3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords Probable tRNA pseudouridine synthase B
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
3CC7F 1YIJF 1VQKF 1YJ9F 5FJ4C 1KQSF 3E20B 3V7QA 3LWVC 3LWOC 1XBIA 3E1YA 3RA5A 5A2QM 2HVYD 1H7MA 3JAMM 1SDSA 3LWRC 3RA6A 3CPQA 3CG6A 4NUTA 1X7PA 3CCRF 2KG4A 1YJWF 3VMFB 1DT9A 4LCKA 5GIOC 1VQOF 5GINC 1Q81H 3IR9A 1JJ2F 1E7KA 3OW2F 3NVKE 3SIUA 3CCLF 3GYQA 1M90H 1W3EX 3CCVF 1VQNF 3J81M 3CMEF 1S72F 1W42A 3N4ZA 3CC2F 5FLXM 1X7OA 5GAPK 3G4SF 3OBWA 4BY9D 3CCUF 1Q86H 3CD6F 2OTJF 2BO1A 3PAFA 1RLGA 2OZBA 1VQ6F 5GIPC 3LWQC 1W2BF 3HAXD 3NK7A 3NVIB 1NMUB 4C4WC 1W40A 2FC3A 5IT9M 3CC4F 5EWRA 3LWPC 1K73H 3VI6A 5GANK 2QEXF 5EO3A 1T0KB 2LBWA 1VQ9F 3FFMA 1IPAA 1KD1H 1PXWA 2KTUA 3CMAF 1CN7A 2JNBA 1N8RH 2QA4F 1RA4A 4TZZA 3CCJF 3CCQF 1KC8H 3JCMM 3OBYA 1VQ8F 3HJWC 2VGMA 3G6EF 3CPWF 4X3LA 2LBXA 2OTLF 2CZWA 2QI2A 1YITF 1Q82H 1VQ5F 1YJNF 3CCMF 1W41A 1VQPF 3I55F 1ZWZA 1YHQF 2WALA 1VQ4F 3CCSF 2OHWA 3O85A 1X52A 3G71F 1M1KH 3CCEF 1K8AH 2AIFA 1VQ7F 2KTVA 3MCAB 3LFOA 5G4UC 4BW0B 1VQLF 1YI2F 1Q7YH 3NMUC 3NK6A 3J7AR 3SIVA 3J80M 5DCVA 1GO1A 1NJIH 5G4VC 1QVGF 3WXMB 1GZ0A 1QVFF 1VQMF 4X3MA 3PLAC 3V7EA 3CXCF 2I6DA 3ON1A 3AGKA 1CK2A 2VGNA 1GO0A 1K9MH 3I56F 2ALEA 3N4YA
chains in the Genus database with same CATH superfamily
4U39A 3IEQA 2BTUA 4ZHWA 3HKDB 4NWOB 3E20B 4IIJB 3V7QA 2Z1UA 4G88A 5J2TB 5IJ9A 2G9IA 2Z01A 1H7MA 2RHOA 3I3FA 5LOVA 5LP6C 5EB1B 1TUBA 1U3LA 3D00A 4ZOLA 5GIOC 2K1SA 5KMGB 1VQOF 1W59A 1E7KA 1RQ2A 3JARA 3CCLF 5JQGB 1FFXB 1H47A 1W5EA 3DC2A 3JATB 2Q1YA 2RHLA 2HP3A 5EIBC 3ESJA 1Z5VA 3L7QA 1X25A 5FLXM 5IYZA 5EYPA 2IQQA 2RB9A 2OTJF 1RLGA 2OZBA 5GIPC 3LWQC 5CA1A 5ITZA 4E6EA 1U43A 3JAWB 1W40A 2FC3A 3FD5A 3CC4F 4ERHA 1PF5A 3LWPC 5JVDB 1CLIA 1K73H 4ZI7B 4I4TA 3VOAA 4IIJA 1FNKA 1QU9A 1W57A 2LBWA 1T0KB 3BYQA 5J2TA 4O2BB 2QA4F 1RA4A 3ZO8A 4O4JB 4F6RA 4TV9B 3CYQA 3OBYA 3WJPA 2MQEA 1XV2A 2GZLA 3TD3A 4TV8B 2B33A 2VGMA 3WPWA 3GTZA 3CPWF 4X3LA 3MQWA 4FFBB 1JFFB 3VYSC 2OTLF 5JH7A 4BT7A 5KMGA 5HP7A 3S0YA 1VQ5F 1YJNF 5B8FA 2ZF8A 1W41A 4O4HB 3Q8HA 1FSZA 1FFXA 3O85A 5CB4A 5LP6A 3RYCA 1T0AA 2R751 4O4LA 3C9SA 3C9RA 3WGLA 2KTVA 3WGKA 4BT4A 3F0GA 4I50A 4BW0B 1VQLF 1Q7YH 3JALB 2Z1FA 5IJ9B 3WJQA 1DBFA 3MDOA 2ZVZA 5LOVB 1VQMF 3HKBA 3JAWA 4HNAB 3CXCF 2DYYA 1TUBB 2CSLA 2VGNA 4ZOLB 5JVDA 2FGYA 1KNKA 3CC7F 2UYKA 1YJ9F 5FJ4C 1J7HA 3RYFA 1H48A 4O4JA 4TV9A 3LYBA 4X20A 5HY4A 5CA0A 5A2QM 3JAMM 3EORA 4G4ZA 4X1YB 1RLUA 4NUTA 2R6R1 2HRUA 2KG4A 3M4SA 4FFBA 3VCZA 2W8BC 3WGNA 3ERNA 4LCKA 3HKCA 2CHTA 5CA1B 5ITZB 3FBAA 2CWJA 4IHJA 4I4TB 1QAHA 4I55B 3WGJA 3DDNA 2V9YA 3JALA 2GLZA 1S72F 5JCOC 2HX0A 4F6RB 3S0HA 5EZYA 3CD6F 2RHHA 4BT6A 4HNAA 1W2BF 3NVIB 3ZOPA 2YXZA 5JH7B 3K12A 2IAFA 2AIZP 5EWRA 2QEXF 3S06A 1YQNA 5AVMA 1VQ9F 2KTUA 1CN7A 3RYCB 2UYJA 5CB4B 5LP6B 1N8RH 5MN4A 2GVIA 3QUWA 4TZZA 4O4LB 4X1YA 4RHAA 3IKEA 2VXYA 1VQ8F 3FPIA 3HJWC 4I50B 1VK3A 3G6EF 4B45A 1COMA 3I7TA 2CHSA 1IV4A 1Q82H 3HKBB 4RQOA 1VQPF 3I55F 1ZWZA 2DT4A 1R1MA 1U40A 3IMPA 4I55A 3RYHB 1M1KH 3CCEF 1K8AH 1VQ7F 4BT5A 3JAKA 4X1KB 3RYFB 3LFOA 3QHDA 4YJ3A 1IV2A 4KWEA 3NMUC 3NK6A 4X20B 5EB0A 5CA0B 3J7AR 4M8IA 3JVHA 4XCQA 1NJIH 4G4XA 3V3TA 5G4VC 1JY8A 3R0PA 3IEWA 1GZ0A 3M1XA 3KJKA 4BVTA 3VYTC 1QVFF 2QTPA 2AMTA 2PMPA 4BVQA 3N2KA 1W581 1SZQA 4YJ2A 1ONIA 3HKCB 5JCOA 4ZHQB 5FNVA 2LCAA 1VQKF 4DRXB 1KQSF 4IHJB 3N2GA 3LWVC 2H6LA 1JD1A 3GHZA 1SA0A 2UYPA 3E1YA 3RA5A 1SDSA 2EWCA 1Q8RA 3P0ZA 3RA6A 3UT5A 2ZVYA 3WGMA 3CG6A 1U3PA 1X7PA 5GONA 1YJWF 1JN1A 5EZYB 3IKFA 2Z1EA 1QD9A 3P4EA 3OW2F 3M84A 3RYHA 4TUYA 4X1IB 3CCVF 4X1KA 4WBNA 4B46A 4C82A 2HS4A 2VAWA 4EI7A 2VAMA 3N4ZA 5LYJA 2HP0A 1KNJA 1X7OA 5GAPK 1VH8A 4C8IA 3E22B 4BY9D 3PAFA 3VIUA 4ZHYB 1NMUB 1RQ7A 3ZP4A 4G4WA 5IT9M 5LXTA 4ZHQA 3V4DA 3VI6A 4DRXA 5GANK 2RHJA 5BMVA 3CB2A 3OONA 3K14A 2LBTA 1KD1H 1PXWA 5EIBD 3B6NA 3CCQF 4G4VA 5HP8A 2PHNA 3JAKB 3FD6A 1W5AA 4YJ3B 3QTYA 1W5FA 3RE3A 5HXUA 1ODEA 4G4YA 2LBXA 3KE1A 3HKEB 3C9UA 2H8EA 2QI2A 1YITF 2ZAUA 3CCMF 2ZOVA 4O2AA 3N2KB 1YHQF 3RYIA 3CCSF 4YJ2B 4X1IA 3G71F 1OFUA 1VQVA 5FNVB 1OAPA 5HY0A 2HRYA 4B5CA 4BT2A 3N2GB 5G4UC 1YI2F 1SA0B 3VTIC 5J2UB 3E22A 3K0TA 5DCVA 3UT5B 1GO1A 5KX5B 1QVGF 3TD5A 2CW4A 3PLAC 2N48A 3MBMA 3V7EA 5GONB 2I6DA 1UI9A 1Z5WA 1CK2A 4LNUA 1K9MH 3I56F 3S0WA 2ALEA 5MN5A 1YIJF 4BT3A 4EI8A 1YGYA 2H8CA 4O4IA 1GO0A 4U3JA 3VO8A 2UYNA 3LWOC 1NQ3A 1XBIA 4TUYB 2BTOA 3KHNA 2HVYD 4WBNB 3LWRC 3ZP7A 4EI9A 3CPQA 3K2XA 1W55A 5LYJB 2HS0A 2HP0B 5IJ0B 2P6YA 3F6MA 1TVKA 4PWTA 3CCRF 3HKEA 3D01A 3S02A 4ZHVA 5HY1A 3VMFB 4C8GA 1DT9A 5GINC 3HTNA 1Q81H 3IR9A 3MCQA 5HWEA 3HKDA 1JJ2F 3T80A 5LXTB 3NVKE 4EB6B 2HQSC 5MN6A 3SIUA 3GYQA 2F9ZC 1M90H 1W3EX 5BMVB 2Q1XA 3J81M 1VQNF 3HWUA 3CMEF 1W42A 1XHOA 3TD4A 3P10A 4B62A 5J2UA 3CC2F 1GX1A 3G4SF 1UFYA 2UZHA 5KX5A 3JASB 3OBWA 3CCUF 1Q86H 2I6RA 3F0EA 5C8YB 2BO1A 1VQ6F 3HAXD 3NK7A 3U0OA 4BVSA 4C4WC 5LA6B 5EAZA 1FNJA 5JQGA 3LDTA 1IV1A 4O2AB 5EO3A 5HY2A 3F0DA 3JATA 3FFMA 3RYIB 1IPAA 4C8EA 3CMAF 3KIZA 2JNBA 3CCJF 1KC8H 3JCMM 2HS3A 5IJ0A 1VHAA 2IG8A 2YYEA 3ELCA 3D54A 2CZWA 2CVLA 3VOBA 4ZI7A 2VAPA 5HXZA 3CYPB 2BTQB 4EB6A 4NQ3A 4LNUB 2WALA 1VQ4F 2OHWA 3C9TA 4O2BA 4DXDA 2OTMA 2ZODA 1X52A 3JARB 4R40B 4C81A 3VYUC 3F0FA 2AIFA 4O4IB 2L26A 4U3JB 3MCAB 3WJRA 3LMEA 2NMUA 4TV8A 2UYNB 3S03A 3C8LA 4BVRA 3JASA 4ZK7A 1IV3A 3SIVA 3J80M 3KJJA 5C8YA 1JFFA 2KGWA 5IYZB 5EYPB 3WXMB 4X3MA 1TVKB 1W5BA 5LA6A 3ON1A 4O4HA 1XRGA 2Z1TA 3AGKA 3WPXA 3N4YA
chains in the Genus database with same CATH topology
3CC7F 1YIJF 1VQKF 4EI8A 1YJ9F 5FJ4C 1KQSF 3E20B 3V7QA 3LWVC 3LWOC 1XBIA 3E1YA 3RA5A 5HY4A 5A2QM 1H7MA 3JAMM 1SDSA 3LWRC 3RA6A 2HVYD 4EI9A 3CPQA 3CG6A 4NUTA 3I56F 1X7PA 3CCRF 2KG4A 1YJWF 3D00A 5HY1A 3VMFB 1DT9A 4LCKA 5GIOC 1VQOF 5GINC 1Q81H 3IR9A 5HWEA 1JJ2F 1E7KA 3OW2F 3NVKE 3SIUA 3CCLF 3GYQA 2F9ZC 1M90H 1W3EX 3CCVF 1VQNF 2GLZA 3J81M 3CMEF 1S72F 1W42A 3N4ZA 4EI7A 3CC2F 5FLXM 1X7OA 5GAPK 3G4SF 3OBWA 4BY9D 3CCUF 1Q86H 3CD6F 2OTJF 2BO1A 3PAFA 1RLGA 2OZBA 1VQ6F 5GIPC 3LWQC 1W2BF 3HAXD 3NK7A 3NVIB 1NMUB 4BVSA 4C4WC 1W40A 2FC3A 5IT9M 3CC4F 5EWRA 3LWPC 1K73H 3VI6A 5GANK 2QEXF 5EO3A 5HY2A 1T0KB 2LBWA 1VQ9F 3FFMA 1IPAA 1KD1H 1PXWA 2KTUA 3CMAF 1CN7A 2JNBA 1N8RH 2QA4F 1RA4A 4TZZA 3CCJF 3CCQF 1KC8H 3JCMM 3OBYA 1VQ8F 3HJWC 2VGMA 3G6EF 3CPWF 4X3LA 5HXUA 2LBXA 2OTLF 2CZWA 2QI2A 1YITF 1Q82H 1VQ5F 1YJNF 3CCMF 1W41A 5HXZA 1VQPF 4NQ3A 3I55F 1ZWZA 1YHQF 2WALA 1VQ4F 3CCSF 2OHWA 3O85A 1X52A 3G71F 5HY0A 1M1KH 3CCEF 1K8AH 2AIFA 1VQ7F 2KTVA 3MCAB 3LFOA 5G4UC 4BW0B 1VQLF 1YI2F 1Q7YH 4BVRA 3NMUC 3NK6A 3J7AR 3SIVA 3J80M 5DCVA 4XCQA 1GO1A 3V3TA 1NJIH 5G4VC 1QVGF 3WXMB 1GZ0A 1QVFF 4BVTA 4X3MA 1VQMF 3PLAC 3V7EA 3CXCF 2I6DA 3ON1A 4BVQA 3AGKA 1CK2A 2VGNA 1GO0A 1K9MH 2FGYA 2ALEA 3N4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 F;  1YIJ F;  1VQK F;  1YJ9 F;  5FJ4 C;  1KQS F;  3E20 B;  3V7Q A;  3LWV C;  3LWO C;  1XBI A;  3E1Y A;  3RA5 A;  5A2Q M;  2HVY D;  1H7M A;  3JAM M;  1SDS A;  3LWR C;  3RA6 A;  3CPQ A;  3CG6 A;  4NUT A;  1X7P A;  3CCR F;  2KG4 A;  1YJW F;  3VMF B;  1DT9 A;  4LCK A;  5GIO C;  1VQO F;  5GIN C;  1Q81 H;  3IR9 A;  1JJ2 F;  1E7K A;  3OW2 F;  3NVK E;  3SIU A;  3CCL F;  3GYQ A;  1M90 H;  1W3E X;  3CCV F;  1VQN F;  3J81 M;  3CME F;  1S72 F;  1W42 A;  3N4Z A;  3CC2 F;  5FLX M;  1X7O A;  5GAP K;  3G4S F;  3OBW A;  4BY9 D;  3CCU F;  1Q86 H;  3CD6 F;  2OTJ F;  2BO1 A;  3PAF A;  1RLG A;  2OZB A;  1VQ6 F;  5GIP C;  3LWQ C;  1W2B F;  3HAX D;  3NK7 A;  3NVI B;  1NMU B;  4C4W C;  1W40 A;  2FC3 A;  5IT9 M;  3CC4 F;  5EWR A;  3LWP C;  1K73 H;  3VI6 A;  5GAN K;  2QEX F;  5EO3 A;  1T0K B;  2LBW A;  1VQ9 F;  3FFM A;  1IPA A;  1KD1 H;  1PXW A;  2KTU A;  3CMA F;  1CN7 A;  2JNB A;  1N8R H;  2QA4 F;  1RA4 A;  4TZZ A;  3CCJ F;  3CCQ F;  1KC8 H;  3JCM M;  3OBY A;  1VQ8 F;  3HJW C;  2VGM A;  3G6E F;  3CPW F;  4X3L A;  2LBX A;  2OTL F;  2CZW A;  2QI2 A;  1YIT F;  1Q82 H;  1VQ5 F;  1YJN F;  3CCM F;  1W41 A;  1VQP F;  3I55 F;  1ZWZ A;  1YHQ F;  2WAL A;  1VQ4 F;  3CCS F;  2OHW A;  3O85 A;  1X52 A;  3G71 F;  1M1K H;  3CCE F;  1K8A H;  2AIF A;  1VQ7 F;  2KTV A;  3MCA B;  3LFO A;  5G4U C;  4BW0 B;  1VQL F;  1YI2 F;  1Q7Y H;  3NMU C;  3NK6 A;  3J7A R;  3SIV A;  3J80 M;  5DCV A;  1GO1 A;  1NJI H;  5G4V C;  1QVG F;  3WXM B;  1GZ0 A;  1QVF F;  1VQM F;  4X3M A;  3PLA C;  3V7E A;  3CXC F;  2I6D A;  3ON1 A;  3AGK A;  1CK2 A;  2VGN A;  1GO0 A;  1K9M H;  3I56 F;  2ALE A;  3N4Y A; 
#chains in the Genus database with same CATH topology
 4U39 A;  3IEQ A;  2BTU A;  4ZHW A;  3HKD B;  4NWO B;  3E20 B;  4IIJ B;  3V7Q A;  2Z1U A;  4G88 A;  5J2T B;  5IJ9 A;  2G9I A;  2Z01 A;  1H7M A;  2RHO A;  3I3F A;  5LOV A;  5LP6 C;  5EB1 B;  1TUB A;  1U3L A;  3D00 A;  4ZOL A;  5GIO C;  2K1S A;  5KMG B;  1VQO F;  1W59 A;  1E7K A;  1RQ2 A;  3JAR A;  3CCL F;  5JQG B;  1FFX B;  1H47 A;  1W5E A;  3DC2 A;  3JAT B;  2Q1Y A;  2RHL A;  2HP3 A;  5EIB C;  3ESJ A;  1Z5V A;  3L7Q A;  1X25 A;  5FLX M;  5IYZ A;  5EYP A;  2IQQ A;  2RB9 A;  2OTJ F;  1RLG A;  2OZB A;  5GIP C;  3LWQ C;  5CA1 A;  5ITZ A;  4E6E A;  1U43 A;  3JAW B;  1W40 A;  2FC3 A;  3FD5 A;  3CC4 F;  4ERH A;  1PF5 A;  3LWP C;  5JVD B;  1CLI A;  1K73 H;  4ZI7 B;  4I4T A;  3VOA A;  4IIJ A;  1FNK A;  1QU9 A;  1W57 A;  2LBW A;  1T0K B;  3BYQ A;  5J2T A;  4O2B B;  2QA4 F;  1RA4 A;  3ZO8 A;  4O4J B;  4F6R A;  4TV9 B;  3CYQ A;  3OBY A;  3WJP A;  2MQE A;  1XV2 A;  2GZL A;  3TD3 A;  4TV8 B;  2B33 A;  2VGM A;  3WPW A;  3GTZ A;  3CPW F;  4X3L A;  3MQW A;  4FFB B;  1JFF B;  3VYS C;  2OTL F;  5JH7 A;  4BT7 A;  5KMG A;  5HP7 A;  3S0Y A;  1VQ5 F;  1YJN F;  5B8F A;  2ZF8 A;  1W41 A;  4O4H B;  3Q8H A;  1FSZ A;  1FFX A;  3O85 A;  5CB4 A;  5LP6 A;  3RYC A;  1T0A A;  2R75 1;  4O4L A;  3C9S A;  3C9R A;  3WGL A;  2KTV A;  3WGK A;  4BT4 A;  3F0G A;  4I50 A;  4BW0 B;  1VQL F;  1Q7Y H;  3JAL B;  2Z1F A;  5IJ9 B;  3WJQ A;  1DBF A;  3MDO A;  2ZVZ A;  5LOV B;  1VQM F;  3HKB A;  3JAW A;  4HNA B;  3CXC F;  2DYY A;  1TUB B;  2CSL A;  2VGN A;  4ZOL B;  5JVD A;  2FGY A;  1KNK A;  3CC7 F;  2UYK A;  1YJ9 F;  5FJ4 C;  1J7H A;  3RYF A;  1H48 A;  4O4J A;  4TV9 A;  3LYB A;  4X20 A;  5HY4 A;  5CA0 A;  5A2Q M;  3JAM M;  3EOR A;  4G4Z A;  4X1Y B;  1RLU A;  4NUT A;  2R6R 1;  2HRU A;  2KG4 A;  3M4S A;  4FFB A;  3VCZ A;  2W8B C;  3WGN A;  3ERN A;  4LCK A;  3HKC A;  2CHT A;  5CA1 B;  5ITZ B;  3FBA A;  2CWJ A;  4IHJ A;  4I4T B;  1QAH A;  4I55 B;  3WGJ A;  3DDN A;  2V9Y A;  3JAL A;  2GLZ A;  1S72 F;  5JCO C;  2HX0 A;  4F6R B;  3S0H A;  5EZY A;  3CD6 F;  2RHH A;  4BT6 A;  4HNA A;  1W2B F;  3NVI B;  3ZOP A;  2YXZ A;  5JH7 B;  3K12 A;  2IAF A;  2AIZ P;  5EWR A;  2QEX F;  3S06 A;  1YQN A;  5AVM A;  1VQ9 F;  2KTU A;  1CN7 A;  3RYC B;  2UYJ A;  5CB4 B;  5LP6 B;  1N8R H;  5MN4 A;  2GVI A;  3QUW A;  4TZZ A;  4O4L B;  4X1Y A;  4RHA A;  3IKE A;  2VXY A;  1VQ8 F;  3FPI A;  3HJW C;  4I50 B;  1VK3 A;  3G6E F;  4B45 A;  1COM A;  3I7T A;  2CHS A;  1IV4 A;  1Q82 H;  3HKB B;  4RQO A;  1VQP F;  3I55 F;  1ZWZ A;  2DT4 A;  1R1M A;  1U40 A;  3IMP A;  4I55 A;  3RYH B;  1M1K H;  3CCE F;  1K8A H;  1VQ7 F;  4BT5 A;  3JAK A;  4X1K B;  3RYF B;  3LFO A;  3QHD A;  4YJ3 A;  1IV2 A;  4KWE A;  3NMU C;  3NK6 A;  4X20 B;  5EB0 A;  5CA0 B;  3J7A R;  4M8I A;  3JVH A;  4XCQ A;  1NJI H;  4G4X A;  3V3T A;  5G4V C;  1JY8 A;  3R0P A;  3IEW A;  1GZ0 A;  3M1X A;  3KJK A;  4BVT A;  3VYT C;  1QVF F;  2QTP A;  2AMT A;  2PMP A;  4BVQ A;  3N2K A;  1W58 1;  1SZQ A;  4YJ2 A;  1ONI A;  3HKC B;  5JCO A;  4ZHQ B;  5FNV A;  2LCA A;  1VQK F;  4DRX B;  1KQS F;  4IHJ B;  3N2G A;  3LWV C;  2H6L A;  1JD1 A;  3GHZ A;  1SA0 A;  2UYP A;  3E1Y A;  3RA5 A;  1SDS A;  2EWC A;  1Q8R A;  3P0Z A;  3RA6 A;  3UT5 A;  2ZVY A;  3WGM A;  3CG6 A;  1U3P A;  1X7P A;  5GON A;  1YJW F;  1JN1 A;  5EZY B;  3IKF A;  2Z1E A;  1QD9 A;  3P4E A;  3OW2 F;  3M84 A;  3RYH A;  4TUY A;  4X1I B;  3CCV F;  4X1K A;  4WBN A;  4B46 A;  4C82 A;  2HS4 A;  2VAW A;  4EI7 A;  2VAM A;  3N4Z A;  5LYJ A;  2HP0 A;  1KNJ A;  1X7O A;  5GAP K;  1VH8 A;  4C8I A;  3E22 B;  4BY9 D;  3PAF A;  3VIU A;  4ZHY B;  1NMU B;  1RQ7 A;  3ZP4 A;  4G4W A;  5IT9 M;  5LXT A;  4ZHQ A;  3V4D A;  3VI6 A;  4DRX A;  5GAN K;  2RHJ A;  5BMV A;  3CB2 A;  3OON A;  3K14 A;  2LBT A;  1KD1 H;  1PXW A;  5EIB D;  3B6N A;  3CCQ F;  4G4V A;  5HP8 A;  2PHN A;  3JAK B;  3FD6 A;  1W5A A;  4YJ3 B;  3QTY A;  1W5F A;  3RE3 A;  5HXU A;  1ODE A;  4G4Y A;  2LBX A;  3KE1 A;  3HKE B;  3C9U A;  2H8E A;  2QI2 A;  1YIT F;  2ZAU A;  3CCM F;  2ZOV A;  4O2A A;  3N2K B;  1YHQ F;  3RYI A;  3CCS F;  4YJ2 B;  4X1I A;  3G71 F;  1OFU A;  1VQV A;  5FNV B;  1OAP A;  5HY0 A;  2HRY A;  4B5C A;  4BT2 A;  3N2G B;  5G4U C;  1YI2 F;  1SA0 B;  3VTI C;  5J2U B;  3E22 A;  3K0T A;  5DCV A;  3UT5 B;  1GO1 A;  5KX5 B;  1QVG F;  3TD5 A;  2CW4 A;  3PLA C;  2N48 A;  3MBM A;  3V7E A;  5GON B;  2I6D A;  1UI9 A;  1Z5W A;  1CK2 A;  4LNU A;  1K9M H;  3I56 F;  3S0W A;  2ALE A;  5MN5 A;  1YIJ F;  4BT3 A;  4EI8 A;  1YGY A;  2H8C A;  4O4I A;  1GO0 A;  4U3J A;  3VO8 A;  2UYN A;  3LWO C;  1NQ3 A;  1XBI A;  4TUY B;  2BTO A;  3KHN A;  2HVY D;  4WBN B;  3LWR C;  3ZP7 A;  4EI9 A;  3CPQ A;  3K2X A;  1W55 A;  5LYJ B;  2HS0 A;  2HP0 B;  5IJ0 B;  2P6Y A;  3F6M A;  1TVK A;  4PWT A;  3CCR F;  3HKE A;  3D01 A;  3S02 A;  4ZHV A;  5HY1 A;  3VMF B;  4C8G A;  1DT9 A;  5GIN C;  3HTN A;  1Q81 H;  3IR9 A;  3MCQ A;  5HWE A;  3HKD A;  1JJ2 F;  3T80 A;  5LXT B;  3NVK E;  4EB6 B;  2HQS C;  5MN6 A;  3SIU A;  3GYQ A;  2F9Z C;  1M90 H;  1W3E X;  5BMV B;  2Q1X A;  3J81 M;  1VQN F;  3HWU A;  3CME F;  1W42 A;  1XHO A;  3TD4 A;  3P10 A;  4B62 A;  5J2U A;  3CC2 F;  1GX1 A;  3G4S F;  1UFY A;  2UZH A;  5KX5 A;  3JAS B;  3OBW A;  3CCU F;  1Q86 H;  2I6R A;  3F0E A;  5C8Y B;  2BO1 A;  1VQ6 F;  3HAX D;  3NK7 A;  3U0O A;  4BVS A;  4C4W C;  5LA6 B;  5EAZ A;  1FNJ A;  5JQG A;  3LDT A;  1IV1 A;  4O2A B;  5EO3 A;  5HY2 A;  3F0D A;  3JAT A;  3FFM A;  3RYI B;  1IPA A;  4C8E A;  3CMA F;  3KIZ A;  2JNB A;  3CCJ F;  1KC8 H;  3JCM M;  2HS3 A;  5IJ0 A;  1VHA A;  2IG8 A;  2YYE A;  3ELC A;  3D54 A;  2CZW A;  2CVL A;  3VOB A;  4ZI7 A;  2VAP A;  5HXZ A;  3CYP B;  2BTQ B;  4EB6 A;  4NQ3 A;  4LNU B;  2WAL A;  1VQ4 F;  2OHW A;  3C9T A;  4O2B A;  4DXD A;  2OTM A;  2ZOD A;  1X52 A;  3JAR B;  4R40 B;  4C81 A;  3VYU C;  3F0F A;  2AIF A;  4O4I B;  2L26 A;  4U3J B;  3MCA B;  3WJR A;  3LME A;  2NMU A;  4TV8 A;  2UYN B;  3S03 A;  3C8L A;  4BVR A;  3JAS A;  4ZK7 A;  1IV3 A;  3SIV A;  3J80 M;  3KJJ A;  5C8Y A;  1JFF A;  2KGW A;  5IYZ B;  5EYP B;  3WXM B;  4X3M A;  1TVK B;  1W5B A;  5LA6 A;  3ON1 A;  4O4H A;  1XRG A;  2Z1T A;  3AGK A;  3WPX A;  3N4Y A; 
#chains in the Genus database with same CATH homology
 3CC7 F;  1YIJ F;  1VQK F;  4EI8 A;  1YJ9 F;  5FJ4 C;  1KQS F;  3E20 B;  3V7Q A;  3LWV C;  3LWO C;  1XBI A;  3E1Y A;  3RA5 A;  5HY4 A;  5A2Q M;  1H7M A;  3JAM M;  1SDS A;  3LWR C;  3RA6 A;  2HVY D;  4EI9 A;  3CPQ A;  3CG6 A;  4NUT A;  3I56 F;  1X7P A;  3CCR F;  2KG4 A;  1YJW F;  3D00 A;  5HY1 A;  3VMF B;  1DT9 A;  4LCK A;  5GIO C;  1VQO F;  5GIN C;  1Q81 H;  3IR9 A;  5HWE A;  1JJ2 F;  1E7K A;  3OW2 F;  3NVK E;  3SIU A;  3CCL F;  3GYQ A;  2F9Z C;  1M90 H;  1W3E X;  3CCV F;  1VQN F;  2GLZ A;  3J81 M;  3CME F;  1S72 F;  1W42 A;  3N4Z A;  4EI7 A;  3CC2 F;  5FLX M;  1X7O A;  5GAP K;  3G4S F;  3OBW A;  4BY9 D;  3CCU F;  1Q86 H;  3CD6 F;  2OTJ F;  2BO1 A;  3PAF A;  1RLG A;  2OZB A;  1VQ6 F;  5GIP C;  3LWQ C;  1W2B F;  3HAX D;  3NK7 A;  3NVI B;  1NMU B;  4BVS A;  4C4W C;  1W40 A;  2FC3 A;  5IT9 M;  3CC4 F;  5EWR A;  3LWP C;  1K73 H;  3VI6 A;  5GAN K;  2QEX F;  5EO3 A;  5HY2 A;  1T0K B;  2LBW A;  1VQ9 F;  3FFM A;  1IPA A;  1KD1 H;  1PXW A;  2KTU A;  3CMA F;  1CN7 A;  2JNB A;  1N8R H;  2QA4 F;  1RA4 A;  4TZZ A;  3CCJ F;  3CCQ F;  1KC8 H;  3JCM M;  3OBY A;  1VQ8 F;  3HJW C;  2VGM A;  3G6E F;  3CPW F;  4X3L A;  5HXU A;  2LBX A;  2OTL F;  2CZW A;  2QI2 A;  1YIT F;  1Q82 H;  1VQ5 F;  1YJN F;  3CCM F;  1W41 A;  5HXZ A;  1VQP F;  4NQ3 A;  3I55 F;  1ZWZ A;  1YHQ F;  2WAL A;  1VQ4 F;  3CCS F;  2OHW A;  3O85 A;  1X52 A;  3G71 F;  5HY0 A;  1M1K H;  3CCE F;  1K8A H;  2AIF A;  1VQ7 F;  2KTV A;  3MCA B;  3LFO A;  5G4U C;  4BW0 B;  1VQL F;  1YI2 F;  1Q7Y H;  4BVR A;  3NMU C;  3NK6 A;  3J7A R;  3SIV A;  3J80 M;  5DCV A;  4XCQ A;  1GO1 A;  3V3T A;  1NJI H;  5G4V C;  1QVG F;  3WXM B;  1GZ0 A;  1QVF F;  4BVT A;  4X3M A;  1VQM F;  3PLA C;  3V7E A;  3CXC F;  2I6D A;  3ON1 A;  4BVQ A;  3AGK A;  1CK2 A;  2VGN A;  1GO0 A;  1K9M H;  2FGY A;  2ALE A;  3N4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...