3RA5A

Crystal structure of t. celer l30e e6a/r92a variant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MVDFAFALRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
total genus 26
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra5A00
3N4ZA 3CPQA 2JNBA 3PLAC 3NVKE 1RA4A 1DT9A 1S72F 4X3LA 5GIOC 3PAFA 1VQPF 3CCRF 3OBYA 1ZWZA 5EO3A 1GO1A 1VQ4F 4X3MA 3MCAB 3CXCF 1X7PA 2CZWA 1KQSF 2OZBA 1K9MH 1M90H 2OHWA 3GYQA 1W42A 1VQMF 5GANK 3NK6A 3CMAF 1Q7YH 3LWVC 1YHQF 1VQNF 3CC4F 3LWPC 3CC2F 1Q82H 3LWOC 3CCVF 2ALEA 1M1KH 5IT9M 1GO0A 2AIFA 1VQ6F 1YJNF 1VQ7F 3VI6A 1GZ0A 2QA4F 3E1YA 3CMEF 5FJ4C 3RA5A 2VGMA 2KTUA 3CCUF 4TZZA 3J7AR 1Q86H 1QVFF 1NJIH 1VQKF 2I6DA 5GINC 1VQ5F 1K8AH 1QVGF 1VQOF 3IR9A 2KTVA 1PXWA 3I56F 3G71F 1W2BF 3JCMM 5GAPK 3CCMF 3NMUC 1SDSA 3WXMB 3G4SF 1K73H 2KG4A 1NMUB 3SIVA 3CCQF 1VQ8F 3FFMA 1YIJF 2OTLF 2OTJF 5DCVA 1XBIA 2FC3A 2QEXF 1H7MA 4BW0B 1E7KA 2LBXA 2LBWA 3RA6A 3CD6F 2WALA 1IPAA 1VQ9F 3G6EF 5G4UC 3O85A 3VMFB 4NUTA 1RLGA 5A2QM 5GIPC 3OW2F 4BY9D 3J81M 3V7QA 5FLXM 3ON1A 4C4WC 3V7EA 3J80M 3SIUA 3HAXD 3HJWC 1W40A 3NVIB 3CCEF 3LWRC 1JJ2F 2BO1A 1CK2A 2VGNA 3CCLF 4LCKA 5EWRA 1N8RH 1T0KB 1KD1H 3E20B 1YI2F 3LWQC 3N4YA 3LFOA 3OBWA 5G4VC 3CCSF 2HVYD 1X52A 3CPWF 3CCJF 1X7OA 3NK7A 1CN7A 3CG6A 1YITF 1YJ9F 1VQLF 2QI2A 3CC7F 1KC8H 1Q81H 3JAMM 3AGKA 1YJWF 1W3EX 1W41A 3I55F
chains in the Genus database with same CATH superfamily
3PLAC 2DT4A 5HY1A 3PAFA 4ZOLB 3CCRF 3TD3A 4TV8B 5ITZA 1X7PA 2VXYA 5LA6B 4I4TB 3S0WA 2OZBA 1VH8A 4U3JB 3C9TA 4TV9A 4BT5A 3LWVC 3S0HA 3RYCA 3CC4F 2GZLA 2P6YA 4C82A 3FD5A 3Q8HA 3VI6A 3HTNA 3E1YA 1JFFB 2VGMA 3KE1A 3JALA 4IHJB 3D00A 2GVIA 3ESJA 2UYJA 1FFXA 3QUWA 2VAMA 1IV2A 2I6DA 2UYNA 2NMUA 3KJJA 2QTPA 1ONIA 1TVKB 3VYSC 4U39A 2CSLA 3M1XA 4IIJB 3FPIA 5JH7A 3JARA 2IG8A 2RB9A 1IV4A 4O4JA 3JCMM 2L26A 3JAWB 3RYIA 4O2BB 1W5AA 4R40B 3VIUA 3WGJA 3ZOPA 1U3LA 4BT7A 3JVHA 4NQ3A 1YIJF 5LP6B 5DCVA 1XBIA 5IJ9B 3RYFA 2FC3A 3B6NA 1W581 4BW0B 4BT3A 3RA6A 4XCQA 5HY0A 2WALA 3CD6F 4C8GA 3T80A 5IJ0A 4YJ3B 5G4UC 2CHTA 2RHJA 1YQNA 1FSZA 5BMVA 4NUTA 5EYPA 2LBTA 3JATB 4BY9D 1OFUA 4C4WC 3V7EA 3HKBB 4O4LB 4ZHQA 3TD4A 3HJWC 1W40A 1IV1A 4DXDA 2BO1A 1W57A 2BTOA 4WBNB 3UT5B 3E22A 5EZYB 1W5BA 3JASA 1H48A 2RHLA 3P4EA 3MDOA 3LWQC 1VHAA 1TUBB 3S02A 3K14A 5KMGA 3LFOA 3OBWA 2HS0A 4ZI7A 4BVQA 3CCJF 2HS3A 2VAWA 3KIZA 3M4SA 1YJ9F 1W5EA 3WPXA 3D01A 1YJWF 3HWUA 4G4YA 4X20A 4B45A 4KWEA 3N4ZA 3CPQA 5EB1B 1VK3A 4O2AB 2JNBA 3K0TA 1JY8A 4I50A 3JAKB 1S72F 1GX1A 1SA0A 4X3LA 1JD1A 2Q1XA 3K12A 2I6RA 5CA1A 1GO1A 4TV9B 1VQ4F 4O4HB 3MCAB 3RYCB 3F0GA 3QTYA 1XRGA 3MCQA 3P10A 2OHWA 2IAFA 1YGYA 2HQSC 3HKDA 3V4DA 1W42A 2H6LA 5C8YA 4F6RA 1W55A 2GLZA 4X1YB 3C9SA 3HKCA 3JALB 1Q82H 3LWOC 4B46A 4BVTA 1M1KH 1GO0A 1YJNF 1VQ7F 3GTZA 3U0OA 3ERNA 2UYNB 3N2GB 3CMEF 3CB2A 3RA5A 2Z1TA 2IQQA 2KTUA 3CCUF 4G4ZA 2G9IA 5JH7B 1W59A 4O4JB 1J7HA 5LYJA 2ZVZA 3RYIB 1NJIH 3S06A 1T0AA 5GINC 1K8AH 1QVGF 2FGYA 3IR9A 2KTVA 2YYEA 5JVDA 5FNVA 1PXWA 3WJPA 4E6EA 1JN1A 3RYFB 3NMUC 2UYKA 1Q8RA 5GONA 3F6MA 5LXTB 3D54A 3G4SF 3K2XA 4YJ2A 3IKFA 1VQ8F 2CWJA 3FFMA 2F9ZC 4BT6A 2QEXF 2CVLA 4C8IA 5BMVB 5EYPB 5KX5A 1IPAA 4EI9A 1COMA 4ZHQB 1VQ9F 2K1SA 3WJRA 3HKEA 4EB6A 3MQWA 3VMFB 4O4IA 4HNAA 1RLGA 4M8IA 3J81M 3V7QA 3I3FA 3ON1A 1PF5A 3VCZA 3CCEF 2B33A 4I55A 4DRXA 2H8EA 3N2KA 2VGNA 2ZAUA 4ZI7B 3M84A 4ZHWA 3L7QA 1T0KB 1KD1H 3E20B 4BT4A 5J2TB 1YI2F 3IEWA 5LOVA 3N4YA 4X20B 5G4VC 3CCSF 1OAPA 2HVYD 3CPWF 1QU9A 3FBAA 3NK7A 1KNJA 3BYQA 1U43A 4BVRA 4I50B 1YITF 4LNUA 4TV8A 1VQLF 1KC8H 1Q81H 1W5FA 3WGMA 2KGWA 1W3EX 4U3JA 5CA1B 2HP0A 1U40A 2Q1YA 3S03A 3WJQA 5B8FA 3HKDB 5GIOC 4F6RB 3OBYA 1ZWZA 5EO3A 4X3MA 2CZWA 3CYPB 2RHOA 3FD6A 4X1IA 1KQSF 1QD9A 1X25A 1K9MH 5GANK 1U3PA 5EIBD 2R6R1 3DDNA 1TVKA 2ALEA 3GHZA 5LYJB 1VQ6F 1SZQA 2QA4F 3CYQA 5ITZB 3DC2A 5JVDB 4ZHYB 5FNVB 4C81A 3R0PA 5HY2A 1QAHA 1Z5WA 4TZZA 1Q86H 1QVFF 3WGLA 2CW4A 1VQKF 5GONB 2N48A 2PMPA 4G4VA 4YJ2B 5HXUA 3G71F 4FFBA 4C8EA 4EI8A 5JQGA 4B62A 5GAPK 1SDSA 3WXMB 1RLUA 5CA0A 1R1MA 1K73H 3RYHA 5KX5B 1FFXB 4RHAA 4BT2A 3SIVA 2HS4A 5J2UA 4ZHVA 2OTLF 2LCAA 3HKEB 4EI7A 1XHOA 3HKBA 4O4LA 5EAZA 4X1KA 2HRUA 3JARB 1E7KA 2LBXA 3TD5A 2EWCA 4WBNA 2Z1EA 3OONA 4DRXB 2ZODA 4I55B 2HX0A 2H8CA 3G6EF 4B5CA 3N2KB 3IEQA 2PHNA 1NQ3A 5GIPC 3OW2F 3KJKA 3LDTA 3J80M 3SIUA 3HAXD 3WGNA 3NVIB 5LP6C 5LOVB 3LWRC 2AMTA 1CK2A 5MN6A 5MN4A 4NWOB 1N8RH 5IJ0B 1VQVA 3F0DA 1IV3A 4LNUB 5CB4A 4O2AA 4G4XA 2UZHA 3JAKA 3WPWA 2HP0B 4TUYA 1CN7A 1DBFA 2DYYA 5JCOC 2QI2A 4O4HA 3CC7F 3E22B 3JAMM 3AGKA 5IYZA 3JASB 1W41A 3VO8A 2Z1UA 4X1YA 3NVKE 1RA4A 1DT9A 5KMGB 4X1IB 2VAPA 2Z01A 1VQPF 3I7TA 1ODEA 3P0ZA 4PWTA 2OTMA 3VTIC 3WGKA 3N2GA 3RE3A 3CXCF 2BTQB 1RQ7A 5HP7A 1M90H 3GYQA 4ZOLA 1VQMF 3ELCA 3NK6A 3CMAF 1Q7YH 2V9YA 3EORA 1SA0B 2CHSA 1YHQF 3LWPC 2HP3A 3CC2F 1Z5VA 1VQNF 1KNKA 3CCVF 5IT9M 2AIFA 5LA6A 4I4TA 2MQEA 3LMEA 1GZ0A 3C8LA 5FJ4C 2AIZP 2Z1FA 3F0FA 2RHHA 5EB0A 5LXTA 4FFBB 5C8YB 3J7AR 5JQGB 3HKCB 1VQ5F 5CA0B 1JFFA 1VQOF 1FNJA 2R751 3RYHB 4IHJA 3ZO8A 5J2UB 3I56F 1W2BF 2HRYA 5HY4A 3CCMF 5HWEA 2UYPA 4G4WA 4X1KB 3VOAA 5HXZA 4ZK7A 2KG4A 3S0YA 4IIJA 1NMUB 3F0EA 3CCQF 4G88A 5HP8A 3LYBA 3JAWA 2OTJF 3MBMA 4O2BA 1H7MA 1FNKA 3KHNA 3ZP4A 2LBWA 3V3TA 3VYUC 3ZP7A 5AVMA 5LP6A 5IJ9A 1CLIA 3IMPA 3IKEA 2BTUA 3O85A 5J2TA 3C9UA 2ZF8A 5A2QM 5FLXM 1UI9A 1UFYA 4RQOA 4BVSA 3QHDA 5CB4B 3C9RA 4YJ3A 1JJ2F 2ZOVA 4LCKA 5EWRA 3JATA 4TUYB 3VOBA 4EB6B 5EIBC 5JCOA 4O4IB 4HNAB 1RQ2A 5IYZB 3VYTC 1H47A 1X52A 1XV2A 1X7OA 3UT5A 2ZVYA 5EZYA 3CG6A 2YXZA 1TUBA 4ERHA 5MN5A 3CCLF 2W8BC 3I55F
chains in the Genus database with same CATH topology
3N4ZA 3CPQA 2JNBA 3PLAC 3NVKE 1RA4A 1DT9A 1S72F 5HY1A 4X3LA 5GIOC 3PAFA 1VQPF 3CCRF 3OBYA 1ZWZA 5EO3A 1GO1A 1VQ4F 4X3MA 3MCAB 3CXCF 1X7PA 2CZWA 1KQSF 2OZBA 1K9MH 1M90H 2OHWA 3GYQA 1W42A 1VQMF 2GLZA 5GANK 3NK6A 3CMAF 1Q7YH 3LWVC 1YHQF 1VQNF 3CC4F 3LWPC 3CC2F 1Q82H 3LWOC 3CCVF 4BVTA 2ALEA 1M1KH 5IT9M 1GO0A 2AIFA 1VQ6F 1YJNF 1VQ7F 3VI6A 1GZ0A 2QA4F 3E1YA 3CMEF 5FJ4C 3RA5A 2VGMA 2KTUA 3CCUF 5HY2A 3D00A 4TZZA 3J7AR 1Q86H 1QVFF 1NJIH 1VQKF 2I6DA 5GINC 1VQ5F 1K8AH 1QVGF 1VQOF 2FGYA 3IR9A 2KTVA 5HXUA 1PXWA 3I56F 3G71F 1W2BF 3JCMM 4EI8A 5HY4A 5GAPK 3CCMF 3NMUC 5HWEA 1SDSA 3WXMB 5HXZA 3G4SF 1K73H 2KG4A 1NMUB 3SIVA 3CCQF 1VQ8F 3FFMA 4NQ3A 1YIJF 2OTLF 2OTJF 5DCVA 1XBIA 2F9ZC 4EI7A 2FC3A 2QEXF 1H7MA 4BW0B 1E7KA 2LBXA 2LBWA 3RA6A 4XCQA 3V3TA 2WALA 5HY0A 3CD6F 1IPAA 4EI9A 1VQ9F 3G6EF 5G4UC 3O85A 3VMFB 4NUTA 1RLGA 5A2QM 5GIPC 3OW2F 4BY9D 3J81M 3V7QA 5FLXM 3ON1A 4C4WC 3V7EA 3J80M 4BVSA 3SIUA 3HAXD 3HJWC 1W40A 3NVIB 3CCEF 3LWRC 1JJ2F 2BO1A 1CK2A 2VGNA 3CCLF 4LCKA 5EWRA 1N8RH 1T0KB 1KD1H 3E20B 1YI2F 3LWQC 3N4YA 3LFOA 3OBWA 5G4VC 3CCSF 2HVYD 1X52A 4BVQA 3CPWF 1X7OA 3CCJF 3NK7A 1CN7A 4BVRA 3CG6A 1YITF 1YJ9F 1VQLF 2QI2A 3CC7F 1KC8H 1Q81H 3JAMM 3AGKA 1YJWF 1W3EX 1W41A 3I55F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Z A;  3CPQ A;  2JNB A;  3PLA C;  3NVK E;  1RA4 A;  1DT9 A;  1S72 F;  4X3L A;  5GIO C;  3PAF A;  1VQP F;  3CCR F;  3OBY A;  1ZWZ A;  5EO3 A;  1GO1 A;  1VQ4 F;  4X3M A;  3MCA B;  3CXC F;  1X7P A;  2CZW A;  1KQS F;  2OZB A;  1K9M H;  1M90 H;  2OHW A;  3GYQ A;  1W42 A;  1VQM F;  5GAN K;  3NK6 A;  3CMA F;  1Q7Y H;  3LWV C;  1YHQ F;  1VQN F;  3CC4 F;  3LWP C;  3CC2 F;  1Q82 H;  3LWO C;  3CCV F;  2ALE A;  1M1K H;  5IT9 M;  1GO0 A;  2AIF A;  1VQ6 F;  1YJN F;  1VQ7 F;  3VI6 A;  1GZ0 A;  2QA4 F;  3E1Y A;  3CME F;  5FJ4 C;  3RA5 A;  2VGM A;  2KTU A;  3CCU F;  4TZZ A;  3J7A R;  1Q86 H;  1QVF F;  1NJI H;  1VQK F;  2I6D A;  5GIN C;  1VQ5 F;  1K8A H;  1QVG F;  1VQO F;  3IR9 A;  2KTV A;  1PXW A;  3I56 F;  3G71 F;  1W2B F;  3JCM M;  5GAP K;  3CCM F;  3NMU C;  1SDS A;  3WXM B;  3G4S F;  1K73 H;  2KG4 A;  1NMU B;  3SIV A;  3CCQ F;  1VQ8 F;  3FFM A;  1YIJ F;  2OTL F;  2OTJ F;  5DCV A;  1XBI A;  2FC3 A;  2QEX F;  1H7M A;  4BW0 B;  1E7K A;  2LBX A;  2LBW A;  3RA6 A;  3CD6 F;  2WAL A;  1IPA A;  1VQ9 F;  3G6E F;  5G4U C;  3O85 A;  3VMF B;  4NUT A;  1RLG A;  5A2Q M;  5GIP C;  3OW2 F;  4BY9 D;  3J81 M;  3V7Q A;  5FLX M;  3ON1 A;  4C4W C;  3V7E A;  3J80 M;  3SIU A;  3HAX D;  3HJW C;  1W40 A;  3NVI B;  3CCE F;  3LWR C;  1JJ2 F;  2BO1 A;  1CK2 A;  2VGN A;  3CCL F;  4LCK A;  5EWR A;  1N8R H;  1T0K B;  1KD1 H;  3E20 B;  1YI2 F;  3LWQ C;  3N4Y A;  3LFO A;  3OBW A;  5G4V C;  3CCS F;  2HVY D;  1X52 A;  3CPW F;  3CCJ F;  1X7O A;  3NK7 A;  1CN7 A;  3CG6 A;  1YIT F;  1YJ9 F;  1VQL F;  2QI2 A;  3CC7 F;  1KC8 H;  1Q81 H;  3JAM M;  3AGK A;  1YJW F;  1W3E X;  1W41 A;  3I55 F; 
#chains in the Genus database with same CATH topology
 3PLA C;  2DT4 A;  5HY1 A;  3PAF A;  4ZOL B;  3CCR F;  3TD3 A;  4TV8 B;  5ITZ A;  1X7P A;  2VXY A;  5LA6 B;  4I4T B;  3S0W A;  2OZB A;  1VH8 A;  4U3J B;  3C9T A;  4TV9 A;  4BT5 A;  3LWV C;  3S0H A;  3RYC A;  3CC4 F;  2GZL A;  2P6Y A;  4C82 A;  3FD5 A;  3Q8H A;  3VI6 A;  3HTN A;  3E1Y A;  1JFF B;  2VGM A;  3KE1 A;  3JAL A;  4IHJ B;  3D00 A;  2GVI A;  3ESJ A;  2UYJ A;  1FFX A;  3QUW A;  2VAM A;  1IV2 A;  2I6D A;  2UYN A;  2NMU A;  3KJJ A;  2QTP A;  1ONI A;  1TVK B;  3VYS C;  4U39 A;  2CSL A;  3M1X A;  4IIJ B;  3FPI A;  5JH7 A;  3JAR A;  2IG8 A;  2RB9 A;  1IV4 A;  4O4J A;  3JCM M;  2L26 A;  3JAW B;  3RYI A;  4O2B B;  1W5A A;  4R40 B;  3VIU A;  3WGJ A;  3ZOP A;  1U3L A;  4BT7 A;  3JVH A;  4NQ3 A;  1YIJ F;  5LP6 B;  5DCV A;  1XBI A;  5IJ9 B;  3RYF A;  2FC3 A;  3B6N A;  1W58 1;  4BW0 B;  4BT3 A;  3RA6 A;  4XCQ A;  5HY0 A;  2WAL A;  3CD6 F;  4C8G A;  3T80 A;  5IJ0 A;  4YJ3 B;  5G4U C;  2CHT A;  2RHJ A;  1YQN A;  1FSZ A;  5BMV A;  4NUT A;  5EYP A;  2LBT A;  3JAT B;  4BY9 D;  1OFU A;  4C4W C;  3V7E A;  3HKB B;  4O4L B;  4ZHQ A;  3TD4 A;  3HJW C;  1W40 A;  1IV1 A;  4DXD A;  2BO1 A;  1W57 A;  2BTO A;  4WBN B;  3UT5 B;  3E22 A;  5EZY B;  1W5B A;  3JAS A;  1H48 A;  2RHL A;  3P4E A;  3MDO A;  3LWQ C;  1VHA A;  1TUB B;  3S02 A;  3K14 A;  5KMG A;  3LFO A;  3OBW A;  2HS0 A;  4ZI7 A;  4BVQ A;  3CCJ F;  2HS3 A;  2VAW A;  3KIZ A;  3M4S A;  1YJ9 F;  1W5E A;  3WPX A;  3D01 A;  1YJW F;  3HWU A;  4G4Y A;  4X20 A;  4B45 A;  4KWE A;  3N4Z A;  3CPQ A;  5EB1 B;  1VK3 A;  4O2A B;  2JNB A;  3K0T A;  1JY8 A;  4I50 A;  3JAK B;  1S72 F;  1GX1 A;  1SA0 A;  4X3L A;  1JD1 A;  2Q1X A;  3K12 A;  2I6R A;  5CA1 A;  1GO1 A;  4TV9 B;  1VQ4 F;  4O4H B;  3MCA B;  3RYC B;  3F0G A;  3QTY A;  1XRG A;  3MCQ A;  3P10 A;  2OHW A;  2IAF A;  1YGY A;  2HQS C;  3HKD A;  3V4D A;  1W42 A;  2H6L A;  5C8Y A;  4F6R A;  1W55 A;  2GLZ A;  4X1Y B;  3C9S A;  3HKC A;  3JAL B;  1Q82 H;  3LWO C;  4B46 A;  4BVT A;  1M1K H;  1GO0 A;  1YJN F;  1VQ7 F;  3GTZ A;  3U0O A;  3ERN A;  2UYN B;  3N2G B;  3CME F;  3CB2 A;  3RA5 A;  2Z1T A;  2IQQ A;  2KTU A;  3CCU F;  4G4Z A;  2G9I A;  5JH7 B;  1W59 A;  4O4J B;  1J7H A;  5LYJ A;  2ZVZ A;  3RYI B;  1NJI H;  3S06 A;  1T0A A;  5GIN C;  1K8A H;  1QVG F;  2FGY A;  3IR9 A;  2KTV A;  2YYE A;  5JVD A;  5FNV A;  1PXW A;  3WJP A;  4E6E A;  1JN1 A;  3RYF B;  3NMU C;  2UYK A;  1Q8R A;  5GON A;  3F6M A;  5LXT B;  3D54 A;  3G4S F;  3K2X A;  4YJ2 A;  3IKF A;  1VQ8 F;  2CWJ A;  3FFM A;  2F9Z C;  4BT6 A;  2QEX F;  2CVL A;  4C8I A;  5BMV B;  5EYP B;  5KX5 A;  1IPA A;  4EI9 A;  1COM A;  4ZHQ B;  1VQ9 F;  2K1S A;  3WJR A;  3HKE A;  4EB6 A;  3MQW A;  3VMF B;  4O4I A;  4HNA A;  1RLG A;  4M8I A;  3J81 M;  3V7Q A;  3I3F A;  3ON1 A;  1PF5 A;  3VCZ A;  3CCE F;  2B33 A;  4I55 A;  4DRX A;  2H8E A;  3N2K A;  2VGN A;  2ZAU A;  4ZI7 B;  3M84 A;  4ZHW A;  3L7Q A;  1T0K B;  1KD1 H;  3E20 B;  4BT4 A;  5J2T B;  1YI2 F;  3IEW A;  5LOV A;  3N4Y A;  4X20 B;  5G4V C;  3CCS F;  1OAP A;  2HVY D;  3CPW F;  1QU9 A;  3FBA A;  3NK7 A;  1KNJ A;  3BYQ A;  1U43 A;  4BVR A;  4I50 B;  1YIT F;  4LNU A;  4TV8 A;  1VQL F;  1KC8 H;  1Q81 H;  1W5F A;  3WGM A;  2KGW A;  1W3E X;  4U3J A;  5CA1 B;  2HP0 A;  1U40 A;  2Q1Y A;  3S03 A;  3WJQ A;  5B8F A;  3HKD B;  5GIO C;  4F6R B;  3OBY A;  1ZWZ A;  5EO3 A;  4X3M A;  2CZW A;  3CYP B;  2RHO A;  3FD6 A;  4X1I A;  1KQS F;  1QD9 A;  1X25 A;  1K9M H;  5GAN K;  1U3P A;  5EIB D;  2R6R 1;  3DDN A;  1TVK A;  2ALE A;  3GHZ A;  5LYJ B;  1VQ6 F;  1SZQ A;  2QA4 F;  3CYQ A;  5ITZ B;  3DC2 A;  5JVD B;  4ZHY B;  5FNV B;  4C81 A;  3R0P A;  5HY2 A;  1QAH A;  1Z5W A;  4TZZ A;  1Q86 H;  1QVF F;  3WGL A;  2CW4 A;  1VQK F;  5GON B;  2N48 A;  2PMP A;  4G4V A;  4YJ2 B;  5HXU A;  3G71 F;  4FFB A;  4C8E A;  4EI8 A;  5JQG A;  4B62 A;  5GAP K;  1SDS A;  3WXM B;  1RLU A;  5CA0 A;  1R1M A;  1K73 H;  3RYH A;  5KX5 B;  1FFX B;  4RHA A;  4BT2 A;  3SIV A;  2HS4 A;  5J2U A;  4ZHV A;  2OTL F;  2LCA A;  3HKE B;  4EI7 A;  1XHO A;  3HKB A;  4O4L A;  5EAZ A;  4X1K A;  2HRU A;  3JAR B;  1E7K A;  2LBX A;  3TD5 A;  2EWC A;  4WBN A;  2Z1E A;  3OON A;  4DRX B;  2ZOD A;  4I55 B;  2HX0 A;  2H8C A;  3G6E F;  4B5C A;  3N2K B;  3IEQ A;  2PHN A;  1NQ3 A;  5GIP C;  3OW2 F;  3KJK A;  3LDT A;  3J80 M;  3SIU A;  3HAX D;  3WGN A;  3NVI B;  5LP6 C;  5LOV B;  3LWR C;  2AMT A;  1CK2 A;  5MN6 A;  5MN4 A;  4NWO B;  1N8R H;  5IJ0 B;  1VQV A;  3F0D A;  1IV3 A;  4LNU B;  5CB4 A;  4O2A A;  4G4X A;  2UZH A;  3JAK A;  3WPW A;  2HP0 B;  4TUY A;  1CN7 A;  1DBF A;  2DYY A;  5JCO C;  2QI2 A;  4O4H A;  3CC7 F;  3E22 B;  3JAM M;  3AGK A;  5IYZ A;  3JAS B;  1W41 A;  3VO8 A;  2Z1U A;  4X1Y A;  3NVK E;  1RA4 A;  1DT9 A;  5KMG B;  4X1I B;  2VAP A;  2Z01 A;  1VQP F;  3I7T A;  1ODE A;  3P0Z A;  4PWT A;  2OTM A;  3VTI C;  3WGK A;  3N2G A;  3RE3 A;  3CXC F;  2BTQ B;  1RQ7 A;  5HP7 A;  1M90 H;  3GYQ A;  4ZOL A;  1VQM F;  3ELC A;  3NK6 A;  3CMA F;  1Q7Y H;  2V9Y A;  3EOR A;  1SA0 B;  2CHS A;  1YHQ F;  3LWP C;  2HP3 A;  3CC2 F;  1Z5V A;  1VQN F;  1KNK A;  3CCV F;  5IT9 M;  2AIF A;  5LA6 A;  4I4T A;  2MQE A;  3LME A;  1GZ0 A;  3C8L A;  5FJ4 C;  2AIZ P;  2Z1F A;  3F0F A;  2RHH A;  5EB0 A;  5LXT A;  4FFB B;  5C8Y B;  3J7A R;  5JQG B;  3HKC B;  1VQ5 F;  5CA0 B;  1JFF A;  1VQO F;  1FNJ A;  2R75 1;  3RYH B;  4IHJ A;  3ZO8 A;  5J2U B;  3I56 F;  1W2B F;  2HRY A;  5HY4 A;  3CCM F;  5HWE A;  2UYP A;  4G4W A;  4X1K B;  3VOA A;  5HXZ A;  4ZK7 A;  2KG4 A;  3S0Y A;  4IIJ A;  1NMU B;  3F0E A;  3CCQ F;  4G88 A;  5HP8 A;  3LYB A;  3JAW A;  2OTJ F;  3MBM A;  4O2B A;  1H7M A;  1FNK A;  3KHN A;  3ZP4 A;  2LBW A;  3V3T A;  3VYU C;  3ZP7 A;  5AVM A;  5LP6 A;  5IJ9 A;  1CLI A;  3IMP A;  3IKE A;  2BTU A;  3O85 A;  5J2T A;  3C9U A;  2ZF8 A;  5A2Q M;  5FLX M;  1UI9 A;  1UFY A;  4RQO A;  4BVS A;  3QHD A;  5CB4 B;  3C9R A;  4YJ3 A;  1JJ2 F;  2ZOV A;  4LCK A;  5EWR A;  3JAT A;  4TUY B;  3VOB A;  4EB6 B;  5EIB C;  5JCO A;  4O4I B;  4HNA B;  1RQ2 A;  5IYZ B;  3VYT C;  1H47 A;  1X52 A;  1XV2 A;  1X7O A;  3UT5 A;  2ZVY A;  5EZY A;  3CG6 A;  2YXZ A;  1TUB A;  4ERH A;  5MN5 A;  3CCL F;  2W8B C;  3I55 F; 
#chains in the Genus database with same CATH homology
 3N4Z A;  3CPQ A;  2JNB A;  3PLA C;  3NVK E;  1RA4 A;  1DT9 A;  1S72 F;  5HY1 A;  4X3L A;  5GIO C;  3PAF A;  1VQP F;  3CCR F;  3OBY A;  1ZWZ A;  5EO3 A;  1GO1 A;  1VQ4 F;  4X3M A;  3MCA B;  3CXC F;  1X7P A;  2CZW A;  1KQS F;  2OZB A;  1K9M H;  1M90 H;  2OHW A;  3GYQ A;  1W42 A;  1VQM F;  2GLZ A;  5GAN K;  3NK6 A;  3CMA F;  1Q7Y H;  3LWV C;  1YHQ F;  1VQN F;  3CC4 F;  3LWP C;  3CC2 F;  1Q82 H;  3LWO C;  3CCV F;  4BVT A;  2ALE A;  1M1K H;  5IT9 M;  1GO0 A;  2AIF A;  1VQ6 F;  1YJN F;  1VQ7 F;  3VI6 A;  1GZ0 A;  2QA4 F;  3E1Y A;  3CME F;  5FJ4 C;  3RA5 A;  2VGM A;  2KTU A;  3CCU F;  5HY2 A;  3D00 A;  4TZZ A;  3J7A R;  1Q86 H;  1QVF F;  1NJI H;  1VQK F;  2I6D A;  5GIN C;  1VQ5 F;  1K8A H;  1QVG F;  1VQO F;  2FGY A;  3IR9 A;  2KTV A;  5HXU A;  1PXW A;  3I56 F;  3G71 F;  1W2B F;  3JCM M;  4EI8 A;  5HY4 A;  5GAP K;  3CCM F;  3NMU C;  5HWE A;  1SDS A;  3WXM B;  5HXZ A;  3G4S F;  1K73 H;  2KG4 A;  1NMU B;  3SIV A;  3CCQ F;  1VQ8 F;  3FFM A;  4NQ3 A;  1YIJ F;  2OTL F;  2OTJ F;  5DCV A;  1XBI A;  2F9Z C;  4EI7 A;  2FC3 A;  2QEX F;  1H7M A;  4BW0 B;  1E7K A;  2LBX A;  2LBW A;  3RA6 A;  4XCQ A;  3V3T A;  2WAL A;  5HY0 A;  3CD6 F;  1IPA A;  4EI9 A;  1VQ9 F;  3G6E F;  5G4U C;  3O85 A;  3VMF B;  4NUT A;  1RLG A;  5A2Q M;  5GIP C;  3OW2 F;  4BY9 D;  3J81 M;  3V7Q A;  5FLX M;  3ON1 A;  4C4W C;  3V7E A;  3J80 M;  4BVS A;  3SIU A;  3HAX D;  3HJW C;  1W40 A;  3NVI B;  3CCE F;  3LWR C;  1JJ2 F;  2BO1 A;  1CK2 A;  2VGN A;  3CCL F;  4LCK A;  5EWR A;  1N8R H;  1T0K B;  1KD1 H;  3E20 B;  1YI2 F;  3LWQ C;  3N4Y A;  3LFO A;  3OBW A;  5G4V C;  3CCS F;  2HVY D;  1X52 A;  4BVQ A;  3CPW F;  1X7O A;  3CCJ F;  3NK7 A;  1CN7 A;  4BVR A;  3CG6 A;  1YIT F;  1YJ9 F;  1VQL F;  2QI2 A;  3CC7 F;  1KC8 H;  1Q81 H;  3JAM M;  3AGK A;  1YJW F;  1W3E X;  1W41 A;  3I55 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...