3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords Probable tRNA pseudouridine synthase B
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
3J81M 2VGMA 3RA6A 1W2BF 1Q82H 3RA5A 3VMFB 1X7OA 1K8AH 2OTLF 1YITF 4X3MA 1VQKF 3CCRF 1T0KB 3VI6A 2AIFA 2WALA 5A2QM 1NMUB 5FLXM 5GINC 1VQ7F 3CXCF 4X3LA 1YJWF 1KD1H 1VQ4F 3LWOC 3OW2F 3IR9A 1K9MH 1M90H 3CCUF 3G71F 2KTVA 3ON1A 3CCQF 3NMUC 1Q86H 4C4WC 1KC8H 1SDSA 1XBIA 3MCAB 1QVGF 2QI2A 3I56F 4BW0B 3G4SF 4BY9D 3LFOA 1X52A 1YIJF 1VQNF 1S72F 1GZ0A 4NUTA 2QEXF 1YJNF 3CCJF 1VQMF 3CPWF 1RLGA 2ALEA 1W42A 2KTUA 3N4ZA 3J80M 5EWRA 1VQPF 2OZBA 1CN7A 3CPQA 5GIPC 1KQSF 3LWRC 3CC4F 5G4VC 1W40A 5G4UC 3J7AR 3CCSF 1VQ8F 1YI2F 1VQ6F 1VQLF 5FJ4C 1K73H 3I55F 3PAFA 3CMAF 1ZWZA 2VGNA 1E7KA 4LCKA 5IT9M 1M1KH 2OHWA 1GO0A 1VQOF 3CCVF 3HAXD 5GAPK 5DCVA 3OBWA 2HVYD 3NK6A 3GYQA 5EO3A 3N4YA 1Q7YH 2CZWA 3V7QA 3CD6F 2OTJF 2I6DA 3CG6A 1VQ9F 1H7MA 2QA4F 3PLAC 2KG4A 2BO1A 1W3EX 3LWPC 1Q81H 1W41A 3SIUA 3CC7F 3HJWC 1VQ5F 3NVKE 3CCLF 4TZZA 1N8RH 1X7PA 3JCMM 3E20B 3O85A 3LWVC 1CK2A 3CCEF 3V7EA 3CMEF 3WXMB 3G6EF 3LWQC 3NK7A 3JAMM 1QVFF 2LBXA 1DT9A 3NVIB 3AGKA 3OBYA 1JJ2F 1PXWA 1NJIH 3FFMA 3E1YA 1YHQF 2FC3A 1GO1A 1RA4A 5GANK 1IPAA 5GIOC 1YJ9F 3SIVA 3CC2F 2LBWA 3CCMF 2JNBA
chains in the Genus database with same CATH superfamily
3WPWA 2VGMA 2HRYA 3LDTA 3RA6A 2CVLA 3QHDA 2MQEA 5CB4A 1X7OA 4RQOA 3KJKA 1QD9A 3S0HA 3D00A 4ZK7A 4RHAA 2LCAA 1VH8A 3KE1A 1U40A 1NMUB 2EWCA 1VQ7F 2F9ZC 3HKBB 4X3LA 4I4TB 1VQ4F 4C82A 1ODEA 1UFYA 5LP6C 4NWOB 1M90H 4BVSA 3KHNA 5KMGA 3RYCB 4YJ2A 3T80A 1IV2A 3KIZA 3LYBA 3GHZA 5CA0B 4BY9D 3LFOA 1X52A 4F6RA 3K2XA 3DDNA 2GZLA 5ITZA 1S72F 1W5BA 5IYZB 1TVKB 4DXDA 4NUTA 3CCJF 1VQMF 4I4TA 1RLGA 3S03A 3N4ZA 3WPXA 3JASA 1VQPF 2BTOA 5LP6B 1CN7A 3CPQA 3HKCB 3LWRC 5C8YB 3EORA 3V4DA 5CB4B 4NQ3A 4BVRA 3VOAA 5CA1B 4B62A 1U43A 3I55F 5JCOA 2FGYA 3CMAF 1KNKA 3CYPB 2OHWA 4BVQA 3RYIB 1M1KH 4BT5A 1VQOF 3VYTC 1W59A 5KMGB 3RYCA 2KGWA 3GYQA 5HY0A 5LA6B 1Q7YH 2UYKA 3L7QA 1H7MA 1FFXB 3MBMA 3CYQA 5AVMA 4R40B 5C8YA 3VOBA 3K0TA 1W3EX 1Q81H 3M4SA 3SIUA 5MN4A 3CC7F 3HJWC 4O4JB 2RB9A 1IV4A 2ZOVA 3E22A 4KWEA 4HNAA 1N8RH 1X7PA 3JCMM 3E20B 5MN6A 1FNKA 3LWVC 4IIJB 4DRXA 3CCEF 3HKEA 3V7EA 5HY1A 2CHSA 5LYJA 3DC2A 5IJ9B 3NVIB 4E6EA 1PXWA 1W57A 3FFMA 1YHQF 3C9SA 1R1MA 1RA4A 2PMPA 1YJ9F 3WJRA 3SIVA 1YGYA 3QUWA 5LXTA 3CCMF 4ERHA 3J81M 4B45A 5JQGB 3RA5A 1K8AH 4X3MA 1FFXA 3CCRF 3M1XA 4O4LB 4ZI7A 3VI6A 3OONA 2HP0A 4X1KB 5IYZA 3WGLA 2AIFA 5B8FA 4LNUB 4O2AA 5FLXM 4FFBB 1YJWF 1KD1H 3KJJA 4ZHYB 2R6R1 3ON1A 3CCQF 3NMUC 4XCQA 2H8EA 3MCAB 2AIZP 2QI2A 2IAFA 5JVDA 4BT4A 4YJ3B 4FFBA 3JATA 2ZAUA 3F0FA 5IJ9A 1VQNF 4C81A 1W5EA 4O2BB 3QTYA 3RYHA 3CPWF 2CHTA 5LOVA 2Z1TA 2ALEA 1TVKA 5EZYB 1X25A 4I55A 2UYNA 5BMVB 2Z01A 4U39A 3S02A 2ZF8A 3M84A 4YJ3A 2OZBA 5GIPC 3N2KA 5G4VC 5FNVB 3J7AR 3K14A 1VQ8F 1K73H 3VO8A 2L26A 3WGKA 5KX5A 3PAFA 3FD5A 1T0AA 2QTPA 3HKBA 4EB6B 3HAXD 3HKEB 2HVYD 3NK6A 2UYPA 2VXYA 2K1SA 3N2GB 3N4YA 3V7QA 3D54A 3WGJA 4ZHVA 4I50B 2ZVYA 2BTQB 4TUYB 4BT2A 1W41A 3JARB 5J2TA 2B33A 3ESJA 3CCLF 4TZZA 1FNJA 1RQ2A 4C8GA 3WGNA 3RE3A 5HXZA 3JAKB 3IMPA 2HRUA 2YXZA 4ZOLB 3Q8HA 3ZO8A 5J2UA 4U3JA 3WXMB 4PWTA 3G6EF 4LNUA 3JASB 1U3LA 3LMEA 5HP7A 2RHHA 4X20B 3JAMM 1QVFF 2LBXA 3F0DA 3AGKA 5EB0A 2HS4A 2HQSC 1JJ2F 4O4LA 4X1IA 4BT6A 1COMA 2FC3A 5GANK 2LBWA 3I3FA 2JNBA 5EIBC 5J2UB 3P10A 5HY4A 1VHAA 1Q82H 5LXTB 4EI9A 3JAKA 3HKDB 4TV9B 1XV2A 4X1IB 5GONB 1T0KB 1W5AA 3ERNA 3S0YA 3IEQA 2G9IA 2H6LA 4X20A 3U0OA 2WALA 3F0EA 5HP8A 2GVIA 4IIJA 3LWOC 3OW2F 4O4IA 3S06A 1XHOA 4O2BA 4BVTA 3ELCA 4YJ2B 2KTVA 1VK3A 1Q86H 2VAPA 2PHNA 1JFFA 4G4XA 4C4WC 3TD4A 3JALB 3D01A 1SDSA 3HTNA 4TV8A 1QVGF 1CLIA 3G4SF 2CW4A 3C8LA 1YIJF 3FD6A 2CWJA 1GZ0A 2LBTA 3WGMA 2QEXF 5MN5A 2VAWA 1GX1A 2DYYA 2Z1UA 2ZVZA 2KTUA 3J80M 5EB1B 4IHJB 1NQ3A 1IV3A 5GONA 1KQSF 3CB2A 2HX0A 3UT5B 3WJPA 3ZP4A 2VAMA 1VQ6F 3VYSC 2CSLA 4TUYA 1ZWZA 2VGNA 1E7KA 4LCKA 4O4HA 5IT9M 1U3PA 5LYJB 1JD1A 3CCVF 5GAPK 5DCVA 3OBWA 5EO3A 2CZWA 2OTMA 3JAWA 5IJ0A 1KNJA 2KG4A 2BO1A 2Z1FA 3LWPC 4G4VA 2ZODA 4I50A 2Q1YA 4HNAB 3NVKE 1JN1A 2UYNB 2DT4A 4B5CA 4TV9A 4O4JA 2W8BC 5J2TB 5HY2A 5LOVB 1SA0A 2HP3A 3HKCA 1CK2A 2N48A 4IHJA 4BT7A 4ZHQB 3CMEF 1RQ7A 4O2AB 3RYIA 3ZOPA 5BMVA 1QAHA 2YYEA 4I55B 3LWQC 3NK7A 1PF5A 1ONIA 1OAPA 4F6RB 4WBNB 4C8IA 4U3JB 4C8EA 3BYQA 2RHJA 5JH7B 1NJIH 5HWEA 3C9RA 1IPAA 3P0ZA 2UYJA 3CC2F 5JQGA 5KX5B 4ZHQA 5LP6A 4X1YB 5EAZA 1XRGA 1W2BF 3MQWA 3VMFB 2P6YA 4G4YA 2OTLF 3K12A 1YITF 1VQKF 5IJ0B 3RYHB 3FPIA 3TD3A 3JARA 4WBNA 1FSZA 3VTIC 5A2QM 4ZHWA 5GINC 2H8CA 3V3TA 1OFUA 3CXCF 1W581 3HWUA 4ZOLA 3IR9A 3ZP7A 4G4ZA 1TUBA 1K9MH 2V9YA 3CCUF 3G71F 5LA6A 5JCOC 4EI7A 1KC8H 3P4EA 1SZQA 5JVDB 3MDOA 4M8IA 1XBIA 2RHOA 5EYPB 1SA0B 2NMUA 3I56F 4BW0B 1JY8A 1JFFB 2GLZA 1H48A 3RYFB 1UI9A 3N2GA 5HXUA 1YJNF 4DRXB 5JH7A 3C9UA 1W42A 2AMTA 4BT3A 4EI8A 5EWRA 3JAWB 3IKFA 4X1KA 5EZYA 5CA0A 1W55A 3JVHA 1Z5VA 1Z5WA 3CC4F 3RYFA 3HKDA 1W40A 5ITZB 5G4UC 3S0WA 3N2KB 4G88A 3CCSF 1YI2F 1VQLF 5FJ4C 2R751 2HS3A 2I6RA 1J7HA 3FBAA 1GO0A 3UT5A 3JALA 4O4HB 2Q1XA 3F6MA 3VYUC 3CD6F 1TUBB 2OTJF 4ZI7B 2I6DA 3CG6A 1VQ9F 5CA1A 2QA4F 3IKEA 3E22B 3PLAC 1RLUA 3WJQA 4TV8B 5EYPA 1YQNA 1VQVA 2HP0B 3B6NA 1VQ5F 5FNVA 5EIBD 3MCQA 3R0PA 3VCZA 4G4WA 3O85A 3GTZA 2IG8A 2HS0A 4X1YA 3TD5A 2UZHA 2Z1EA 3I7TA 2RHLA 1QU9A 3JATB 1DT9A 3OBYA 1H47A 1W5FA 4O4IB 3C9TA 1DBFA 3E1YA 3F0GA 4EB6A 1GO1A 1Q8RA 2IQQA 2BTUA 3IEWA 4B46A 5GIOC 1IV1A 3VIUA
chains in the Genus database with same CATH topology
3J81M 2VGMA 5HY4A 3RA6A 1W2BF 1Q82H 3RA5A 4EI9A 3VMFB 1X7OA 1K8AH 2OTLF 1YITF 4X3MA 1VQKF 3CCRF 1T0KB 3D00A 3VI6A 2AIFA 2WALA 5A2QM 1NMUB 5FLXM 5GINC 1VQ7F 2F9ZC 3V3TA 3CXCF 4X3LA 1YJWF 1KD1H 1VQ4F 3LWOC 3OW2F 3IR9A 1K9MH 4BVTA 1M90H 4BVSA 3CCUF 3G71F 2KTVA 3ON1A 3CCQF 3NMUC 1Q86H 4XCQA 4C4WC 4EI7A 1KC8H 1SDSA 1XBIA 3MCAB 1QVGF 2QI2A 3I56F 4BW0B 3G4SF 4BY9D 3LFOA 1X52A 2GLZA 1YIJF 1VQNF 1S72F 1GZ0A 4NUTA 2QEXF 5HXUA 3CCJF 1VQMF 1YJNF 3CPWF 1RLGA 2ALEA 1W42A 2KTUA 4EI8A 3N4ZA 3J80M 5EWRA 1VQPF 2OZBA 1CN7A 3CPQA 5GIPC 1KQSF 3LWRC 3CC4F 5G4VC 1W40A 4NQ3A 4BVRA 3J7AR 5G4UC 3CCSF 1VQ8F 1YI2F 1VQ6F 1VQLF 5FJ4C 1K73H 3I55F 2FGYA 3PAFA 3CMAF 1ZWZA 2VGNA 1E7KA 4LCKA 5IT9M 1M1KH 2OHWA 4BVQA 1GO0A 1VQOF 3CCVF 3HAXD 5GAPK 5DCVA 3OBWA 2HVYD 3NK6A 3GYQA 5EO3A 5HY0A 3N4YA 1Q7YH 2CZWA 3V7QA 3CD6F 2OTJF 2I6DA 3CG6A 1VQ9F 1H7MA 2QA4F 3PLAC 2KG4A 2BO1A 1W3EX 3LWPC 1Q81H 1W41A 3SIUA 3CC7F 3HJWC 1VQ5F 3NVKE 3CCLF 4TZZA 5HXZA 1X7PA 3JCMM 3E20B 3O85A 5HY2A 1N8RH 3LWVC 1CK2A 3CCEF 3V7EA 3CMEF 3WXMB 5HY1A 3G6EF 3LWQC 3NK7A 3JAMM 1QVFF 2LBXA 1DT9A 3NVIB 3AGKA 3OBYA 1JJ2F 1PXWA 1NJIH 3FFMA 3E1YA 5HWEA 1YHQF 2FC3A 1GO1A 1RA4A 5GANK 1IPAA 5GIOC 1YJ9F 3SIVA 3CC2F 2LBWA 3CCMF 2JNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 M;  2VGM A;  3RA6 A;  1W2B F;  1Q82 H;  3RA5 A;  3VMF B;  1X7O A;  1K8A H;  2OTL F;  1YIT F;  4X3M A;  1VQK F;  3CCR F;  1T0K B;  3VI6 A;  2AIF A;  2WAL A;  5A2Q M;  1NMU B;  5FLX M;  5GIN C;  1VQ7 F;  3CXC F;  4X3L A;  1YJW F;  1KD1 H;  1VQ4 F;  3LWO C;  3OW2 F;  3IR9 A;  1K9M H;  1M90 H;  3CCU F;  3G71 F;  2KTV A;  3ON1 A;  3CCQ F;  3NMU C;  1Q86 H;  4C4W C;  1KC8 H;  1SDS A;  1XBI A;  3MCA B;  1QVG F;  2QI2 A;  3I56 F;  4BW0 B;  3G4S F;  4BY9 D;  3LFO A;  1X52 A;  1YIJ F;  1VQN F;  1S72 F;  1GZ0 A;  4NUT A;  2QEX F;  1YJN F;  3CCJ F;  1VQM F;  3CPW F;  1RLG A;  2ALE A;  1W42 A;  2KTU A;  3N4Z A;  3J80 M;  5EWR A;  1VQP F;  2OZB A;  1CN7 A;  3CPQ A;  5GIP C;  1KQS F;  3LWR C;  3CC4 F;  5G4V C;  1W40 A;  5G4U C;  3J7A R;  3CCS F;  1VQ8 F;  1YI2 F;  1VQ6 F;  1VQL F;  5FJ4 C;  1K73 H;  3I55 F;  3PAF A;  3CMA F;  1ZWZ A;  2VGN A;  1E7K A;  4LCK A;  5IT9 M;  1M1K H;  2OHW A;  1GO0 A;  1VQO F;  3CCV F;  3HAX D;  5GAP K;  5DCV A;  3OBW A;  2HVY D;  3NK6 A;  3GYQ A;  5EO3 A;  3N4Y A;  1Q7Y H;  2CZW A;  3V7Q A;  3CD6 F;  2OTJ F;  2I6D A;  3CG6 A;  1VQ9 F;  1H7M A;  2QA4 F;  3PLA C;  2KG4 A;  2BO1 A;  1W3E X;  3LWP C;  1Q81 H;  1W41 A;  3SIU A;  3CC7 F;  3HJW C;  1VQ5 F;  3NVK E;  3CCL F;  4TZZ A;  1N8R H;  1X7P A;  3JCM M;  3E20 B;  3O85 A;  3LWV C;  1CK2 A;  3CCE F;  3V7E A;  3CME F;  3WXM B;  3G6E F;  3LWQ C;  3NK7 A;  3JAM M;  1QVF F;  2LBX A;  1DT9 A;  3NVI B;  3AGK A;  3OBY A;  1JJ2 F;  1PXW A;  1NJI H;  3FFM A;  3E1Y A;  1YHQ F;  2FC3 A;  1GO1 A;  1RA4 A;  5GAN K;  1IPA A;  5GIO C;  1YJ9 F;  3SIV A;  3CC2 F;  2LBW A;  3CCM F;  2JNB A; 
#chains in the Genus database with same CATH topology
 3WPW A;  2VGM A;  2HRY A;  3LDT A;  3RA6 A;  2CVL A;  3QHD A;  2MQE A;  5CB4 A;  1X7O A;  4RQO A;  3KJK A;  1QD9 A;  3S0H A;  3D00 A;  4ZK7 A;  4RHA A;  2LCA A;  1VH8 A;  3KE1 A;  1U40 A;  1NMU B;  2EWC A;  1VQ7 F;  2F9Z C;  3HKB B;  4X3L A;  4I4T B;  1VQ4 F;  4C82 A;  1ODE A;  1UFY A;  5LP6 C;  4NWO B;  1M90 H;  4BVS A;  3KHN A;  5KMG A;  3RYC B;  4YJ2 A;  3T80 A;  1IV2 A;  3KIZ A;  3LYB A;  3GHZ A;  5CA0 B;  4BY9 D;  3LFO A;  1X52 A;  4F6R A;  3K2X A;  3DDN A;  2GZL A;  5ITZ A;  1S72 F;  1W5B A;  5IYZ B;  1TVK B;  4DXD A;  4NUT A;  3CCJ F;  1VQM F;  4I4T A;  1RLG A;  3S03 A;  3N4Z A;  3WPX A;  3JAS A;  1VQP F;  2BTO A;  5LP6 B;  1CN7 A;  3CPQ A;  3HKC B;  3LWR C;  5C8Y B;  3EOR A;  3V4D A;  5CB4 B;  4NQ3 A;  4BVR A;  3VOA A;  5CA1 B;  4B62 A;  1U43 A;  3I55 F;  5JCO A;  2FGY A;  3CMA F;  1KNK A;  3CYP B;  2OHW A;  4BVQ A;  3RYI B;  1M1K H;  4BT5 A;  1VQO F;  3VYT C;  1W59 A;  5KMG B;  3RYC A;  2KGW A;  3GYQ A;  5HY0 A;  5LA6 B;  1Q7Y H;  2UYK A;  3L7Q A;  1H7M A;  1FFX B;  3MBM A;  3CYQ A;  5AVM A;  4R40 B;  5C8Y A;  3VOB A;  3K0T A;  1W3E X;  1Q81 H;  3M4S A;  3SIU A;  5MN4 A;  3CC7 F;  3HJW C;  4O4J B;  2RB9 A;  1IV4 A;  2ZOV A;  3E22 A;  4KWE A;  4HNA A;  1N8R H;  1X7P A;  3JCM M;  3E20 B;  5MN6 A;  1FNK A;  3LWV C;  4IIJ B;  4DRX A;  3CCE F;  3HKE A;  3V7E A;  5HY1 A;  2CHS A;  5LYJ A;  3DC2 A;  5IJ9 B;  3NVI B;  4E6E A;  1PXW A;  1W57 A;  3FFM A;  1YHQ F;  3C9S A;  1R1M A;  1RA4 A;  2PMP A;  1YJ9 F;  3WJR A;  3SIV A;  1YGY A;  3QUW A;  5LXT A;  3CCM F;  4ERH A;  3J81 M;  4B45 A;  5JQG B;  3RA5 A;  1K8A H;  4X3M A;  1FFX A;  3CCR F;  3M1X A;  4O4L B;  4ZI7 A;  3VI6 A;  3OON A;  2HP0 A;  4X1K B;  5IYZ A;  3WGL A;  2AIF A;  5B8F A;  4LNU B;  4O2A A;  5FLX M;  4FFB B;  1YJW F;  1KD1 H;  3KJJ A;  4ZHY B;  2R6R 1;  3ON1 A;  3CCQ F;  3NMU C;  4XCQ A;  2H8E A;  3MCA B;  2AIZ P;  2QI2 A;  2IAF A;  5JVD A;  4BT4 A;  4YJ3 B;  4FFB A;  3JAT A;  2ZAU A;  3F0F A;  5IJ9 A;  1VQN F;  4C81 A;  1W5E A;  4O2B B;  3QTY A;  3RYH A;  3CPW F;  2CHT A;  5LOV A;  2Z1T A;  2ALE A;  1TVK A;  5EZY B;  1X25 A;  4I55 A;  2UYN A;  5BMV B;  2Z01 A;  4U39 A;  3S02 A;  2ZF8 A;  3M84 A;  4YJ3 A;  2OZB A;  5GIP C;  3N2K A;  5G4V C;  5FNV B;  3J7A R;  3K14 A;  1VQ8 F;  1K73 H;  3VO8 A;  2L26 A;  3WGK A;  5KX5 A;  3PAF A;  3FD5 A;  1T0A A;  2QTP A;  3HKB A;  4EB6 B;  3HAX D;  3HKE B;  2HVY D;  3NK6 A;  2UYP A;  2VXY A;  2K1S A;  3N2G B;  3N4Y A;  3V7Q A;  3D54 A;  3WGJ A;  4ZHV A;  4I50 B;  2ZVY A;  2BTQ B;  4TUY B;  4BT2 A;  1W41 A;  3JAR B;  5J2T A;  2B33 A;  3ESJ A;  3CCL F;  4TZZ A;  1FNJ A;  1RQ2 A;  4C8G A;  3WGN A;  3RE3 A;  5HXZ A;  3JAK B;  3IMP A;  2HRU A;  2YXZ A;  4ZOL B;  3Q8H A;  3ZO8 A;  5J2U A;  4U3J A;  3WXM B;  4PWT A;  3G6E F;  4LNU A;  3JAS B;  1U3L A;  3LME A;  5HP7 A;  2RHH A;  4X20 B;  3JAM M;  1QVF F;  2LBX A;  3F0D A;  3AGK A;  5EB0 A;  2HS4 A;  2HQS C;  1JJ2 F;  4O4L A;  4X1I A;  4BT6 A;  1COM A;  2FC3 A;  5GAN K;  2LBW A;  3I3F A;  2JNB A;  5EIB C;  5J2U B;  3P10 A;  5HY4 A;  1VHA A;  1Q82 H;  5LXT B;  4EI9 A;  3JAK A;  3HKD B;  4TV9 B;  1XV2 A;  4X1I B;  5GON B;  1T0K B;  1W5A A;  3ERN A;  3S0Y A;  3IEQ A;  2G9I A;  2H6L A;  4X20 A;  3U0O A;  2WAL A;  3F0E A;  5HP8 A;  2GVI A;  4IIJ A;  3LWO C;  3OW2 F;  4O4I A;  3S06 A;  1XHO A;  4O2B A;  4BVT A;  3ELC A;  4YJ2 B;  2KTV A;  1VK3 A;  1Q86 H;  2VAP A;  2PHN A;  1JFF A;  4G4X A;  4C4W C;  3TD4 A;  3JAL B;  3D01 A;  1SDS A;  3HTN A;  4TV8 A;  1QVG F;  1CLI A;  3G4S F;  2CW4 A;  3C8L A;  1YIJ F;  3FD6 A;  2CWJ A;  1GZ0 A;  2LBT A;  3WGM A;  2QEX F;  5MN5 A;  2VAW A;  1GX1 A;  2DYY A;  2Z1U A;  2ZVZ A;  2KTU A;  3J80 M;  5EB1 B;  4IHJ B;  1NQ3 A;  1IV3 A;  5GON A;  1KQS F;  3CB2 A;  2HX0 A;  3UT5 B;  3WJP A;  3ZP4 A;  2VAM A;  1VQ6 F;  3VYS C;  2CSL A;  4TUY A;  1ZWZ A;  2VGN A;  1E7K A;  4LCK A;  4O4H A;  5IT9 M;  1U3P A;  5LYJ B;  1JD1 A;  3CCV F;  5GAP K;  5DCV A;  3OBW A;  5EO3 A;  2CZW A;  2OTM A;  3JAW A;  5IJ0 A;  1KNJ A;  2KG4 A;  2BO1 A;  2Z1F A;  3LWP C;  4G4V A;  2ZOD A;  4I50 A;  2Q1Y A;  4HNA B;  3NVK E;  1JN1 A;  2UYN B;  2DT4 A;  4B5C A;  4TV9 A;  4O4J A;  2W8B C;  5J2T B;  5HY2 A;  5LOV B;  1SA0 A;  2HP3 A;  3HKC A;  1CK2 A;  2N48 A;  4IHJ A;  4BT7 A;  4ZHQ B;  3CME F;  1RQ7 A;  4O2A B;  3RYI A;  3ZOP A;  5BMV A;  1QAH A;  2YYE A;  4I55 B;  3LWQ C;  3NK7 A;  1PF5 A;  1ONI A;  1OAP A;  4F6R B;  4WBN B;  4C8I A;  4U3J B;  4C8E A;  3BYQ A;  2RHJ A;  5JH7 B;  1NJI H;  5HWE A;  3C9R A;  1IPA A;  3P0Z A;  2UYJ A;  3CC2 F;  5JQG A;  5KX5 B;  4ZHQ A;  5LP6 A;  4X1Y B;  5EAZ A;  1XRG A;  1W2B F;  3MQW A;  3VMF B;  2P6Y A;  4G4Y A;  2OTL F;  3K12 A;  1YIT F;  1VQK F;  5IJ0 B;  3RYH B;  3FPI A;  3TD3 A;  3JAR A;  4WBN A;  1FSZ A;  3VTI C;  5A2Q M;  4ZHW A;  5GIN C;  2H8C A;  3V3T A;  1OFU A;  3CXC F;  1W58 1;  3HWU A;  4ZOL A;  3IR9 A;  3ZP7 A;  4G4Z A;  1TUB A;  1K9M H;  2V9Y A;  3CCU F;  3G71 F;  5LA6 A;  5JCO C;  4EI7 A;  1KC8 H;  3P4E A;  1SZQ A;  5JVD B;  3MDO A;  4M8I A;  1XBI A;  2RHO A;  5EYP B;  1SA0 B;  2NMU A;  3I56 F;  4BW0 B;  1JY8 A;  1JFF B;  2GLZ A;  1H48 A;  3RYF B;  1UI9 A;  3N2G A;  5HXU A;  1YJN F;  4DRX B;  5JH7 A;  3C9U A;  1W42 A;  2AMT A;  4BT3 A;  4EI8 A;  5EWR A;  3JAW B;  3IKF A;  4X1K A;  5EZY A;  5CA0 A;  1W55 A;  3JVH A;  1Z5V A;  1Z5W A;  3CC4 F;  3RYF A;  3HKD A;  1W40 A;  5ITZ B;  5G4U C;  3S0W A;  3N2K B;  4G88 A;  3CCS F;  1YI2 F;  1VQL F;  5FJ4 C;  2R75 1;  2HS3 A;  2I6R A;  1J7H A;  3FBA A;  1GO0 A;  3UT5 A;  3JAL A;  4O4H B;  2Q1X A;  3F6M A;  3VYU C;  3CD6 F;  1TUB B;  2OTJ F;  4ZI7 B;  2I6D A;  3CG6 A;  1VQ9 F;  5CA1 A;  2QA4 F;  3IKE A;  3E22 B;  3PLA C;  1RLU A;  3WJQ A;  4TV8 B;  5EYP A;  1YQN A;  1VQV A;  2HP0 B;  3B6N A;  1VQ5 F;  5FNV A;  5EIB D;  3MCQ A;  3R0P A;  3VCZ A;  4G4W A;  3O85 A;  3GTZ A;  2IG8 A;  2HS0 A;  4X1Y A;  3TD5 A;  2UZH A;  2Z1E A;  3I7T A;  2RHL A;  1QU9 A;  3JAT B;  1DT9 A;  3OBY A;  1H47 A;  1W5F A;  4O4I B;  3C9T A;  1DBF A;  3E1Y A;  3F0G A;  4EB6 A;  1GO1 A;  1Q8R A;  2IQQ A;  2BTU A;  3IEW A;  4B46 A;  5GIO C;  1IV1 A;  3VIU A; 
#chains in the Genus database with same CATH homology
 3J81 M;  2VGM A;  5HY4 A;  3RA6 A;  1W2B F;  1Q82 H;  3RA5 A;  4EI9 A;  3VMF B;  1X7O A;  1K8A H;  2OTL F;  1YIT F;  4X3M A;  1VQK F;  3CCR F;  1T0K B;  3D00 A;  3VI6 A;  2AIF A;  2WAL A;  5A2Q M;  1NMU B;  5FLX M;  5GIN C;  1VQ7 F;  2F9Z C;  3V3T A;  3CXC F;  4X3L A;  1YJW F;  1KD1 H;  1VQ4 F;  3LWO C;  3OW2 F;  3IR9 A;  1K9M H;  4BVT A;  1M90 H;  4BVS A;  3CCU F;  3G71 F;  2KTV A;  3ON1 A;  3CCQ F;  3NMU C;  1Q86 H;  4XCQ A;  4C4W C;  4EI7 A;  1KC8 H;  1SDS A;  1XBI A;  3MCA B;  1QVG F;  2QI2 A;  3I56 F;  4BW0 B;  3G4S F;  4BY9 D;  3LFO A;  1X52 A;  2GLZ A;  1YIJ F;  1VQN F;  1S72 F;  1GZ0 A;  4NUT A;  2QEX F;  5HXU A;  3CCJ F;  1VQM F;  1YJN F;  3CPW F;  1RLG A;  2ALE A;  1W42 A;  2KTU A;  4EI8 A;  3N4Z A;  3J80 M;  5EWR A;  1VQP F;  2OZB A;  1CN7 A;  3CPQ A;  5GIP C;  1KQS F;  3LWR C;  3CC4 F;  5G4V C;  1W40 A;  4NQ3 A;  4BVR A;  3J7A R;  5G4U C;  3CCS F;  1VQ8 F;  1YI2 F;  1VQ6 F;  1VQL F;  5FJ4 C;  1K73 H;  3I55 F;  2FGY A;  3PAF A;  3CMA F;  1ZWZ A;  2VGN A;  1E7K A;  4LCK A;  5IT9 M;  1M1K H;  2OHW A;  4BVQ A;  1GO0 A;  1VQO F;  3CCV F;  3HAX D;  5GAP K;  5DCV A;  3OBW A;  2HVY D;  3NK6 A;  3GYQ A;  5EO3 A;  5HY0 A;  3N4Y A;  1Q7Y H;  2CZW A;  3V7Q A;  3CD6 F;  2OTJ F;  2I6D A;  3CG6 A;  1VQ9 F;  1H7M A;  2QA4 F;  3PLA C;  2KG4 A;  2BO1 A;  1W3E X;  3LWP C;  1Q81 H;  1W41 A;  3SIU A;  3CC7 F;  3HJW C;  1VQ5 F;  3NVK E;  3CCL F;  4TZZ A;  5HXZ A;  1X7P A;  3JCM M;  3E20 B;  3O85 A;  5HY2 A;  1N8R H;  3LWV C;  1CK2 A;  3CCE F;  3V7E A;  3CME F;  3WXM B;  5HY1 A;  3G6E F;  3LWQ C;  3NK7 A;  3JAM M;  1QVF F;  2LBX A;  1DT9 A;  3NVI B;  3AGK A;  3OBY A;  1JJ2 F;  1PXW A;  1NJI H;  3FFM A;  3E1Y A;  5HWE A;  1YHQ F;  2FC3 A;  1GO1 A;  1RA4 A;  5GAN K;  1IPA A;  5GIO C;  1YJ9 F;  3SIV A;  3CC2 F;  2LBW A;  3CCM F;  2JNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...