3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
1YJNF 3NVIB 3ON1A 3G4SF 1IPAA 1NJIH 5GANK 1KQSF 4TZZA 3OW2F 1KC8H 3NK6A 1VQ6F 1YHQF 3J7AR 3SIUA 3V7QA 3FFMA 3HAXD 2KTUA 1KD1H 1RLGA 3CCEF 5FLXM 1SDSA 3SIVA 5GINC 2FC3A 5DCVA 5FJ4C 1CK2A 1NMUB 3CCSF 3AGKA 1YI2F 1K73H 1N8RH 3JCMM 1VQ4F 3LWOC 1YITF 1W40A 3E1YA 3WXMB 1H7MA 3OBYA 2QI2A 3G71F 2HVYD 3V7EA 2LBXA 1CN7A 2KG4A 1W3EX 1W41A 3J81M 1K8AH 3RA6A 2JNBA 3G6EF 1Q7YH 1W2BF 1M90H 2OTLF 3OBWA 2QEXF 1Q86H 2BO1A 2CZWA 1S72F 3NK7A 3GYQA 1QVGF 4LCKA 5EWRA 2QA4F 3VI6A 1W42A 5GAPK 1GO1A 4BY9D 1T0KB 3LWQC 2OHWA 1VQ8F 3NMUC 1PXWA 5EO3A 5A2QM 4BW0B 3CMEF 3CCMF 1YIJF 3E20B 3N4YA 1GO0A 1VQLF 4X3LA 3LWRC 3MCAB 2KTVA 4X3MA 3RA5A 3CD6F 1VQNF 3VMFB 3I56F 1YJ9F 3CMAF 3CPWF 5GIPC 1VQ7F 2AIFA 3CCQF 3CCUF 3CCJF 2I6DA 3CCLF 1DT9A 3JAMM 3CG6A 1E7KA 5G4UC 1VQOF 1K9MH 1VQPF 4C4WC 1ZWZA 1Q82H 1QVFF 3CXCF 1X52A 3IR9A 3LWVC 1X7PA 1VQKF 2WALA 3J80M 2LBWA 2VGMA 5G4VC 3N4ZA 2VGNA 5IT9M 1RA4A 1VQ9F 3O85A 4NUTA 2ALEA 1VQMF 1JJ2F 3CC4F 5GIOC 3NVKE 1X7OA 3CPQA 3CCRF 3PAFA 3CC2F 1Q81H 2OZBA 1M1KH 3PLAC 3CC7F 3CCVF 1XBIA 1YJWF 1VQ5F 3HJWC 3I55F 3LWPC 1GZ0A 3LFOA 2OTJF
chains in the Genus database with same CATH superfamily
3IEQA 5KX5B 3VYSC 2ZAUA 5EZYA 5CB4B 3ON1A 4ZHQA 5EZYB 1VH8A 3N2GA 3WPXA 5GANK 3I7TA 4YJ2B 3NK6A 5J2UA 3T80A 1KNJA 5J2UB 3V4DA 3IKFA 2ZODA 2N48A 3V7QA 3VCZA 4LNUA 5JCOC 3HAXD 3U0OA 4LNUB 5DCVA 2IQQA 4EI9A 5FJ4C 1CK2A 3KHNA 3C9SA 3L7QA 3MCQA 5LA6A 1VQ4F 4BT3A 3LWOC 5LA6B 3G71F 3WGJA 2LBXA 3CB2A 4ZI7A 3I3FA 3WGNA 2H8CA 4TUYB 1QU9A 4ZHWA 4B62A 3G6EF 3OBWA 1Q86H 2BO1A 1GX1A 1YQNA 2RHJA 3WJQA 5CA0A 3JARA 5EIBD 1DBFA 4IHJA 3VI6A 3ELCA 3JARB 4IHJB 2OHWA 5HP8A 5A2QM 4BW0B 4BT4A 3CCMF 5LXTA 3D00A 2BTQB 3N4YA 4DRXA 1VQLF 4B5CA 4DRXB 3MCAB 5EIBC 2HP0A 2V9YA 2HP0B 3VMFB 3CMAF 5GIPC 5EAZA 3HKCB 3S03A 4IIJB 3CCUF 1W55A 3M4SA 3WGMA 5IJ0A 3JAMM 4ERHA 5AVMA 4O4HA 5IJ0B 3ERNA 1FSZA 4O4HB 2VAWA 4B46A 1JY8A 1ZWZA 3F0GA 3CXCF 3IR9A 4X1YA 3VTIC 1XHOA 3JAKA 3RYIB 3ZP4A 2VGMA 3JAKB 3V3TA 1IV1A 4EB6A 2Z1TA 2RB9A 1RA4A 4HNAB 1U43A 1U40A 1X7OA 2HS0A 3CCRF 4NQ3A 3PLAC 3HJWC 4O2AB 3LWPC 3ESJA 3C8LA 3KJJA 3VYUC 2LCAA 2UYJA 3NVIB 3EORA 5EYPA 1NJIH 3MQWA 4BT6A 1YGYA 2Z1EA 5JQGB 4C8IA 1QD9A 5C8YA 4I55A 4G4WA 1OFUA 3GHZA 5C8YB 4I55B 1XV2A 2H6LA 4EI8A 4O4LA 4R40B 3FFMA 3MDOA 1J7HA 2MQEA 5JH7A 4WBNA 1Z5VA 3JASA 3SIVA 5JH7B 2FC3A 4WBNB 3JASB 3JALA 4DXDA 1VHAA 1NMUB 3JALB 4O4IA 3KIZA 5HXUA 1W5AA 2PMPA 2L26A 1YITF 3WGLA 5CB4A 3E1YA 2QI2A 4BVQA 4U39A 2KG4A 1W41A 2Z1UA 5HWEA 3J81M 4YJ2A 2OTLF 3KE1A 3RYHB 1JFFB 3NK7A 2DYYA 5HY2A 1UFYA 5EWRA 1W42A 1T0KB 2YXZA 5EO3A 3S02A 4TUYA 4C82A 2Q1YA 3F6MA 2IAFA 3RE3A 4X3LA 4C8EA 3C9UA 4NWOB 4O2BB 4ZHYB 4G4ZA 2ZVYA 1RLUA 5BMVA 5J2TA 1SZQA 1VQVA 3FD5A 5BMVB 1H48A 5J2TB 3CCQF 3P10A 3CCLF 1W59A 2H8EA 2CSLA 2HQSC 3D54A 1TVKB 2HRUA 1K9MH 4B45A 4E6EA 1Q82H 3F0DA 1X52A 4C8GA 2F9ZC 1VQKF 1R1MA 4ZHVA 3VOAA 4X1KB 3JATA 3FD6A 2LBTA 3JATB 5IT9M 3IKEA 3K2XA 4I4TA 2RHLA 3WGKA 3K0TA 4F6RB 2UYNB 3K12A 4I4TB 5MN6A 2ALEA 4BT2A 4TV8B 5HP7A 2GLZA 2NMUA 3NVKE 3HKCA 4IIJA 1Q81H 3CC2F 4X20A 1M1KH 2OZBA 4X20B 1XBIA 4RQOA 3QTYA 3TD5A 3ZP7A 2UYPA 3I55F 5LOVB 3LFOA 1PF5A 2HRYA 2R6R1 3G4SF 3S06A 5CA1B 5IJ9B 3RYIA 2PHNA 1T0AA 3E22A 2GVIA 1KQSF 4TZZA 3OW2F 1KC8H 3E22B 5IYZB 1IV4A 4M8IA 3GTZA 4HNAA 4I50B 2VAMA 3WJRA 3SIUA 1U3PA 2KTUA 1RLGA 3CCEF 4BVSA 1SDSA 5LP6C 4YJ3A 3JAWA 2YYEA 3F0FA 4YJ3B 3VYTC 3JAWB 3CCSF 3AGKA 4O2AA 1N8RH 1FFXB 1W581 4G4VA 2P6YA 3S0HA 4TV9B 2VXYA 1H7MA 2HVYD 3V7EA 4EI7A 1W3EX 3B6NA 5JQGA 2CHSA 3RA6A 4KWEA 3Q8HA 1W2BF 5MN4A 1IV3A 1H47A 2QEXF 3VO8A 1OAPA 3P0ZA 1S72F 5LP6B 5HY4A 2CWJA 2QA4F 2Z1FA 5GAPK 3LWQC 3MBMA 1W57A 1VQ8F 3NMUC 2GZLA 5EB1B 3RYFB 3CMEF 1YIJF 3UT5B 3E20B 2CVLA 3LYBA 1KNKA 4G4YA 1GO0A 2ZOVA 3DC2A 4FFBB 3LWRC 2VAPA 3RYHA 2ZF8A 1JFFA 1VQNF 2G9IA 3I56F 4U3JB 3WPWA 1VQ7F 3CCJF 2I6DA 1DT9A 2KGWA 5HY1A 4PWTA 3CG6A 1E7KA 2IG8A 1TUBB 3ZOPA 5G4UC 4BVRA 2I6RA 1U3LA 3TD3A 1VQPF 2R751 1Q8RA 1JN1A 4ZOLA 3LWVC 1JD1A 1X7PA 4ZHQB 1FNJA 2WALA 1W5BA 3HKDA 4ZOLB 5HXZA 3HKDB 3N2GB 5G4VC 3M1XA 1VK3A 3ZO8A 1IV2A 1VQ9F 4O2BA 4NUTA 1VQMF 5GONA 3CC4F 5JCOA 4BT5A 5ITZA 5MN5A 5GONB 5GIOC 2RHOA 5ITZB 3D01A 3PAFA 3HKBA 2HS4A 3HKBB 3CCVF 1YJWF 1TVKA 1COMA 1XRGA 3P4EA 2OTJF 5KMGA 1YJNF 2B33A 1ODEA 1ONIA 3F0EA 5KMGB 1IPAA 3K14A 4ZI7B 4X1KA 1W5EA 3C9TA 1VQ6F 1Z5WA 4F6RA 1YHQF 2UYNA 1W5FA 4TV8A 3J7AR 5JVDA 4BT7A 3IEWA 5JVDB 1KD1H 4RHAA 5FLXM 5CA0B 3M84A 3DDNA 2OTMA 3BYQA 5GINC 2HP3A 5B8FA 2Q1XA 2RHHA 1UI9A 4G4XA 1YI2F 3VOBA 5LOVA 1K73H 3JCMM 3WJPA 4C81A 1W40A 1NQ3A 3WXMB 1RQ7A 3OBYA 5CA1A 5IJ9A 5LXTB 4G88A 1K8AH 5IYZA 2JNBA 3TD4A 1Q7YH 1M90H 2Z01A 2ZVZA 4I50A 2AMTA 4BVTA 3QUWA 5LYJA 2CZWA 3LMEA 1SA0A 5LYJB 1SA0B 3GYQA 2BTOA 1QVGF 4LCKA 3CYPB 2CHTA 4BY9D 1GO1A 2QTPA 3JVHA 2FGYA 3KJKA 4O4JA 1FFXA 4O4JB 4TV9A 4X1IA 2DT4A 1PXWA 4X1YB 2CW4A 4X1IB 1X25A 3FBAA 4EB6B 5HY0A 3CYQA 5FNVA 2KTVA 4X3MA 3RA5A 2W8BC 2UZHA 4XCQA 5FNVB 3CD6F 3IMPA 1YJ9F 3CPWF 5LP6A 3S0YA 2AIFA 3HTNA 3OONA 5EB0A 3HKEA 3HWUA 3C9RA 3LDTA 1FNKA 3HKEB 2K1SA 4ZK7A 1VQOF 4C4WC 1QVFF 3RYFA 2AIZP 5EYPB 3UT5A 3J80M 2LBWA 3N4ZA 2BTUA 3QHDA 2VGNA 4FFBA 3RYCA 3N2KA 3RYCB 2HX0A 3N2KB 3O85A 3VIUA 1JJ2F 4O4LB 3R0PA 1QAHA 4U3JA 3CPQA 2UYKA 3FPIA 1RQ2A 2EWCA 3CC7F 1VQ5F 1TUBA 1CLIA 4O4IB 5KX5A 1GZ0A 1CN7A 3S0WA 2HS3A
chains in the Genus database with same CATH topology
1YJNF 3NVIB 3ON1A 3G4SF 1IPAA 1NJIH 5GANK 1KQSF 4TZZA 3OW2F 1KC8H 3NK6A 1VQ6F 1YHQF 4EI8A 3J7AR 3SIUA 3V7QA 3FFMA 3HAXD 2KTUA 1KD1H 1RLGA 3CCEF 4BVSA 5FLXM 1SDSA 5GINC 2FC3A 4EI9A 3SIVA 5DCVA 5FJ4C 1CK2A 1NMUB 3CCSF 3AGKA 1YI2F 5HXUA 1K73H 1N8RH 3JCMM 1VQ4F 3LWOC 1YITF 1W40A 3E1YA 3WXMB 1H7MA 3OBYA 2QI2A 4BVQA 3G71F 2HVYD 3V7EA 2LBXA 1CN7A 2KG4A 1W3EX 1W41A 4EI7A 5HWEA 3J81M 1K8AH 3RA6A 2JNBA 3G6EF 1Q7YH 1W2BF 1M90H 2OTLF 3OBWA 4BVTA 2QEXF 1Q86H 2BO1A 2CZWA 1S72F 3NK7A 5HY4A 5HY2A 3GYQA 1QVGF 4LCKA 5EWRA 2QA4F 3VI6A 1W42A 5GAPK 1GO1A 4BY9D 1T0KB 3LWQC 2FGYA 2OHWA 1VQ8F 3NMUC 1PXWA 5EO3A 5A2QM 4BW0B 3CMEF 3CCMF 1YIJF 3D00A 3E20B 3N4YA 1GO0A 1VQLF 4X3LA 5HY0A 3LWRC 3MCAB 2KTVA 4X3MA 3RA5A 4XCQA 3CD6F 1VQNF 3VMFB 3I56F 1YJ9F 3CMAF 3CPWF 5GIPC 1VQ7F 2AIFA 3CCQF 3CCUF 3CCJF 2I6DA 3CCLF 1DT9A 5HY1A 3JAMM 3CG6A 1E7KA 5G4UC 4BVRA 1VQOF 1K9MH 1VQPF 4C4WC 1ZWZA 1Q82H 1QVFF 3CXCF 1X52A 3IR9A 3LWVC 1X7PA 2F9ZC 1VQKF 2WALA 5HXZA 3J80M 2LBWA 2VGMA 5G4VC 3N4ZA 3V3TA 2VGNA 5IT9M 1RA4A 1VQ9F 3O85A 4NUTA 2ALEA 1VQMF 1JJ2F 3CC4F 5GIOC 2GLZA 3NVKE 1X7OA 3CPQA 3CCRF 3PAFA 3CC2F 1Q81H 2OZBA 1M1KH 4NQ3A 3CC7F 3PLAC 3CCVF 1XBIA 1YJWF 1VQ5F 3HJWC 3I55F 3LWPC 1GZ0A 3LFOA 2OTJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN F;  3NVI B;  3ON1 A;  3G4S F;  1IPA A;  1NJI H;  5GAN K;  1KQS F;  4TZZ A;  3OW2 F;  1KC8 H;  3NK6 A;  1VQ6 F;  1YHQ F;  3J7A R;  3SIU A;  3V7Q A;  3FFM A;  3HAX D;  2KTU A;  1KD1 H;  1RLG A;  3CCE F;  5FLX M;  1SDS A;  3SIV A;  5GIN C;  2FC3 A;  5DCV A;  5FJ4 C;  1CK2 A;  1NMU B;  3CCS F;  3AGK A;  1YI2 F;  1K73 H;  1N8R H;  3JCM M;  1VQ4 F;  3LWO C;  1YIT F;  1W40 A;  3E1Y A;  3WXM B;  1H7M A;  3OBY A;  2QI2 A;  3G71 F;  2HVY D;  3V7E A;  2LBX A;  1CN7 A;  2KG4 A;  1W3E X;  1W41 A;  3J81 M;  1K8A H;  3RA6 A;  2JNB A;  3G6E F;  1Q7Y H;  1W2B F;  1M90 H;  2OTL F;  3OBW A;  2QEX F;  1Q86 H;  2BO1 A;  2CZW A;  1S72 F;  3NK7 A;  3GYQ A;  1QVG F;  4LCK A;  5EWR A;  2QA4 F;  3VI6 A;  1W42 A;  5GAP K;  1GO1 A;  4BY9 D;  1T0K B;  3LWQ C;  2OHW A;  1VQ8 F;  3NMU C;  1PXW A;  5EO3 A;  5A2Q M;  4BW0 B;  3CME F;  3CCM F;  1YIJ F;  3E20 B;  3N4Y A;  1GO0 A;  1VQL F;  4X3L A;  3LWR C;  3MCA B;  2KTV A;  4X3M A;  3RA5 A;  3CD6 F;  1VQN F;  3VMF B;  3I56 F;  1YJ9 F;  3CMA F;  3CPW F;  5GIP C;  1VQ7 F;  2AIF A;  3CCQ F;  3CCU F;  3CCJ F;  2I6D A;  3CCL F;  1DT9 A;  3JAM M;  3CG6 A;  1E7K A;  5G4U C;  1VQO F;  1K9M H;  1VQP F;  4C4W C;  1ZWZ A;  1Q82 H;  1QVF F;  3CXC F;  1X52 A;  3IR9 A;  3LWV C;  1X7P A;  1VQK F;  2WAL A;  3J80 M;  2LBW A;  2VGM A;  5G4V C;  3N4Z A;  2VGN A;  5IT9 M;  1RA4 A;  1VQ9 F;  3O85 A;  4NUT A;  2ALE A;  1VQM F;  1JJ2 F;  3CC4 F;  5GIO C;  3NVK E;  1X7O A;  3CPQ A;  3CCR F;  3PAF A;  3CC2 F;  1Q81 H;  2OZB A;  1M1K H;  3PLA C;  3CC7 F;  3CCV F;  1XBI A;  1YJW F;  1VQ5 F;  3HJW C;  3I55 F;  3LWP C;  1GZ0 A;  3LFO A;  2OTJ F; 
#chains in the Genus database with same CATH topology
 3IEQ A;  5KX5 B;  3VYS C;  2ZAU A;  5EZY A;  5CB4 B;  3ON1 A;  4ZHQ A;  5EZY B;  1VH8 A;  3N2G A;  3WPX A;  5GAN K;  3I7T A;  4YJ2 B;  3NK6 A;  5J2U A;  3T80 A;  1KNJ A;  5J2U B;  3V4D A;  3IKF A;  2ZOD A;  2N48 A;  3V7Q A;  3VCZ A;  4LNU A;  5JCO C;  3HAX D;  3U0O A;  4LNU B;  5DCV A;  2IQQ A;  4EI9 A;  5FJ4 C;  1CK2 A;  3KHN A;  3C9S A;  3L7Q A;  3MCQ A;  5LA6 A;  1VQ4 F;  4BT3 A;  3LWO C;  5LA6 B;  3G71 F;  3WGJ A;  2LBX A;  3CB2 A;  4ZI7 A;  3I3F A;  3WGN A;  2H8C A;  4TUY B;  1QU9 A;  4ZHW A;  4B62 A;  3G6E F;  3OBW A;  1Q86 H;  2BO1 A;  1GX1 A;  1YQN A;  2RHJ A;  3WJQ A;  5CA0 A;  3JAR A;  5EIB D;  1DBF A;  4IHJ A;  3VI6 A;  3ELC A;  3JAR B;  4IHJ B;  2OHW A;  5HP8 A;  5A2Q M;  4BW0 B;  4BT4 A;  3CCM F;  5LXT A;  3D00 A;  2BTQ B;  3N4Y A;  4DRX A;  1VQL F;  4B5C A;  4DRX B;  3MCA B;  5EIB C;  2HP0 A;  2V9Y A;  2HP0 B;  3VMF B;  3CMA F;  5GIP C;  5EAZ A;  3HKC B;  3S03 A;  4IIJ B;  3CCU F;  1W55 A;  3M4S A;  3WGM A;  5IJ0 A;  3JAM M;  4ERH A;  5AVM A;  4O4H A;  5IJ0 B;  3ERN A;  1FSZ A;  4O4H B;  2VAW A;  4B46 A;  1JY8 A;  1ZWZ A;  3F0G A;  3CXC F;  3IR9 A;  4X1Y A;  3VTI C;  1XHO A;  3JAK A;  3RYI B;  3ZP4 A;  2VGM A;  3JAK B;  3V3T A;  1IV1 A;  4EB6 A;  2Z1T A;  2RB9 A;  1RA4 A;  4HNA B;  1U43 A;  1U40 A;  1X7O A;  2HS0 A;  3CCR F;  4NQ3 A;  3PLA C;  3HJW C;  4O2A B;  3LWP C;  3ESJ A;  3C8L A;  3KJJ A;  3VYU C;  2LCA A;  2UYJ A;  3NVI B;  3EOR A;  5EYP A;  1NJI H;  3MQW A;  4BT6 A;  1YGY A;  2Z1E A;  5JQG B;  4C8I A;  1QD9 A;  5C8Y A;  4I55 A;  4G4W A;  1OFU A;  3GHZ A;  5C8Y B;  4I55 B;  1XV2 A;  2H6L A;  4EI8 A;  4O4L A;  4R40 B;  3FFM A;  3MDO A;  1J7H A;  2MQE A;  5JH7 A;  4WBN A;  1Z5V A;  3JAS A;  3SIV A;  5JH7 B;  2FC3 A;  4WBN B;  3JAS B;  3JAL A;  4DXD A;  1VHA A;  1NMU B;  3JAL B;  4O4I A;  3KIZ A;  5HXU A;  1W5A A;  2PMP A;  2L26 A;  1YIT F;  3WGL A;  5CB4 A;  3E1Y A;  2QI2 A;  4BVQ A;  4U39 A;  2KG4 A;  1W41 A;  2Z1U A;  5HWE A;  3J81 M;  4YJ2 A;  2OTL F;  3KE1 A;  3RYH B;  1JFF B;  3NK7 A;  2DYY A;  5HY2 A;  1UFY A;  5EWR A;  1W42 A;  1T0K B;  2YXZ A;  5EO3 A;  3S02 A;  4TUY A;  4C82 A;  2Q1Y A;  3F6M A;  2IAF A;  3RE3 A;  4X3L A;  4C8E A;  3C9U A;  4NWO B;  4O2B B;  4ZHY B;  4G4Z A;  2ZVY A;  1RLU A;  5BMV A;  5J2T A;  1SZQ A;  1VQV A;  3FD5 A;  5BMV B;  1H48 A;  5J2T B;  3CCQ F;  3P10 A;  3CCL F;  1W59 A;  2H8E A;  2CSL A;  2HQS C;  3D54 A;  1TVK B;  2HRU A;  1K9M H;  4B45 A;  4E6E A;  1Q82 H;  3F0D A;  1X52 A;  4C8G A;  2F9Z C;  1VQK F;  1R1M A;  4ZHV A;  3VOA A;  4X1K B;  3JAT A;  3FD6 A;  2LBT A;  3JAT B;  5IT9 M;  3IKE A;  3K2X A;  4I4T A;  2RHL A;  3WGK A;  3K0T A;  4F6R B;  2UYN B;  3K12 A;  4I4T B;  5MN6 A;  2ALE A;  4BT2 A;  4TV8 B;  5HP7 A;  2GLZ A;  2NMU A;  3NVK E;  3HKC A;  4IIJ A;  1Q81 H;  3CC2 F;  4X20 A;  1M1K H;  2OZB A;  4X20 B;  1XBI A;  4RQO A;  3QTY A;  3TD5 A;  3ZP7 A;  2UYP A;  3I55 F;  5LOV B;  3LFO A;  1PF5 A;  2HRY A;  2R6R 1;  3G4S F;  3S06 A;  5CA1 B;  5IJ9 B;  3RYI A;  2PHN A;  1T0A A;  3E22 A;  2GVI A;  1KQS F;  4TZZ A;  3OW2 F;  1KC8 H;  3E22 B;  5IYZ B;  1IV4 A;  4M8I A;  3GTZ A;  4HNA A;  4I50 B;  2VAM A;  3WJR A;  3SIU A;  1U3P A;  2KTU A;  1RLG A;  3CCE F;  4BVS A;  1SDS A;  5LP6 C;  4YJ3 A;  3JAW A;  2YYE A;  3F0F A;  4YJ3 B;  3VYT C;  3JAW B;  3CCS F;  3AGK A;  4O2A A;  1N8R H;  1FFX B;  1W58 1;  4G4V A;  2P6Y A;  3S0H A;  4TV9 B;  2VXY A;  1H7M A;  2HVY D;  3V7E A;  4EI7 A;  1W3E X;  3B6N A;  5JQG A;  2CHS A;  3RA6 A;  4KWE A;  3Q8H A;  1W2B F;  5MN4 A;  1IV3 A;  1H47 A;  2QEX F;  3VO8 A;  1OAP A;  3P0Z A;  1S72 F;  5LP6 B;  5HY4 A;  2CWJ A;  2QA4 F;  2Z1F A;  5GAP K;  3LWQ C;  3MBM A;  1W57 A;  1VQ8 F;  3NMU C;  2GZL A;  5EB1 B;  3RYF B;  3CME F;  1YIJ F;  3UT5 B;  3E20 B;  2CVL A;  3LYB A;  1KNK A;  4G4Y A;  1GO0 A;  2ZOV A;  3DC2 A;  4FFB B;  3LWR C;  2VAP A;  3RYH A;  2ZF8 A;  1JFF A;  1VQN F;  2G9I A;  3I56 F;  4U3J B;  3WPW A;  1VQ7 F;  3CCJ F;  2I6D A;  1DT9 A;  2KGW A;  5HY1 A;  4PWT A;  3CG6 A;  1E7K A;  2IG8 A;  1TUB B;  3ZOP A;  5G4U C;  4BVR A;  2I6R A;  1U3L A;  3TD3 A;  1VQP F;  2R75 1;  1Q8R A;  1JN1 A;  4ZOL A;  3LWV C;  1JD1 A;  1X7P A;  4ZHQ B;  1FNJ A;  2WAL A;  1W5B A;  3HKD A;  4ZOL B;  5HXZ A;  3HKD B;  3N2G B;  5G4V C;  3M1X A;  1VK3 A;  3ZO8 A;  1IV2 A;  1VQ9 F;  4O2B A;  4NUT A;  1VQM F;  5GON A;  3CC4 F;  5JCO A;  4BT5 A;  5ITZ A;  5MN5 A;  5GON B;  5GIO C;  2RHO A;  5ITZ B;  3D01 A;  3PAF A;  3HKB A;  2HS4 A;  3HKB B;  3CCV F;  1YJW F;  1TVK A;  1COM A;  1XRG A;  3P4E A;  2OTJ F;  5KMG A;  1YJN F;  2B33 A;  1ODE A;  1ONI A;  3F0E A;  5KMG B;  1IPA A;  3K14 A;  4ZI7 B;  4X1K A;  1W5E A;  3C9T A;  1VQ6 F;  1Z5W A;  4F6R A;  1YHQ F;  2UYN A;  1W5F A;  4TV8 A;  3J7A R;  5JVD A;  4BT7 A;  3IEW A;  5JVD B;  1KD1 H;  4RHA A;  5FLX M;  5CA0 B;  3M84 A;  3DDN A;  2OTM A;  3BYQ A;  5GIN C;  2HP3 A;  5B8F A;  2Q1X A;  2RHH A;  1UI9 A;  4G4X A;  1YI2 F;  3VOB A;  5LOV A;  1K73 H;  3JCM M;  3WJP A;  4C81 A;  1W40 A;  1NQ3 A;  3WXM B;  1RQ7 A;  3OBY A;  5CA1 A;  5IJ9 A;  5LXT B;  4G88 A;  1K8A H;  5IYZ A;  2JNB A;  3TD4 A;  1Q7Y H;  1M90 H;  2Z01 A;  2ZVZ A;  4I50 A;  2AMT A;  4BVT A;  3QUW A;  5LYJ A;  2CZW A;  3LME A;  1SA0 A;  5LYJ B;  1SA0 B;  3GYQ A;  2BTO A;  1QVG F;  4LCK A;  3CYP B;  2CHT A;  4BY9 D;  1GO1 A;  2QTP A;  3JVH A;  2FGY A;  3KJK A;  4O4J A;  1FFX A;  4O4J B;  4TV9 A;  4X1I A;  2DT4 A;  1PXW A;  4X1Y B;  2CW4 A;  4X1I B;  1X25 A;  3FBA A;  4EB6 B;  5HY0 A;  3CYQ A;  5FNV A;  2KTV A;  4X3M A;  3RA5 A;  2W8B C;  2UZH A;  4XCQ A;  5FNV B;  3CD6 F;  3IMP A;  1YJ9 F;  3CPW F;  5LP6 A;  3S0Y A;  2AIF A;  3HTN A;  3OON A;  5EB0 A;  3HKE A;  3HWU A;  3C9R A;  3LDT A;  1FNK A;  3HKE B;  2K1S A;  4ZK7 A;  1VQO F;  4C4W C;  1QVF F;  3RYF A;  2AIZ P;  5EYP B;  3UT5 A;  3J80 M;  2LBW A;  3N4Z A;  2BTU A;  3QHD A;  2VGN A;  4FFB A;  3RYC A;  3N2K A;  3RYC B;  2HX0 A;  3N2K B;  3O85 A;  3VIU A;  1JJ2 F;  4O4L B;  3R0P A;  1QAH A;  4U3J A;  3CPQ A;  2UYK A;  3FPI A;  1RQ2 A;  2EWC A;  3CC7 F;  1VQ5 F;  1TUB A;  1CLI A;  4O4I B;  5KX5 A;  1GZ0 A;  1CN7 A;  3S0W A;  2HS3 A; 
#chains in the Genus database with same CATH homology
 1YJN F;  3NVI B;  3ON1 A;  3G4S F;  1IPA A;  1NJI H;  5GAN K;  1KQS F;  4TZZ A;  3OW2 F;  1KC8 H;  3NK6 A;  1VQ6 F;  1YHQ F;  4EI8 A;  3J7A R;  3SIU A;  3V7Q A;  3FFM A;  3HAX D;  2KTU A;  1KD1 H;  1RLG A;  3CCE F;  4BVS A;  5FLX M;  1SDS A;  5GIN C;  2FC3 A;  4EI9 A;  3SIV A;  5DCV A;  5FJ4 C;  1CK2 A;  1NMU B;  3CCS F;  3AGK A;  1YI2 F;  5HXU A;  1K73 H;  1N8R H;  3JCM M;  1VQ4 F;  3LWO C;  1YIT F;  1W40 A;  3E1Y A;  3WXM B;  1H7M A;  3OBY A;  2QI2 A;  4BVQ A;  3G71 F;  2HVY D;  3V7E A;  2LBX A;  1CN7 A;  2KG4 A;  1W3E X;  1W41 A;  4EI7 A;  5HWE A;  3J81 M;  1K8A H;  3RA6 A;  2JNB A;  3G6E F;  1Q7Y H;  1W2B F;  1M90 H;  2OTL F;  3OBW A;  4BVT A;  2QEX F;  1Q86 H;  2BO1 A;  2CZW A;  1S72 F;  3NK7 A;  5HY4 A;  5HY2 A;  3GYQ A;  1QVG F;  4LCK A;  5EWR A;  2QA4 F;  3VI6 A;  1W42 A;  5GAP K;  1GO1 A;  4BY9 D;  1T0K B;  3LWQ C;  2FGY A;  2OHW A;  1VQ8 F;  3NMU C;  1PXW A;  5EO3 A;  5A2Q M;  4BW0 B;  3CME F;  3CCM F;  1YIJ F;  3D00 A;  3E20 B;  3N4Y A;  1GO0 A;  1VQL F;  4X3L A;  5HY0 A;  3LWR C;  3MCA B;  2KTV A;  4X3M A;  3RA5 A;  4XCQ A;  3CD6 F;  1VQN F;  3VMF B;  3I56 F;  1YJ9 F;  3CMA F;  3CPW F;  5GIP C;  1VQ7 F;  2AIF A;  3CCQ F;  3CCU F;  3CCJ F;  2I6D A;  3CCL F;  1DT9 A;  5HY1 A;  3JAM M;  3CG6 A;  1E7K A;  5G4U C;  4BVR A;  1VQO F;  1K9M H;  1VQP F;  4C4W C;  1ZWZ A;  1Q82 H;  1QVF F;  3CXC F;  1X52 A;  3IR9 A;  3LWV C;  1X7P A;  2F9Z C;  1VQK F;  2WAL A;  5HXZ A;  3J80 M;  2LBW A;  2VGM A;  5G4V C;  3N4Z A;  3V3T A;  2VGN A;  5IT9 M;  1RA4 A;  1VQ9 F;  3O85 A;  4NUT A;  2ALE A;  1VQM F;  1JJ2 F;  3CC4 F;  5GIO C;  2GLZ A;  3NVK E;  1X7O A;  3CPQ A;  3CCR F;  3PAF A;  3CC2 F;  1Q81 H;  2OZB A;  1M1K H;  4NQ3 A;  3CC7 F;  3PLA C;  3CCV F;  1XBI A;  1YJW F;  1VQ5 F;  3HJW C;  3I55 F;  3LWP C;  1GZ0 A;  3LFO A;  2OTJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...