3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords Probable tRNA pseudouridine synthase B
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
2JNBA 2VGNA 1VQNF 1QVFF 1W3EX 1X7PA 5FLXM 1VQOF 3V7QA 5GINC 2LBXA 1X52A 2OTJF 3ON1A 3CC4F 3SIVA 3VMFB 1K9MH 3CPQA 3LWPC 3CCSF 3OBWA 5GAPK 3V7EA 1PXWA 3E1YA 1VQ8F 2QI2A 1W2BF 3CCEF 3CMAF 3LWRC 3CXCF 1GO1A 3J80M 1VQ6F 3NK6A 4BW0B 3CCRF 2BO1A 4LCKA 1IPAA 1Q82H 3E20B 2KG4A 5G4VC 3CCUF 3CC7F 5EWRA 1GO0A 1W41A 3CCLF 3WXMB 3G4SF 3G71F 1Q86H 2QEXF 3SIUA 1YITF 1KD1H 3HJWC 1JJ2F 2LBWA 3LFOA 5G4UC 3CG6A 1H7MA 1K8AH 2KTUA 1Q7YH 3I55F 1X7OA 2KTVA 1YIJF 3NK7A 2HVYD 3PLAC 3JCMM 3CC2F 3N4YA 1K73H 5GIPC 3CCQF 1CK2A 4X3MA 3PAFA 2QA4F 5A2QM 3CCVF 5GIOC 1VQ5F 1VQMF 1YHQF 1VQ9F 1RA4A 1RLGA 3FFMA 3G6EF 1KC8H 2ALEA 2CZWA 3IR9A 3CD6F 3NMUC 3O85A 4TZZA 3I56F 1CN7A 5IT9M 1E7KA 1DT9A 3LWOC 4C4WC 2VGMA 1VQPF 2I6DA 1N8RH 1SDSA 3NVIB 3CPWF 3OBYA 3AGKA 2OTLF 4BY9D 3J7AR 3CCMF 3LWVC 3GYQA 2AIFA 1M90H 2WALA 1VQ4F 3OW2F 1NJIH 1W40A 2FC3A 3NVKE 1NMUB 1KQSF 1VQ7F 1VQKF 3J81M 3RA5A 3CCJF 1YJNF 1Q81H 1T0KB 3N4ZA 1QVGF 2OZBA 5GANK 5FJ4C 5EO3A 1ZWZA 4X3LA 5DCVA 3VI6A 1VQLF 1W42A 1S72F 3CMEF 1YI2F 3RA6A 1M1KH 3HAXD 3MCAB 3JAMM 1YJ9F 4NUTA 3LWQC 1YJWF 2OHWA 1GZ0A 1XBIA
chains in the Genus database with same CATH superfamily
2RHJA 1QVFF 1VHAA 2FGYA 5FLXM 2MQEA 3JVHA 3KJKA 1X52A 2OTJF 5CA0A 3SIVA 4BT3A 4I55A 1OAPA 4IHJA 5CB4A 3BYQA 1PXWA 3F6MA 5MN6A 1VQ8F 4XCQA 5JH7A 3FBAA 2Z1FA 1GO1A 5EB0A 5EIBC 4BW0B 5KMGA 4BT4A 1IPAA 4HNAB 2KG4A 2CVLA 3CCUF 1W41A 3S0YA 2K1SA 3VTIC 3EORA 2DYYA 2LBWA 5ITZB 3LFOA 5JVDA 3CG6A 3RYCA 5CA1A 1H7MA 1Q7YH 2HX0A 2UYNA 3I55F 1YIJF 3PLAC 3JCMM 4O4JA 5GIPC 1RQ7A 4X3MA 5ITZA 3JAWA 4B45A 5MN4A 2QA4F 5HXZA 3CCVF 3S03A 2Z1EA 4HNAA 4ERHA 5IJ0B 5KMGB 4X1IB 1VQ9F 1KNKA 3D54A 3GTZA 3K0TA 2H8CA 5IJ9B 2Q1YA 3FFMA 4X1YA 4B62A 4RHAA 2VXYA 3LYBA 3CD6F 1RLUA 3I56F 4ZI7B 3IEWA 1FSZA 3WGKA 3LWOC 5JVDB 2UZHA 5CB4B 2I6DA 3UT5B 1N8RH 1SDSA 4X1KB 3QUWA 4WBNA 3AGKA 2OTLF 4BY9D 4O4IA 1RQ2A 3CCMF 3GYQA 4I4TA 1T0AA 4G4ZA 2AIFA 2WALA 3N2GA 4O4LA 3F0FA 3NVKE 3N2KB 1KQSF 2PHNA 4RQOA 2R751 4IHJB 1T0KB 4YJ3A 4M8IA 3WPXA 5LXTA 3WGMA 5GANK 4X20A 2BTOA 4YJ2A 4X3LA 3HKCA 2KGWA 3QTYA 5IYZB 3IKFA 2G9IA 4X1KA 1W42A 5EYPA 2N48A 4FFBB 4O4HA 3CB2A 3KJJA 5J2TB 1JFFB 2CSLA 3FPIA 3RA6A 4O4HB 4G4YA 1YJ9F 4TUYA 4EB6A 4FFBA 1VQNF 2HS4A 4TV8A 3S0HA 3TD4A 3VYTC 5LXTB 4C81A 3JALB 4B46A 3LWPC 3UT5A 3C8LA 5GAPK 3E1YA 2QI2A 3RYFA 1W2BF 3RYCB 3LWRC 1YGYA 3CMAF 3J80M 3ZP4A 1VQ6F 4LCKA 1DBFA 2GZLA 4TV9A 1FFXA 5HY2A 3CC7F 5EWRA 1GO0A 3ZP7A 1SA0B 1QU9A 2IQQA 4LNUB 3WGJA 3RYHB 3I7TA 5KX5A 1YITF 1TUBA 1KD1H 3HJWC 3KE1A 3S02A 1JJ2F 3HKBA 2HS3A 5G4UC 4U39A 3LMEA 1K8AH 4BT5A 2YXZA 3HKBB 3CC2F 3N4YA 1K73H 3K14A 3PAFA 2AMTA 1TUBB 2OTMA 3MBMA 5LA6B 5A2QM 1IV2A 4BT2A 1VQMF 1YHQF 5LYJB 1RA4A 2CWJA 2RHOA 3ELCA 4EI7A 1RLGA 3G6EF 1KC8H 2Z1TA 4U3JB 3K12A 3WJQA 1CN7A 2GVIA 2H6LA 2ZVYA 5JCOC 4C4WC 5EYPB 1R1MA 3CPWF 2CW4A 3J7AR 5CA0B 3D01A 3VCZA 3LWVC 3R0PA 2GLZA 1QD9A 4TV9B 1Z5WA 3OW2F 4E6EA 2H8EA 3C9SA 1NJIH 3I3FA 4NQ3A 3WGLA 4F6RA 3HKDA 1JD1A 3ZOPA 5JH7B 5BMVA 2BTQB 3KHNA 3N2KA 3CCJF 1YJNF 1Q81H 1NQ3A 3S0WA 4IIJB 3N4ZA 5LP6B 3JARB 3V3TA 5FJ4C 4I50A 5MN5A 5HY1A 5DCVA 3C9UA 1UFYA 4YJ3B 4BVRA 3JASB 3K2XA 1VH8A 1U3PA 1W5AA 2QTPA 1YI2F 5HP8A 4X1YB 1JFFA 5IJ9A 3JAMM 3WPWA 2YYEA 4NUTA 2Q1XA 2UYPA 3M4SA 1XHOA 2JNBA 2VGNA 3JASA 1CLIA 1X7PA 4ZHYB 2VAWA 3V7QA 1TVKA 2ZVZA 5GINC 1COMA 4O4IB 5LP6A 1K9MH 3CPQA 3IEQA 3OBWA 4O2AB 3JAKB 5EZYB 4BT7A 5CA1B 2VAMA 3CXCF 3L7QA 5GONA 5LYJA 3CCRF 1U43A 2NMUA 5J2UB 3DC2A 4ZOLB 4R40B 1FNJA 3G4SF 1FFXB 3G71F 2QEXF 1Q86H 2IG8A 4C82A 5HXUA 3SIUA 3HKEA 4G4XA 2V9YA 4C8IA 1XV2A 5GONB 3KIZA 3QHDA 4O2BB 2KTUA 1VK3A 1X7OA 3JAKA 2HVYD 2HRUA 3MDOA 1OFUA 3D00A 1CK2A 3WJRA 1W5EA 1U40A 3HKEB 3C9TA 3RYHA 1VQ5F 5LA6A 2RHLA 3JAWB 4BVTA 4ZK7A 3ESJA 3FD6A 3HWUA 3TD5A 1XRGA 2CZWA 1Z5VA 5HY0A 3NMUC 1ODEA 3O85A 4TZZA 2Z1UA 4O2BA 5J2TA 5IT9M 1DT9A 1W55A 1IV4A 2EWCA 4ZHQA 3NVIB 3OBYA 5B8FA 1W581 3T80A 3MCQA 1IV1A 3ZO8A 1SZQA 1U3LA 2UYJA 1M90H 5EAZA 2B33A 2R6R1 5J2UA 3VOAA 5C8YB 4DXDA 3RYIA 1NMUB 3VYUC 3FD5A 1VQ7F 5JCOA 1VQKF 4G88A 1W57A 4O2AA 4O4LB 2F9ZC 5IYZA 4I4TB 5EO3A 3E22A 1IV3A 1ZWZA 3VI6A 1KNJA 4YJ2B 3U0OA 1VQLF 4EI8A 5AVMA 3VIUA 2L26A 1W5BA 4BVQA 3CMEF 4F6RB 3RYIB 4BVSA 3P0ZA 2P6YA 2AIZP 2HRYA 1GZ0A 1XBIA 5FNVB 5IJ0A 1W3EX 3HKCB 3OONA 4EI9A 1VQOF 4C8GA 3P4EA 2LBXA 2HP0B 3ON1A 3CC4F 3VMFB 5HP7A 5EB1B 2PMPA 4O4JB 3V4DA 1QAHA 4ZI7A 4U3JA 3WGNA 3CCSF 3VYSC 2ZOVA 4BT6A 3V7EA 4C8EA 3CCEF 1PF5A 3NK6A 1X25A 3CYQA 2BO1A 1ONIA 1Q82H 3E20B 3IMPA 5G4VC 1UI9A 1H48A 3C9RA 3CCLF 3WXMB 2LCAA 3DDNA 2LBTA 3S06A 2CHSA 4KWEA 4WBNB 4ZHQB 2HQSC 3RYFB 2RHHA 5LP6C 3M1XA 5HWEA 2KTVA 3NK7A 5HY4A 3CCQF 2W8BC 4DRXB 1SA0A 2Z01A 4B5CA 2IAFA 5KX5B 5GIOC 4LNUA 5FNVA 4DRXA 4ZOLA 2BTUA 5EIBD 4ZHWA 2ZODA 1JY8A 2HP3A 3F0GA 1Q8RA 1FNKA 2ALEA 2UYNB 3F0DA 3IR9A 5EZYA 1W59A 1E7KA 3MQWA 4I55B 3Q8HA 2VGMA 1VQPF 2HP0A 5JQGB 4TV8B 3ERNA 1W5FA 3E22B 4X20B 4I50B 4ZHVA 3CYPB 1VQ4F 3B6NA 2CHTA 2HS0A 1W40A 2FC3A 3M84A 3VOBA 1J7HA 3P10A 4PWTA 5LOVA 3J81M 3VO8A 3RA5A 5C8YA 1YQNA 2ZAUA 3JATB 3WJPA 3JALA 2DT4A 1QVGF 2OZBA 2UYKA 1GX1A 1TVKB 4G4VA 2ZF8A 3F0EA 5JQGA 4IIJA 3HTNA 3JARA 1S72F 3LDTA 4G4WA 5LOVB 4TUYB 4EB6B 2I6RA 2VAPA 3JATA 3GHZA 3IKEA 5BMVB 1JN1A 3RE3A 1H47A 3TD3A 3HKDB 1M1KH 3HAXD 3MCAB 2RB9A 1VQVA 4NWOB 3LWQC 1YJWF 2OHWA 3N2GB 4X1IA
chains in the Genus database with same CATH topology
2JNBA 2VGNA 1VQNF 1QVFF 1W3EX 1X7PA 2FGYA 5FLXM 4EI9A 1VQOF 3V7QA 5GINC 2LBXA 1X52A 2OTJF 3ON1A 3CC4F 3SIVA 3VMFB 1K9MH 3CPQA 3LWPC 3CCSF 3OBWA 5GAPK 3V7EA 1PXWA 3E1YA 1VQ8F 2QI2A 4XCQA 1W2BF 3CCEF 3CMAF 3LWRC 3CXCF 1GO1A 3J80M 1VQ6F 3NK6A 4BW0B 3CCRF 2BO1A 4LCKA 1IPAA 1Q82H 3E20B 2KG4A 5HY2A 5G4VC 3CCUF 3CC7F 5EWRA 1GO0A 1W41A 3CCLF 3WXMB 3G4SF 3G71F 1Q86H 2QEXF 3SIUA 5HXUA 1YITF 1KD1H 3HJWC 1JJ2F 2LBWA 3LFOA 5G4UC 3CG6A 1H7MA 1K8AH 2KTUA 1Q7YH 5HWEA 3I55F 1X7OA 2KTVA 1YIJF 3NK7A 2HVYD 5HY4A 3JCMM 3PLAC 3CC2F 3N4YA 1K73H 3D00A 5GIPC 3CCQF 1CK2A 4X3MA 3PAFA 2QA4F 5HXZA 5A2QM 3CCVF 5GIOC 1VQ5F 1VQMF 1YHQF 1VQ9F 4BVTA 1RA4A 1RLGA 4EI7A 3FFMA 3G6EF 1KC8H 2ALEA 2CZWA 3IR9A 5HY0A 3CD6F 3NMUC 3O85A 4TZZA 3I56F 1CN7A 5IT9M 1E7KA 1DT9A 3LWOC 4C4WC 2VGMA 1VQPF 2I6DA 1N8RH 1SDSA 3NVIB 3CPWF 3OBYA 3AGKA 2OTLF 4BY9D 3J7AR 3CCMF 3LWVC 3GYQA 2GLZA 2AIFA 1M90H 2WALA 1VQ4F 3OW2F 1NJIH 1W40A 2FC3A 4NQ3A 3NVKE 1NMUB 1KQSF 1VQ7F 1VQKF 3J81M 3RA5A 3CCJF 1YJNF 1Q81H 1T0KB 2F9ZC 3N4ZA 1QVGF 2OZBA 5GANK 3V3TA 5FJ4C 5EO3A 1ZWZA 4X3LA 5HY1A 5DCVA 3VI6A 4BVRA 1VQLF 4EI8A 1W42A 1S72F 3CMEF 4BVQA 1YI2F 3RA6A 4BVSA 1M1KH 3HAXD 3MCAB 3JAMM 1YJ9F 4NUTA 3LWQC 1YJWF 2OHWA 1GZ0A 1XBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNB A;  2VGN A;  1VQN F;  1QVF F;  1W3E X;  1X7P A;  5FLX M;  1VQO F;  3V7Q A;  5GIN C;  2LBX A;  1X52 A;  2OTJ F;  3ON1 A;  3CC4 F;  3SIV A;  3VMF B;  1K9M H;  3CPQ A;  3LWP C;  3CCS F;  3OBW A;  5GAP K;  3V7E A;  1PXW A;  3E1Y A;  1VQ8 F;  2QI2 A;  1W2B F;  3CCE F;  3CMA F;  3LWR C;  3CXC F;  1GO1 A;  3J80 M;  1VQ6 F;  3NK6 A;  4BW0 B;  3CCR F;  2BO1 A;  4LCK A;  1IPA A;  1Q82 H;  3E20 B;  2KG4 A;  5G4V C;  3CCU F;  3CC7 F;  5EWR A;  1GO0 A;  1W41 A;  3CCL F;  3WXM B;  3G4S F;  3G71 F;  1Q86 H;  2QEX F;  3SIU A;  1YIT F;  1KD1 H;  3HJW C;  1JJ2 F;  2LBW A;  3LFO A;  5G4U C;  3CG6 A;  1H7M A;  1K8A H;  2KTU A;  1Q7Y H;  3I55 F;  1X7O A;  2KTV A;  1YIJ F;  3NK7 A;  2HVY D;  3PLA C;  3JCM M;  3CC2 F;  3N4Y A;  1K73 H;  5GIP C;  3CCQ F;  1CK2 A;  4X3M A;  3PAF A;  2QA4 F;  5A2Q M;  3CCV F;  5GIO C;  1VQ5 F;  1VQM F;  1YHQ F;  1VQ9 F;  1RA4 A;  1RLG A;  3FFM A;  3G6E F;  1KC8 H;  2ALE A;  2CZW A;  3IR9 A;  3CD6 F;  3NMU C;  3O85 A;  4TZZ A;  3I56 F;  1CN7 A;  5IT9 M;  1E7K A;  1DT9 A;  3LWO C;  4C4W C;  2VGM A;  1VQP F;  2I6D A;  1N8R H;  1SDS A;  3NVI B;  3CPW F;  3OBY A;  3AGK A;  2OTL F;  4BY9 D;  3J7A R;  3CCM F;  3LWV C;  3GYQ A;  2AIF A;  1M90 H;  2WAL A;  1VQ4 F;  3OW2 F;  1NJI H;  1W40 A;  2FC3 A;  3NVK E;  1NMU B;  1KQS F;  1VQ7 F;  1VQK F;  3J81 M;  3RA5 A;  3CCJ F;  1YJN F;  1Q81 H;  1T0K B;  3N4Z A;  1QVG F;  2OZB A;  5GAN K;  5FJ4 C;  5EO3 A;  1ZWZ A;  4X3L A;  5DCV A;  3VI6 A;  1VQL F;  1W42 A;  1S72 F;  3CME F;  1YI2 F;  3RA6 A;  1M1K H;  3HAX D;  3MCA B;  3JAM M;  1YJ9 F;  4NUT A;  3LWQ C;  1YJW F;  2OHW A;  1GZ0 A;  1XBI A; 
#chains in the Genus database with same CATH topology
 2RHJ A;  1QVF F;  1VHA A;  2FGY A;  5FLX M;  2MQE A;  3JVH A;  3KJK A;  1X52 A;  2OTJ F;  5CA0 A;  3SIV A;  4BT3 A;  4I55 A;  1OAP A;  4IHJ A;  5CB4 A;  3BYQ A;  1PXW A;  3F6M A;  5MN6 A;  1VQ8 F;  4XCQ A;  5JH7 A;  3FBA A;  2Z1F A;  1GO1 A;  5EB0 A;  5EIB C;  4BW0 B;  5KMG A;  4BT4 A;  1IPA A;  4HNA B;  2KG4 A;  2CVL A;  3CCU F;  1W41 A;  3S0Y A;  2K1S A;  3VTI C;  3EOR A;  2DYY A;  2LBW A;  5ITZ B;  3LFO A;  5JVD A;  3CG6 A;  3RYC A;  5CA1 A;  1H7M A;  1Q7Y H;  2HX0 A;  2UYN A;  3I55 F;  1YIJ F;  3PLA C;  3JCM M;  4O4J A;  5GIP C;  1RQ7 A;  4X3M A;  5ITZ A;  3JAW A;  4B45 A;  5MN4 A;  2QA4 F;  5HXZ A;  3CCV F;  3S03 A;  2Z1E A;  4HNA A;  4ERH A;  5IJ0 B;  5KMG B;  4X1I B;  1VQ9 F;  1KNK A;  3D54 A;  3GTZ A;  3K0T A;  2H8C A;  5IJ9 B;  2Q1Y A;  3FFM A;  4X1Y A;  4B62 A;  4RHA A;  2VXY A;  3LYB A;  3CD6 F;  1RLU A;  3I56 F;  4ZI7 B;  3IEW A;  1FSZ A;  3WGK A;  3LWO C;  5JVD B;  2UZH A;  5CB4 B;  2I6D A;  3UT5 B;  1N8R H;  1SDS A;  4X1K B;  3QUW A;  4WBN A;  3AGK A;  2OTL F;  4BY9 D;  4O4I A;  1RQ2 A;  3CCM F;  3GYQ A;  4I4T A;  1T0A A;  4G4Z A;  2AIF A;  2WAL A;  3N2G A;  4O4L A;  3F0F A;  3NVK E;  3N2K B;  1KQS F;  2PHN A;  4RQO A;  2R75 1;  4IHJ B;  1T0K B;  4YJ3 A;  4M8I A;  3WPX A;  5LXT A;  3WGM A;  5GAN K;  4X20 A;  2BTO A;  4YJ2 A;  4X3L A;  3HKC A;  2KGW A;  3QTY A;  5IYZ B;  3IKF A;  2G9I A;  4X1K A;  1W42 A;  5EYP A;  2N48 A;  4FFB B;  4O4H A;  3CB2 A;  3KJJ A;  5J2T B;  1JFF B;  2CSL A;  3FPI A;  3RA6 A;  4O4H B;  4G4Y A;  1YJ9 F;  4TUY A;  4EB6 A;  4FFB A;  1VQN F;  2HS4 A;  4TV8 A;  3S0H A;  3TD4 A;  3VYT C;  5LXT B;  4C81 A;  3JAL B;  4B46 A;  3LWP C;  3UT5 A;  3C8L A;  5GAP K;  3E1Y A;  2QI2 A;  3RYF A;  1W2B F;  3RYC B;  3LWR C;  1YGY A;  3CMA F;  3J80 M;  3ZP4 A;  1VQ6 F;  4LCK A;  1DBF A;  2GZL A;  4TV9 A;  1FFX A;  5HY2 A;  3CC7 F;  5EWR A;  1GO0 A;  3ZP7 A;  1SA0 B;  1QU9 A;  2IQQ A;  4LNU B;  3WGJ A;  3RYH B;  3I7T A;  5KX5 A;  1YIT F;  1TUB A;  1KD1 H;  3HJW C;  3KE1 A;  3S02 A;  1JJ2 F;  3HKB A;  2HS3 A;  5G4U C;  4U39 A;  3LME A;  1K8A H;  4BT5 A;  2YXZ A;  3HKB B;  3CC2 F;  3N4Y A;  1K73 H;  3K14 A;  3PAF A;  2AMT A;  1TUB B;  2OTM A;  3MBM A;  5LA6 B;  5A2Q M;  1IV2 A;  4BT2 A;  1VQM F;  1YHQ F;  5LYJ B;  1RA4 A;  2CWJ A;  2RHO A;  3ELC A;  4EI7 A;  1RLG A;  3G6E F;  1KC8 H;  2Z1T A;  4U3J B;  3K12 A;  3WJQ A;  1CN7 A;  2GVI A;  2H6L A;  2ZVY A;  5JCO C;  4C4W C;  5EYP B;  1R1M A;  3CPW F;  2CW4 A;  3J7A R;  5CA0 B;  3D01 A;  3VCZ A;  3LWV C;  3R0P A;  2GLZ A;  1QD9 A;  4TV9 B;  1Z5W A;  3OW2 F;  4E6E A;  2H8E A;  3C9S A;  1NJI H;  3I3F A;  4NQ3 A;  3WGL A;  4F6R A;  3HKD A;  1JD1 A;  3ZOP A;  5JH7 B;  5BMV A;  2BTQ B;  3KHN A;  3N2K A;  3CCJ F;  1YJN F;  1Q81 H;  1NQ3 A;  3S0W A;  4IIJ B;  3N4Z A;  5LP6 B;  3JAR B;  3V3T A;  5FJ4 C;  4I50 A;  5MN5 A;  5HY1 A;  5DCV A;  3C9U A;  1UFY A;  4YJ3 B;  4BVR A;  3JAS B;  3K2X A;  1VH8 A;  1U3P A;  1W5A A;  2QTP A;  1YI2 F;  5HP8 A;  4X1Y B;  1JFF A;  5IJ9 A;  3JAM M;  3WPW A;  2YYE A;  4NUT A;  2Q1X A;  2UYP A;  3M4S A;  1XHO A;  2JNB A;  2VGN A;  3JAS A;  1CLI A;  1X7P A;  4ZHY B;  2VAW A;  3V7Q A;  1TVK A;  2ZVZ A;  5GIN C;  1COM A;  4O4I B;  5LP6 A;  1K9M H;  3CPQ A;  3IEQ A;  3OBW A;  4O2A B;  3JAK B;  5EZY B;  4BT7 A;  5CA1 B;  2VAM A;  3CXC F;  3L7Q A;  5GON A;  5LYJ A;  3CCR F;  1U43 A;  2NMU A;  5J2U B;  3DC2 A;  4ZOL B;  4R40 B;  1FNJ A;  3G4S F;  1FFX B;  3G71 F;  2QEX F;  1Q86 H;  2IG8 A;  4C82 A;  5HXU A;  3SIU A;  3HKE A;  4G4X A;  2V9Y A;  4C8I A;  1XV2 A;  5GON B;  3KIZ A;  3QHD A;  4O2B B;  2KTU A;  1VK3 A;  1X7O A;  3JAK A;  2HVY D;  2HRU A;  3MDO A;  1OFU A;  3D00 A;  1CK2 A;  3WJR A;  1W5E A;  1U40 A;  3HKE B;  3C9T A;  3RYH A;  1VQ5 F;  5LA6 A;  2RHL A;  3JAW B;  4BVT A;  4ZK7 A;  3ESJ A;  3FD6 A;  3HWU A;  3TD5 A;  1XRG A;  2CZW A;  1Z5V A;  5HY0 A;  3NMU C;  1ODE A;  3O85 A;  4TZZ A;  2Z1U A;  4O2B A;  5J2T A;  5IT9 M;  1DT9 A;  1W55 A;  1IV4 A;  2EWC A;  4ZHQ A;  3NVI B;  3OBY A;  5B8F A;  1W58 1;  3T80 A;  3MCQ A;  1IV1 A;  3ZO8 A;  1SZQ A;  1U3L A;  2UYJ A;  1M90 H;  5EAZ A;  2B33 A;  2R6R 1;  5J2U A;  3VOA A;  5C8Y B;  4DXD A;  3RYI A;  1NMU B;  3VYU C;  3FD5 A;  1VQ7 F;  5JCO A;  1VQK F;  4G88 A;  1W57 A;  4O2A A;  4O4L B;  2F9Z C;  5IYZ A;  4I4T B;  5EO3 A;  3E22 A;  1IV3 A;  1ZWZ A;  3VI6 A;  1KNJ A;  4YJ2 B;  3U0O A;  1VQL F;  4EI8 A;  5AVM A;  3VIU A;  2L26 A;  1W5B A;  4BVQ A;  3CME F;  4F6R B;  3RYI B;  4BVS A;  3P0Z A;  2P6Y A;  2AIZ P;  2HRY A;  1GZ0 A;  1XBI A;  5FNV B;  5IJ0 A;  1W3E X;  3HKC B;  3OON A;  4EI9 A;  1VQO F;  4C8G A;  3P4E A;  2LBX A;  2HP0 B;  3ON1 A;  3CC4 F;  3VMF B;  5HP7 A;  5EB1 B;  2PMP A;  4O4J B;  3V4D A;  1QAH A;  4ZI7 A;  4U3J A;  3WGN A;  3CCS F;  3VYS C;  2ZOV A;  4BT6 A;  3V7E A;  4C8E A;  3CCE F;  1PF5 A;  3NK6 A;  1X25 A;  3CYQ A;  2BO1 A;  1ONI A;  1Q82 H;  3E20 B;  3IMP A;  5G4V C;  1UI9 A;  1H48 A;  3C9R A;  3CCL F;  3WXM B;  2LCA A;  3DDN A;  2LBT A;  3S06 A;  2CHS A;  4KWE A;  4WBN B;  4ZHQ B;  2HQS C;  3RYF B;  2RHH A;  5LP6 C;  3M1X A;  5HWE A;  2KTV A;  3NK7 A;  5HY4 A;  3CCQ F;  2W8B C;  4DRX B;  1SA0 A;  2Z01 A;  4B5C A;  2IAF A;  5KX5 B;  5GIO C;  4LNU A;  5FNV A;  4DRX A;  4ZOL A;  2BTU A;  5EIB D;  4ZHW A;  2ZOD A;  1JY8 A;  2HP3 A;  3F0G A;  1Q8R A;  1FNK A;  2ALE A;  2UYN B;  3F0D A;  3IR9 A;  5EZY A;  1W59 A;  1E7K A;  3MQW A;  4I55 B;  3Q8H A;  2VGM A;  1VQP F;  2HP0 A;  5JQG B;  4TV8 B;  3ERN A;  1W5F A;  3E22 B;  4X20 B;  4I50 B;  4ZHV A;  3CYP B;  1VQ4 F;  3B6N A;  2CHT A;  2HS0 A;  1W40 A;  2FC3 A;  3M84 A;  3VOB A;  1J7H A;  3P10 A;  4PWT A;  5LOV A;  3J81 M;  3VO8 A;  3RA5 A;  5C8Y A;  1YQN A;  2ZAU A;  3JAT B;  3WJP A;  3JAL A;  2DT4 A;  1QVG F;  2OZB A;  2UYK A;  1GX1 A;  1TVK B;  4G4V A;  2ZF8 A;  3F0E A;  5JQG A;  4IIJ A;  3HTN A;  3JAR A;  1S72 F;  3LDT A;  4G4W A;  5LOV B;  4TUY B;  4EB6 B;  2I6R A;  2VAP A;  3JAT A;  3GHZ A;  3IKE A;  5BMV B;  1JN1 A;  3RE3 A;  1H47 A;  3TD3 A;  3HKD B;  1M1K H;  3HAX D;  3MCA B;  2RB9 A;  1VQV A;  4NWO B;  3LWQ C;  1YJW F;  2OHW A;  3N2G B;  4X1I A; 
#chains in the Genus database with same CATH homology
 2JNB A;  2VGN A;  1VQN F;  1QVF F;  1W3E X;  1X7P A;  2FGY A;  5FLX M;  4EI9 A;  1VQO F;  3V7Q A;  5GIN C;  2LBX A;  1X52 A;  2OTJ F;  3ON1 A;  3CC4 F;  3SIV A;  3VMF B;  1K9M H;  3CPQ A;  3LWP C;  3CCS F;  3OBW A;  5GAP K;  3V7E A;  1PXW A;  3E1Y A;  1VQ8 F;  2QI2 A;  4XCQ A;  1W2B F;  3CCE F;  3CMA F;  3LWR C;  3CXC F;  1GO1 A;  3J80 M;  1VQ6 F;  3NK6 A;  4BW0 B;  3CCR F;  2BO1 A;  4LCK A;  1IPA A;  1Q82 H;  3E20 B;  2KG4 A;  5HY2 A;  5G4V C;  3CCU F;  3CC7 F;  5EWR A;  1GO0 A;  1W41 A;  3CCL F;  3WXM B;  3G4S F;  3G71 F;  1Q86 H;  2QEX F;  3SIU A;  5HXU A;  1YIT F;  1KD1 H;  3HJW C;  1JJ2 F;  2LBW A;  3LFO A;  5G4U C;  3CG6 A;  1H7M A;  1K8A H;  2KTU A;  1Q7Y H;  5HWE A;  3I55 F;  1X7O A;  2KTV A;  1YIJ F;  3NK7 A;  2HVY D;  5HY4 A;  3JCM M;  3PLA C;  3CC2 F;  3N4Y A;  1K73 H;  3D00 A;  5GIP C;  3CCQ F;  1CK2 A;  4X3M A;  3PAF A;  2QA4 F;  5HXZ A;  5A2Q M;  3CCV F;  5GIO C;  1VQ5 F;  1VQM F;  1YHQ F;  1VQ9 F;  4BVT A;  1RA4 A;  1RLG A;  4EI7 A;  3FFM A;  3G6E F;  1KC8 H;  2ALE A;  2CZW A;  3IR9 A;  5HY0 A;  3CD6 F;  3NMU C;  3O85 A;  4TZZ A;  3I56 F;  1CN7 A;  5IT9 M;  1E7K A;  1DT9 A;  3LWO C;  4C4W C;  2VGM A;  1VQP F;  2I6D A;  1N8R H;  1SDS A;  3NVI B;  3CPW F;  3OBY A;  3AGK A;  2OTL F;  4BY9 D;  3J7A R;  3CCM F;  3LWV C;  3GYQ A;  2GLZ A;  2AIF A;  1M90 H;  2WAL A;  1VQ4 F;  3OW2 F;  1NJI H;  1W40 A;  2FC3 A;  4NQ3 A;  3NVK E;  1NMU B;  1KQS F;  1VQ7 F;  1VQK F;  3J81 M;  3RA5 A;  3CCJ F;  1YJN F;  1Q81 H;  1T0K B;  2F9Z C;  3N4Z A;  1QVG F;  2OZB A;  5GAN K;  3V3T A;  5FJ4 C;  5EO3 A;  1ZWZ A;  4X3L A;  5HY1 A;  5DCV A;  3VI6 A;  4BVR A;  1VQL F;  4EI8 A;  1W42 A;  1S72 F;  3CME F;  4BVQ A;  1YI2 F;  3RA6 A;  4BVS A;  1M1K H;  3HAX D;  3MCA B;  3JAM M;  1YJ9 F;  4NUT A;  3LWQ C;  1YJW F;  2OHW A;  1GZ0 A;  1XBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...