HY4 A;  3GYQ A;  3G6E F;  2VGN A;  5HWE A;  3CCS F;  4X3L A;  3CD6 F;  1VQM F;  3E1Y A;  1CK2 A;  1W42 A;  1NMU B;  3LWO C;  3CCV F;  3SIV A;  1H7M A;  3CCU F;  3NK7 A;  1XBI A;  3JAM M;  3CCR F;  3CCE F;  3LWR C;  2OHW A;  3G71 F;  1YJW F;  1YI2 F;  2QI2 A;  1VQ5 F;  1VQN F;  1KQS F;  1N8R H;  3O85 A;  1QVG F;  3CCL F;  4EI9 A;  1X52 A;  1S72 F;  1M1K H;  2KG4 A;  3LWV C;  2FC3 A;  3CG6 A;  3CC4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...