3RA5A

Crystal structure of t. celer l30e e6a/r92a variant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MVDFAFALRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 26
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra5A00
1Q82H 1YITF 3IR9A 5DCVA 1S72F 3CG6A 2QEXF 1K73H 2QI2A 3CPWF 1YJNF 3CXCF 1GZ0A 5A2QM 4TZZA 3E1YA 2KTVA 3RA5A 2OZBA 3CCQF 3LWPC 2JNBA 1K8AH 5GAPK 4C4WC 1VQMF 3LWVC 1YI2F 1SDSA 3OW2F 1KQSF 1W42A 3PLAC 3V7QA 5G4VC 1NJIH 1X7PA 3CMAF 3CCUF 2OHWA 3CCLF 1YIJF 3V7EA 1K9MH 1VQ8F 3NK6A 3G6EF 1VQ5F 1KC8H 3CCRF 3HJWC 3MCAB 5FJ4C 3O85A 1VQ6F 3OBYA 3J7AR 3RA6A 5EO3A 3NVKE 1VQKF 3LFOA 3G71F 3CC4F 3VI6A 1VQOF 1Q86H 1CN7A 3E20B 1N8RH 3NK7A 4X3MA 1E7KA 1KD1H 2VGNA 1QVGF 3LWOC 3CCVF 1VQ9F 1GO0A 3CC2F 3I55F 1W2BF 1JJ2F 1W3EX 3HAXD 1VQ7F 5IT9M 5GINC 1NMUB 1PXWA 2I6DA 1Q81H 1Q7YH 1T0KB 3LWRC 3CCMF 1VQ4F 3JCMM 2LBWA 1YHQF 4BY9D 1RA4A 1W40A 1ZWZA 3CCSF 3FFMA 1M90H 3LWQC 1YJ9F 1YJWF 3N4ZA 2VGMA 2WALA 3AGKA 4X3LA 2ALEA 5GIPC 3CD6F 3CMEF 3SIUA 3CPQA 3ON1A 2AIFA 3J80M 5GIOC 3VMFB 2KTUA 3SIVA 3CCJF 3WXMB 3NMUC 3NVIB 1X7OA 2OTJF 1X52A 3GYQA 4LCKA 1VQNF 3G4SF 3J81M 2BO1A 3CCEF 5FLXM 5G4UC 2OTLF 1GO1A 3N4YA 1CK2A 5EWRA 1W41A 2FC3A 2HVYD 1VQPF 1VQLF 1IPAA 2LBXA 3PAFA 3JAMM 1M1KH 1DT9A 2QA4F 3OBWA 4NUTA 2KG4A 1QVFF 3I56F 5GANK 1XBIA 1H7MA 4BW0B 3CC7F 1RLGA 2CZWA
chains in the Genus database with same CATH superfamily
4B45A 1Q82H 5HY1A 2UZHA 2RHJA 4X1KA 3CXCF 3E22B 1W5AA 3E1YA 2UYPA 3RA5A 1QAHA 4NQ3A 4TV8A 1K8AH 3L7QA 3QHDA 3UT5A 5JQGA 4O2AA 2OHWA 1YIJF 3WPXA 4X1KB 3WGLA 5KMGA 1VQ5F 4F6RB 3HJWC 5IJ0A 5FJ4C 3O85A 3VCZA 3JARB 2HRUA 5EO3A 3WGNA 3OONA 2CW4A 3LFOA 5IJ9B 3CC4F 3NVKE 1OAPA 1VH8A 1U3PA 2Z1EA 1W5EA 1W57A 3UT5B 1N8RH 1QD9A 2I6RA 4O2AB 1T0AA 1Z5WA 3V3TA 5JCOC 1GO0A 1VQ7F 3LMEA 5GINC 5HXZA 1Q7YH 2PMPA 5JCOA 3LWRC 3CCMF 1X25A 1R1MA 1YHQF 3RYHA 3N2KA 1QU9A 4ZOLA 3Q8HA 3B6NA 1ZWZA 4G4VA 5EAZA 3FFMA 5BMVA 2HS4A 1YJWF 3BYQA 4PWTA 3P0ZA 2ALEA 3K0TA 4C8IA 3CD6F 5HY0A 3WJRA 4RQOA 3C9UA 3CPQA 3EORA 4ZHQA 3N2KB 5GIOC 4O4LA 2KTUA 3ZP4A 4FFBA 2HS0A 1YGYA 3C8LA 2H8CA 3MQWA 3CCJF 5BMVB 5JH7A 3DC2A 1X52A 2BTOA 4LNUB 2LBTA 4LCKA 2ZAUA 3J81M 3CCEF 3TD5A 3IKEA 4O4IA 5EB0A 2OTLF 1GO1A 4O4HB 2HVYD 3RYFA 5KX5A 5EB1B 5MN4A 3S0YA 1VQLF 4X1YA 3TD3A 5FNVA 5JH7B 2KG4A 4BVTA 3QUWA 4EI8A 4C81A 1RLGA 3HKEA 4BVRA 4I4TA 2ZVYA 2R6R1 2CZWA 1U40A 1YITF 3IR9A 5DCVA 4G4ZA 5EIBC 1COMA 4I55A 2Q1YA 4BVQA 2CHSA 2QI2A 3CYQA 3CPWF 5KX5B 3WGMA 2Q1XA 2B33A 2N48A 4TZZA 3M1XA 4X1YB 4O2BA 1JN1A 3CB2A 4BT7A 2AIZP 4RHAA 4X20A 2FGYA 4C4WC 3JATA 1KQSF 3N2GB 4YJ2A 1NJIH 3CMAF 4I55B 4EB6A 5IYZA 3JASB 1VK3A 1K9MH 1JY8A 3F0GA 3G6EF 1KC8H 4O2BB 3CCRF 3WGKA 3VO8A 2UYJA 2HQSC 3MCAB 5CA1B 3OBYA 5LYJB 2RHOA 5B8FA 3RA6A 3G71F 3JATB 3GTZA 3RE3A 1VQOF 1Q86H 2BTQB 3E20B 4X3MA 1E7KA 4BT2A 2F9ZC 3C9TA 1QVGF 2HS3A 5AVMA 4U3JA 3CCVF 1VQ9F 3CC2F 1W2BF 3HAXD 4O4JB 3CYPB 1Q81H 1T0KB 2V9YA 3VYTC 3FD6A 2LBWA 3JALA 4BT6A 4BT4A 1SA0A 3HKDA 3K2XA 3R0PA 1RA4A 3CCSF 4TV8B 1JFFA 3IEWA 4TV9A 2DYYA 1OFUA 2VGMA 3F0DA 4BT5A 5ITZA 4X3LA 2HP0A 5JQGB 5LA6A 3SIUA 3QTYA 1IV4A 2ZOVA 5KMGB 3T80A 4IHJA 2YXZA 3VMFB 3ZO8A 4C8GA 3WJPA 5IJ0B 3I3FA 3S0WA 3P10A 2GLZA 2HP3A 2KGWA 1FNKA 4TV9B 3WXMB 2OTMA 1X7OA 1VQNF 3WPWA 3RYIA 5ITZB 4HNAA 4ZI7A 1CK2A 1W41A 2FC3A 4EI9A 3GHZA 1FNJA 3MCQA 4I50A 3JAMM 3JAKA 1DT9A 2QA4F 4G4XA 4X1IA 2EWCA 3VYUC 3RYHB 3M4SA 1KNKA 5EYPA 2K1SA 2H6LA 4ZOLB 1UI9A 2H8EA 1W55A 4XCQA 5MN5A 2IQQA 2L26A 1K73H 2QEXF 4TUYA 2VAPA 3K14A 5JVDA 4G4YA 4I50B 3S02A 1GZ0A 4X1IB 2KTVA 3FD5A 4ZK7A 3LWPC 2JNBA 2Z1FA 4ZHQB 3F0EA 3FPIA 4O4LB 3C9SA 4FFBB 1W59A 3KJKA 1YI2F 3OW2F 1W42A 5GONA 3MDOA 5G4VC 5HXUA 2GZLA 4TUYB 2RHHA 4G88A 3CCUF 1VQ8F 3NK6A 4O4IB 3M84A 1VQ6F 2G9IA 3RYFB 3I7TA 2MQEA 5HP8A 5FNVB 4DRXA 1PF5A 1U43A 1KD1H 1J7HA 2VGNA 5HP7A 3DDNA 3I55F 1NQ3A 3HKEB 2RHLA 1JJ2F 4YJ3A 4I4TB 3HWUA 2I6DA 1RQ7A 5J2UA 4B62A 1VQ4F 3JCMM 2NMUA 1JD1A 1CLIA 3VOBA 5MN6A 1RLUA 1TVKA 4BY9D 1W40A 3HKCA 1IV2A 4X20B 1M90H 3HTNA 3LWQC 1IV1A 3F6MA 2HRYA 3IMPA 1H47A 4B5CA 1YJ9F 4YJ2B 2PHNA 3E22A 2WALA 4C82A 4EB6B 5IYZB 5GIPC 2CWJA 3VIUA 3CMEF 2VAWA 2AIFA 3J80M 4G4WA 2HX0A 2Z1TA 3KE1A 3SIVA 3HKCB 1IV3A 5C8YA 4ZHWA 3VYSC 3V4DA 3NMUC 1ONIA 3LYBA 2UYNA 3RYCA 1FSZA 2OTJF 1XHOA 3GYQA 3G4SF 2R751 5EIBD 5G4UC 5FLXM 3WGJA 4F6RA 3ERNA 3TD4A 4U3JB 1TUBA 3JARA 5EWRA 4ZHYB 1SZQA 5IJ9A 1VQPF 4EI7A 3PAFA 3C9RA 1M1KH 5C8YB 1Q8RA 3HKBA 3JALB 3OBWA 1XV2A 1QVFF 3I56F 2UYNB 3RYCB 3D00A 1SA0B 3HKDB 1DBFA 1FFXA 2YYEA 3JAWA 1JFFB 2VAMA 4B46A 5CA0A 1TUBB 1S72F 3CG6A 4C8EA 1YJNF 5A2QM 2HP0B 5CB4A 5LA6B 2CSLA 2W8BC 3HKBB 3CCQF 2OZBA 1RQ2A 5HY2A 4IHJB 3KHNA 3D54A 2ZVZA 5GAPK 3U0OA 5EZYA 1H48A 1KNJA 1FFXB 1VQMF 3JAWB 3LWVC 1SDSA 3PLAC 3FBAA 3V7QA 3JVHA 5CA0B 1X7PA 3CCLF 1XRGA 2GVIA 3V7EA 3K12A 5LXTA 3MBMA 3RYIB 4HNAB 2Z01A 2IAFA 5CB4B 4ZI7B 3J7AR 2DT4A 2BTUA 1GX1A 4IIJA 2ZODA 1VQKF 5EZYB 4NWOB 3VI6A 3JAKB 4LNUA 1CN7A 5HY4A 3S0HA 2LCAA 3NK7A 4BVSA 3S03A 3KIZA 2CVLA 3LWOC 5EYPB 5LXTB 4O4HA 3VTIC 1W5BA 1W3EX 5IT9M 4M8IA 1NMUB 2UYKA 1PXWA 2Z1UA 5LP6C 3IEQA 2RB9A 4IIJB 5JVDB 3KJJA 3VOAA 2CHTA 3ELCA 5LP6A 4E6EA 3LDTA 1VHAA 5LOVA 3N4ZA 1W5FA 5GONB 1U3LA 2P6YA 3WJQA 3AGKA 5J2TA 3ON1A 1ODEA 2VXYA 4U39A 4WBNA 5LP6B 1YQNA 3N2GA 4R40B 1W581 4ZHVA 4KWEA 2IG8A 4ERHA 3P4EA 3NVIB 3JASA 3IKFA 5LOVB 3ZOPA 4DRXB 2BO1A 2AMTA 3ZP7A 3N4YA 5CA1A 5J2TB 5LYJA 4YJ3B 4WBNB 1IPAA 3D01A 1Z5VA 2LBXA 2ZF8A 4DXDA 2QTPA 5J2UB 4BT3A 3ESJA 5HWEA 4NUTA 3S06A 5GANK 1XBIA 1VQVA 1H7MA 1TVKB 4BW0B 1UFYA 3CC7F 3F0FA 4O4JA
chains in the Genus database with same CATH topology
1Q82H 1YITF 3IR9A 5HY1A 5DCVA 1S72F 3CG6A 2QEXF 4BVQA 1K73H 2QI2A 3CPWF 1YJNF 3CXCF 1GZ0A 5A2QM 4TZZA 3E1YA 2KTVA 3RA5A 2OZBA 3CCQF 4NQ3A 3LWPC 2JNBA 1K8AH 5HY2A 5GAPK 2FGYA 4C4WC 1VQMF 3LWVC 1YI2F 1SDSA 3OW2F 1KQSF 1W42A 3PLAC 3V7QA 5G4VC 5HXUA 1NJIH 1X7PA 3CMAF 3CCUF 2OHWA 3CCLF 1YIJF 3V7EA 1K9MH 1VQ8F 3NK6A 3G6EF 1VQ5F 1KC8H 3CCRF 3HJWC 3MCAB 5FJ4C 3O85A 1VQ6F 3OBYA 3J7AR 3RA6A 5EO3A 3NVKE 1VQKF 3LFOA 3G71F 3CC4F 3VI6A 1VQOF 1Q86H 1CN7A 5HY4A 3E20B 1N8RH 3NK7A 4X3MA 4BVSA 1E7KA 1KD1H 2VGNA 2F9ZC 1QVGF 3LWOC 3CCVF 3V3TA 1VQ9F 3CC2F 1GO0A 3I55F 1W2BF 1JJ2F 1W3EX 3HAXD 1VQ7F 5IT9M 5GINC 5HXZA 1NMUB 1PXWA 2I6DA 1Q81H 1Q7YH 1T0KB 3LWRC 3CCMF 1VQ4F 3JCMM 2LBWA 1YHQF 4BY9D 1RA4A 1W40A 1ZWZA 3CCSF 3FFMA 1M90H 3LWQC 1YJ9F 1YJWF 3N4ZA 2VGMA 2WALA 3AGKA 4X3LA 2ALEA 5GIPC 3CD6F 5HY0A 3CMEF 3SIUA 3CPQA 3ON1A 2AIFA 3J80M 5GIOC 3VMFB 2KTUA 3SIVA 2GLZA 3CCJF 3WXMB 3NMUC 3NVIB 1X7OA 2OTJF 1X52A 3GYQA 4LCKA 1VQNF 3G4SF 3J81M 2BO1A 3CCEF 5FLXM 5G4UC 2OTLF 1GO1A 3N4YA 1CK2A 5EWRA 1W41A 2FC3A 4EI9A 2HVYD 1VQPF 1VQLF 1IPAA 4EI7A 2LBXA 3PAFA 3JAMM 1M1KH 1DT9A 2QA4F 5HWEA 3OBWA 4NUTA 2KG4A 1QVFF 4BVTA 3I56F 5GANK 1XBIA 3D00A 4EI8A 1H7MA 4BW0B 3CC7F 1RLGA 4BVRA 4XCQA 2CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 H;  1YIT F;  3IR9 A;  5DCV A;  1S72 F;  3CG6 A;  2QEX F;  1K73 H;  2QI2 A;  3CPW F;  1YJN F;  3CXC F;  1GZ0 A;  5A2Q M;  4TZZ A;  3E1Y A;  2KTV A;  3RA5 A;  2OZB A;  3CCQ F;  3LWP C;  2JNB A;  1K8A H;  5GAP K;  4C4W C;  1VQM F;  3LWV C;  1YI2 F;  1SDS A;  3OW2 F;  1KQS F;  1W42 A;  3PLA C;  3V7Q A;  5G4V C;  1NJI H;  1X7P A;  3CMA F;  3CCU F;  2OHW A;  3CCL F;  1YIJ F;  3V7E A;  1K9M H;  1VQ8 F;  3NK6 A;  3G6E F;  1VQ5 F;  1KC8 H;  3CCR F;  3HJW C;  3MCA B;  5FJ4 C;  3O85 A;  1VQ6 F;  3OBY A;  3J7A R;  3RA6 A;  5EO3 A;  3NVK E;  1VQK F;  3LFO A;  3G71 F;  3CC4 F;  3VI6 A;  1VQO F;  1Q86 H;  1CN7 A;  3E20 B;  1N8R H;  3NK7 A;  4X3M A;  1E7K A;  1KD1 H;  2VGN A;  1QVG F;  3LWO C;  3CCV F;  1VQ9 F;  1GO0 A;  3CC2 F;  3I55 F;  1W2B F;  1JJ2 F;  1W3E X;  3HAX D;  1VQ7 F;  5IT9 M;  5GIN C;  1NMU B;  1PXW A;  2I6D A;  1Q81 H;  1Q7Y H;  1T0K B;  3LWR C;  3CCM F;  1VQ4 F;  3JCM M;  2LBW A;  1YHQ F;  4BY9 D;  1RA4 A;  1W40 A;  1ZWZ A;  3CCS F;  3FFM A;  1M90 H;  3LWQ C;  1YJ9 F;  1YJW F;  3N4Z A;  2VGM A;  2WAL A;  3AGK A;  4X3L A;  2ALE A;  5GIP C;  3CD6 F;  3CME F;  3SIU A;  3CPQ A;  3ON1 A;  2AIF A;  3J80 M;  5GIO C;  3VMF B;  2KTU A;  3SIV A;  3CCJ F;  3WXM B;  3NMU C;  3NVI B;  1X7O A;  2OTJ F;  1X52 A;  3GYQ A;  4LCK A;  1VQN F;  3G4S F;  3J81 M;  2BO1 A;  3CCE F;  5FLX M;  5G4U C;  2OTL F;  1GO1 A;  3N4Y A;  1CK2 A;  5EWR A;  1W41 A;  2FC3 A;  2HVY D;  1VQP F;  1VQL F;  1IPA A;  2LBX A;  3PAF A;  3JAM M;  1M1K H;  1DT9 A;  2QA4 F;  3OBW A;  4NUT A;  2KG4 A;  1QVF F;  3I56 F;  5GAN K;  1XBI A;  1H7M A;  4BW0 B;  3CC7 F;  1RLG A;  2CZW A; 
#chains in the Genus database with same CATH topology
 4B45 A;  1Q82 H;  5HY1 A;  2UZH A;  2RHJ A;  4X1K A;  3CXC F;  3E22 B;  1W5A A;  3E1Y A;  2UYP A;  3RA5 A;  1QAH A;  4NQ3 A;  4TV8 A;  1K8A H;  3L7Q A;  3QHD A;  3UT5 A;  5JQG A;  4O2A A;  2OHW A;  1YIJ F;  3WPX A;  4X1K B;  3WGL A;  5KMG A;  1VQ5 F;  4F6R B;  3HJW C;  5IJ0 A;  5FJ4 C;  3O85 A;  3VCZ A;  3JAR B;  2HRU A;  5EO3 A;  3WGN A;  3OON A;  2CW4 A;  3LFO A;  5IJ9 B;  3CC4 F;  3NVK E;  1OAP A;  1VH8 A;  1U3P A;  2Z1E A;  1W5E A;  1W57 A;  3UT5 B;  1N8R H;  1QD9 A;  2I6R A;  4O2A B;  1T0A A;  1Z5W A;  3V3T A;  5JCO C;  1GO0 A;  1VQ7 F;  3LME A;  5GIN C;  5HXZ A;  1Q7Y H;  2PMP A;  5JCO A;  3LWR C;  3CCM F;  1X25 A;  1R1M A;  1YHQ F;  3RYH A;  3N2K A;  1QU9 A;  4ZOL A;  3Q8H A;  3B6N A;  1ZWZ A;  4G4V A;  5EAZ A;  3FFM A;  5BMV A;  2HS4 A;  1YJW F;  3BYQ A;  4PWT A;  3P0Z A;  2ALE A;  3K0T A;  4C8I A;  3CD6 F;  5HY0 A;  3WJR A;  4RQO A;  3C9U A;  3CPQ A;  3EOR A;  4ZHQ A;  3N2K B;  5GIO C;  4O4L A;  2KTU A;  3ZP4 A;  4FFB A;  2HS0 A;  1YGY A;  3C8L A;  2H8C A;  3MQW A;  3CCJ F;  5BMV B;  5JH7 A;  3DC2 A;  1X52 A;  2BTO A;  4LNU B;  2LBT A;  4LCK A;  2ZAU A;  3J81 M;  3CCE F;  3TD5 A;  3IKE A;  4O4I A;  5EB0 A;  2OTL F;  1GO1 A;  4O4H B;  2HVY D;  3RYF A;  5KX5 A;  5EB1 B;  5MN4 A;  3S0Y A;  1VQL F;  4X1Y A;  3TD3 A;  5FNV A;  5JH7 B;  2KG4 A;  4BVT A;  3QUW A;  4EI8 A;  4C81 A;  1RLG A;  3HKE A;  4BVR A;  4I4T A;  2ZVY A;  2R6R 1;  2CZW A;  1U40 A;  1YIT F;  3IR9 A;  5DCV A;  4G4Z A;  5EIB C;  1COM A;  4I55 A;  2Q1Y A;  4BVQ A;  2CHS A;  2QI2 A;  3CYQ A;  3CPW F;  5KX5 B;  3WGM A;  2Q1X A;  2B33 A;  2N48 A;  4TZZ A;  3M1X A;  4X1Y B;  4O2B A;  1JN1 A;  3CB2 A;  4BT7 A;  2AIZ P;  4RHA A;  4X20 A;  2FGY A;  4C4W C;  3JAT A;  1KQS F;  3N2G B;  4YJ2 A;  1NJI H;  3CMA F;  4I55 B;  4EB6 A;  5IYZ A;  3JAS B;  1VK3 A;  1K9M H;  1JY8 A;  3F0G A;  3G6E F;  1KC8 H;  4O2B B;  3CCR F;  3WGK A;  3VO8 A;  2UYJ A;  2HQS C;  3MCA B;  5CA1 B;  3OBY A;  5LYJ B;  2RHO A;  5B8F A;  3RA6 A;  3G71 F;  3JAT B;  3GTZ A;  3RE3 A;  1VQO F;  1Q86 H;  2BTQ B;  3E20 B;  4X3M A;  1E7K A;  4BT2 A;  2F9Z C;  3C9T A;  1QVG F;  2HS3 A;  5AVM A;  4U3J A;  3CCV F;  1VQ9 F;  3CC2 F;  1W2B F;  3HAX D;  4O4J B;  3CYP B;  1Q81 H;  1T0K B;  2V9Y A;  3VYT C;  3FD6 A;  2LBW A;  3JAL A;  4BT6 A;  4BT4 A;  1SA0 A;  3HKD A;  3K2X A;  3R0P A;  1RA4 A;  3CCS F;  4TV8 B;  1JFF A;  3IEW A;  4TV9 A;  2DYY A;  1OFU A;  2VGM A;  3F0D A;  4BT5 A;  5ITZ A;  4X3L A;  2HP0 A;  5JQG B;  5LA6 A;  3SIU A;  3QTY A;  1IV4 A;  2ZOV A;  5KMG B;  3T80 A;  4IHJ A;  2YXZ A;  3VMF B;  3ZO8 A;  4C8G A;  3WJP A;  5IJ0 B;  3I3F A;  3S0W A;  3P10 A;  2GLZ A;  2HP3 A;  2KGW A;  1FNK A;  4TV9 B;  3WXM B;  2OTM A;  1X7O A;  1VQN F;  3WPW A;  3RYI A;  5ITZ B;  4HNA A;  4ZI7 A;  1CK2 A;  1W41 A;  2FC3 A;  4EI9 A;  3GHZ A;  1FNJ A;  3MCQ A;  4I50 A;  3JAM M;  3JAK A;  1DT9 A;  2QA4 F;  4G4X A;  4X1I A;  2EWC A;  3VYU C;  3RYH B;  3M4S A;  1KNK A;  5EYP A;  2K1S A;  2H6L A;  4ZOL B;  1UI9 A;  2H8E A;  1W55 A;  4XCQ A;  5MN5 A;  2IQQ A;  2L26 A;  1K73 H;  2QEX F;  4TUY A;  2VAP A;  3K14 A;  5JVD A;  4G4Y A;  4I50 B;  3S02 A;  1GZ0 A;  4X1I B;  2KTV A;  3FD5 A;  4ZK7 A;  3LWP C;  2JNB A;  2Z1F A;  4ZHQ B;  3F0E A;  3FPI A;  4O4L B;  3C9S A;  4FFB B;  1W59 A;  3KJK A;  1YI2 F;  3OW2 F;  1W42 A;  5GON A;  3MDO A;  5G4V C;  5HXU A;  2GZL A;  4TUY B;  2RHH A;  4G88 A;  3CCU F;  1VQ8 F;  3NK6 A;  4O4I B;  3M84 A;  1VQ6 F;  2G9I A;  3RYF B;  3I7T A;  2MQE A;  5HP8 A;  5FNV B;  4DRX A;  1PF5 A;  1U43 A;  1KD1 H;  1J7H A;  2VGN A;  5HP7 A;  3DDN A;  3I55 F;  1NQ3 A;  3HKE B;  2RHL A;  1JJ2 F;  4YJ3 A;  4I4T B;  3HWU A;  2I6D A;  1RQ7 A;  5J2U A;  4B62 A;  1VQ4 F;  3JCM M;  2NMU A;  1JD1 A;  1CLI A;  3VOB A;  5MN6 A;  1RLU A;  1TVK A;  4BY9 D;  1W40 A;  3HKC A;  1IV2 A;  4X20 B;  1M90 H;  3HTN A;  3LWQ C;  1IV1 A;  3F6M A;  2HRY A;  3IMP A;  1H47 A;  4B5C A;  1YJ9 F;  4YJ2 B;  2PHN A;  3E22 A;  2WAL A;  4C82 A;  4EB6 B;  5IYZ B;  5GIP C;  2CWJ A;  3VIU A;  3CME F;  2VAW A;  2AIF A;  3J80 M;  4G4W A;  2HX0 A;  2Z1T A;  3KE1 A;  3SIV A;  3HKC B;  1IV3 A;  5C8Y A;  4ZHW A;  3VYS C;  3V4D A;  3NMU C;  1ONI A;  3LYB A;  2UYN A;  3RYC A;  1FSZ A;  2OTJ F;  1XHO A;  3GYQ A;  3G4S F;  2R75 1;  5EIB D;  5G4U C;  5FLX M;  3WGJ A;  4F6R A;  3ERN A;  3TD4 A;  4U3J B;  1TUB A;  3JAR A;  5EWR A;  4ZHY B;  1SZQ A;  5IJ9 A;  1VQP F;  4EI7 A;  3PAF A;  3C9R A;  1M1K H;  5C8Y B;  1Q8R A;  3HKB A;  3JAL B;  3OBW A;  1XV2 A;  1QVF F;  3I56 F;  2UYN B;  3RYC B;  3D00 A;  1SA0 B;  3HKD B;  1DBF A;  1FFX A;  2YYE A;  3JAW A;  1JFF B;  2VAM A;  4B46 A;  5CA0 A;  1TUB B;  1S72 F;  3CG6 A;  4C8E A;  1YJN F;  5A2Q M;  2HP0 B;  5CB4 A;  5LA6 B;  2CSL A;  2W8B C;  3HKB B;  3CCQ F;  2OZB A;  1RQ2 A;  5HY2 A;  4IHJ B;  3KHN A;  3D54 A;  2ZVZ A;  5GAP K;  3U0O A;  5EZY A;  1H48 A;  1KNJ A;  1FFX B;  1VQM F;  3JAW B;  3LWV C;  1SDS A;  3PLA C;  3FBA A;  3V7Q A;  3JVH A;  5CA0 B;  1X7P A;  3CCL F;  1XRG A;  2GVI A;  3V7E A;  3K12 A;  5LXT A;  3MBM A;  3RYI B;  4HNA B;  2Z01 A;  2IAF A;  5CB4 B;  4ZI7 B;  3J7A R;  2DT4 A;  2BTU A;  1GX1 A;  4IIJ A;  2ZOD A;  1VQK F;  5EZY B;  4NWO B;  3VI6 A;  3JAK B;  4LNU A;  1CN7 A;  5HY4 A;  3S0H A;  2LCA A;  3NK7 A;  4BVS A;  3S03 A;  3KIZ A;  2CVL A;  3LWO C;  5EYP B;  5LXT B;  4O4H A;  3VTI C;  1W5B A;  1W3E X;  5IT9 M;  4M8I A;  1NMU B;  2UYK A;  1PXW A;  2Z1U A;  5LP6 C;  3IEQ A;  2RB9 A;  4IIJ B;  5JVD B;  3KJJ A;  3VOA A;  2CHT A;  3ELC A;  5LP6 A;  4E6E A;  3LDT A;  1VHA A;  5LOV A;  3N4Z A;  1W5F A;  5GON B;  1U3L A;  2P6Y A;  3WJQ A;  3AGK A;  5J2T A;  3ON1 A;  1ODE A;  2VXY A;  4U39 A;  4WBN A;  5LP6 B;  1YQN A;  3N2G A;  4R40 B;  1W58 1;  4ZHV A;  4KWE A;  2IG8 A;  4ERH A;  3P4E A;  3NVI B;  3JAS A;  3IKF A;  5LOV B;  3ZOP A;  4DRX B;  2BO1 A;  2AMT A;  3ZP7 A;  3N4Y A;  5CA1 A;  5J2T B;  5LYJ A;  4YJ3 B;  4WBN B;  1IPA A;  3D01 A;  1Z5V A;  2LBX A;  2ZF8 A;  4DXD A;  2QTP A;  5J2U B;  4BT3 A;  3ESJ A;  5HWE A;  4NUT A;  3S06 A;  5GAN K;  1XBI A;  1VQV A;  1H7M A;  1TVK B;  4BW0 B;  1UFY A;  3CC7 F;  3F0F A;  4O4J A; 
#chains in the Genus database with same CATH homology
 1Q82 H;  1YIT F;  3IR9 A;  5HY1 A;  5DCV A;  1S72 F;  3CG6 A;  2QEX F;  4BVQ A;  1K73 H;  2QI2 A;  3CPW F;  1YJN F;  3CXC F;  1GZ0 A;  5A2Q M;  4TZZ A;  3E1Y A;  2KTV A;  3RA5 A;  2OZB A;  3CCQ F;  4NQ3 A;  3LWP C;  2JNB A;  1K8A H;  5HY2 A;  5GAP K;  2FGY A;  4C4W C;  1VQM F;  3LWV C;  1YI2 F;  1SDS A;  3OW2 F;  1KQS F;  1W42 A;  3PLA C;  3V7Q A;  5G4V C;  5HXU A;  1NJI H;  1X7P A;  3CMA F;  3CCU F;  2OHW A;  3CCL F;  1YIJ F;  3V7E A;  1K9M H;  1VQ8 F;  3NK6 A;  3G6E F;  1VQ5 F;  1KC8 H;  3CCR F;  3HJW C;  3MCA B;  5FJ4 C;  3O85 A;  1VQ6 F;  3OBY A;  3J7A R;  3RA6 A;  5EO3 A;  3NVK E;  1VQK F;  3LFO A;  3G71 F;  3CC4 F;  3VI6 A;  1VQO F;  1Q86 H;  1CN7 A;  5HY4 A;  3E20 B;  1N8R H;  3NK7 A;  4X3M A;  4BVS A;  1E7K A;  1KD1 H;  2VGN A;  2F9Z C;  1QVG F;  3LWO C;  3CCV F;  3V3T A;  1VQ9 F;  3CC2 F;  1GO0 A;  3I55 F;  1W2B F;  1JJ2 F;  1W3E X;  3HAX D;  1VQ7 F;  5IT9 M;  5GIN C;  5HXZ A;  1NMU B;  1PXW A;  2I6D A;  1Q81 H;  1Q7Y H;  1T0K B;  3LWR C;  3CCM F;  1VQ4 F;  3JCM M;  2LBW A;  1YHQ F;  4BY9 D;  1RA4 A;  1W40 A;  1ZWZ A;  3CCS F;  3FFM A;  1M90 H;  3LWQ C;  1YJ9 F;  1YJW F;  3N4Z A;  2VGM A;  2WAL A;  3AGK A;  4X3L A;  2ALE A;  5GIP C;  3CD6 F;  5HY0 A;  3CME F;  3SIU A;  3CPQ A;  3ON1 A;  2AIF A;  3J80 M;  5GIO C;  3VMF B;  2KTU A;  3SIV A;  2GLZ A;  3CCJ F;  3WXM B;  3NMU C;  3NVI B;  1X7O A;  2OTJ F;  1X52 A;  3GYQ A;  4LCK A;  1VQN F;  3G4S F;  3J81 M;  2BO1 A;  3CCE F;  5FLX M;  5G4U C;  2OTL F;  1GO1 A;  3N4Y A;  1CK2 A;  5EWR A;  1W41 A;  2FC3 A;  4EI9 A;  2HVY D;  1VQP F;  1VQL F;  1IPA A;  4EI7 A;  2LBX A;  3PAF A;  3JAM M;  1M1K H;  1DT9 A;  2QA4 F;  5HWE A;  3OBW A;  4NUT A;  2KG4 A;  1QVF F;  4BVT A;  3I56 F;  5GAN K;  1XBI A;  3D00 A;  4EI8 A;  1H7M A;  4BW0 B;  3CC7 F;  1RLG A;  4BVR A;  4XCQ A;  2CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...