3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
3LWRC 1VQKF 2JNBA 1KQSF 3NK6A 2FC3A 4X3LA 1NMUB 1GO0A 5GINC 3N4YA 2KTUA 3V7QA 3VMFB 3CCLF 3CC4F 3OBWA 3JCMM 1W3EX 2QA4F 5DCVA 1W40A 3CPQA 3WXMB 1M1KH 3NVKE 3CG6A 1DT9A 1KC8H 1VQPF 1W41A 3G6EF 1YJNF 3LWPC 2WALA 3FFMA 1H7MA 2LBWA 3IR9A 1N8RH 3LWOC 3CCRF 3CMAF 3CCSF 1GZ0A 3HJWC 2QI2A 3SIUA 3J80M 1S72F 3RA6A 5FLXM 2HVYD 3SIVA 1YHQF 2QEXF 1VQ8F 3OW2F 1XBIA 3HAXD 1K8AH 3NMUC 2KTVA 1JJ2F 1YJWF 1VQ6F 3LWQC 3JAMM 2OHWA 5GIPC 1M90H 1RLGA 4BW0B 3CCUF 1RA4A 4X3MA 3CCQF 3NVIB 1W2BF 1T0KB 3J7AR 3CMEF 3LFOA 1Q7YH 3I55F 4TZZA 3V7EA 1CK2A 5GANK 3OBYA 1Q81H 3RA5A 2CZWA 3E1YA 1SDSA 1VQ7F 3J81M 1VQMF 1Q86H 4NUTA 3G4SF 1QVFF 2OTJF 1X7PA 5EWRA 3PAFA 3ON1A 1K73H 1QVGF 2LBXA 1CN7A 1NJIH 3CC7F 3E20B 3VI6A 3CC2F 1X7OA 2AIFA 3G71F 5GAPK 1VQOF 1Q82H 2I6DA 1YJ9F 4C4WC 2KG4A 3N4ZA 3CD6F 3CXCF 1KD1H 1W42A 1VQLF 3CCJF 2OZBA 4BY9D 3PLAC 5G4VC 3AGKA 2OTLF 1VQ5F 5IT9M 5FJ4C 3CPWF 1ZWZA 4LCKA 1IPAA 3LWVC 3CCMF 3NK7A 5EO3A 3CCVF 1VQNF 2ALEA 1PXWA 3GYQA 1E7KA 2VGMA 5A2QM 1K9MH 1YITF 1VQ9F 1YI2F 1YIJF 1GO1A 3O85A 1VQ4F 2BO1A 5GIOC 3MCAB 2VGNA 3I56F 5G4UC 1X52A 3CCEF
chains in the Genus database with same CATH superfamily
2AMTA 1XRGA 5EZYA 1Z5VA 2W8BC 3ESJA 3JALB 3NK6A 4PWTA 4LNUA 3VTIC 4C8GA 2L26A 1NMUB 2F9ZC 3B6NA 3R0PA 5GINC 5EB0A 3VMFB 1IV2A 3CC4F 4X1IA 3JCMM 5FNVA 3JARB 5DCVA 2N48A 3JATB 3CPQA 3T80A 1DT9A 3VIUA 1KC8H 1ODEA 3F6MA 1YJNF 2WALA 3LDTA 2CVLA 4ZHWA 3FFMA 3CCRF 4X1KA 3J80M 4E6EA 3UT5A 2DT4A 2RHLA 2QEXF 1H48A 3IEWA 5HXZA 2Q1XA 1JJ2F 2HP0A 1YJWF 3LWQC 3DC2A 3D54A 5GIPC 1M90H 4O2BB 2CW4A 1VHAA 1RA4A 1J7HA 3P0ZA 3J7AR 3CMEF 4ZHQB 4TZZA 3V7EA 4I4TA 3P4EA 4C82A 5EYPB 3RYIA 1Q81H 4U39A 2UYNA 3J81M 1Q86H 4G88A 2HRYA 3WGNA 4IIJB 2VAWA 1XHOA 1K73H 4YJ2B 5IJ9B 3LMEA 4G4WA 3VI6A 4EB6B 2VAPA 1OAPA 3IMPA 4M8IA 3HTNA 1Q82H 3N4ZA 3ZP7A 3N2GA 3ZP4A 2ZVZA 3D01A 5LP6A 1TUBB 2OZBA 3WGJA 5G4VC 5J2UA 1PF5A 5IT9M 5FJ4C 3CPWF 4LCKA 5LYJB 5C8YA 2CSLA 2PHNA 3NK7A 2DYYA 5EIBD 4ERHA 3S03A 3JAKA 3ZOPA 2I6RA 2UYKA 3TD4A 5KX5A 4O4IA 2R751 3O85A 2GLZA 3Q8HA 5GIOC 4C81A 1Z5WA 3E22A 1U40A 3K12A 1QU9A 5J2TA 3M1XA 1W5AA 2ZF8A 3TD5A 2JNBA 4B46A 5IYZB 3HKDA 5BMVB 3JASB 4O4HB 4BVTA 4B5CA 3RYHA 1W3EX 1T0AA 3ELCA 2OTMA 5HXUA 2CHTA 2RHJA 1SA0B 4F6RB 2BTQB 3KJJA 2HS4A 3F0FA 3FPIA 3G6EF 4ZI7A 4X1YB 4ZHYB 5LA6B 4FFBA 3HKCB 3TD3A 3VO8A 3CCSF 3JAWB 1GZ0A 1RLUA 4O2AB 4EI8A 1S72F 3CYQA 3RA6A 2HVYD 2R6R1 1KNJA 4C8IA 1VQ8F 3L7QA 3C9UA 3NMUC 4I55B 4O4JA 2IG8A 3S02A 1JFFB 3MCQA 3JAMM 2OHWA 4ZOLB 3RYFA 1RLGA 3K14A 1W581 3QTYA 5MN6A 2UYJA 1IV3A 1IV4A 2Z1TA 1W2BF 4TV9A 5MN5A 2ZVYA 2YYEA 1CK2A 5GANK 3VOAA 1JY8A 5JVDB 3RA5A 5CA1A 3U0OA 1TVKA 3IKEA 1SDSA 3F0GA 4DRXB 4HNAA 3IKFA 5JQGB 3WGLA 2YXZA 1W5EA 3LYBA 5LP6C 3K2XA 4BT5A 3RYCB 4XCQA 5ITZA 3CC7F 3E20B 3CC2F 5LOVB 1FFXA 3G71F 3VYSC 2NMUA 5GAPK 1VQOF 4WBNB 5GONB 3N2KB 3QHDA 2LBTA 3VCZA 5CA0B 4IHJA 5KMGA 1X25A 4O4LA 1KD1H 1VQLF 4TUYA 3CCJF 4B45A 3AGKA 1VH8A 2HP3A 3WGKA 5JH7B 5CB4B 2VXYA 3WJQA 4BT3A 3GTZA 5EO3A 3JALA 1ONIA 3CCVF 1PXWA 3WPXA 3DDNA 5LXTB 1QAHA 2IQQA 1K9MH 3VYUC 1FNKA 1VQ9F 4G4VA 1YI2F 3BYQA 1GO1A 1VQ4F 3JARA 3JATA 4TV8B 3F0EA 4BT6A 4I50B 2Z01A 5EAZA 1X52A 3I3FA 4ZK7A 2HRUA 3CCEF 3C8LA 4RHAA 2AIZP 2CHSA 3HKEB 1NQ3A 3LWRC 2UZHA 3EORA 3VYTC 4BVSA 4X3LA 5JCOA 4YJ3B 3V3TA 3N4YA 3CCLF 3CYPB 3HKBB 3OBWA 2KGWA 3ERNA 3C9SA 3S06A 2BTOA 1W40A 4X20B 5IJ0B 2H8EA 5HY2A 1W41A 4U3JB 4O2BA 3GHZA 5EZYB 1H7MA 2LBWA 2Q1YA 1U3LA 3IR9A 4LNUB 2K1SA 2HS3A 4ZHQA 1U3PA 4B62A 2EWCA 4X1IB 5EYPA 5FNVB 1YHQF 1W55A 2CWJA 3JVHA 3HAXD 1K8AH 2LCAA 2KTVA 1VQVA 2H6LA 4IIJA 1VQ6F 5HY4A 2IAFA 4DXDA 1VK3A 2FGYA 4YJ2A 3F0DA 5IJ9A 1DBFA 3CCQF 3QUWA 4X1KB 4EB6A 5EB1B 3I55F 3OBYA 3UT5B 2CZWA 3E1YA 1VQ7F 1VQMF 2GZLA 1TUBA 1YQNA 3MBMA 4NUTA 3G4SF 2HP0B 2OTJF 1X7PA 1YGYA 5EWRA 3ON1A 1QVGF 2LBXA 3IEQA 5LYJA 3D00A 1NJIH 3WJPA 4BT2A 4G4XA 1X7OA 3M4SA 3WJRA 4I4TB 4C4WC 1YJ9F 3RYIB 2P6YA 2RHHA 2UYNB 2HS0A 1JD1A 4G4ZA 5EIBC 2V9YA 4BY9D 2OTLF 1W5FA 1ZWZA 1IPAA 3LWVC 1W57A 5IYZA 2ALEA 3K0TA 4BT4A 5BMVA 3GYQA 3JASA 2ZOVA 4O4HA 1YITF 1YIJF 2BTUA 5JCOC 3N2GB 3I7TA 5LP6B 1UI9A 3WGMA 1SA0A 1UFYA 2VGNA 4F6RA 3I56F 5J2UB 1IV1A 4X1YA 5HWEA 4BVQA 1GX1A 5LA6A 1VQKF 5C8YB 2GVIA 1FNJA 1SZQA 3HKCA 1KQSF 2FC3A 3V4DA 2HQSC 3JAWA 4O2AA 1GO0A 3JAKB 3V7QA 2KTUA 2RB9A 5KX5B 4O4IB 2QA4F 1CLIA 1FSZA 3CB2A 5HY0A 3E22B 2VAMA 3WXMB 4I55A 1M1KH 3NVKE 5J2TB 1JFFA 3CG6A 4NQ3A 4ZOLA 1VQPF 2PMPA 3OONA 2Z1EA 3LWPC 1Q8RA 3FBAA 1N8RH 3HKDB 2ZODA 3LWOC 3CMAF 4EI9A 3HJWC 3SIUA 2QI2A 3MQWA 3SIVA 5FLXM 5JVDA 3RYHB 2B33A 2QTPA 3WPWA 3OW2F 1W5BA 1RQ2A 1XBIA 4DRXA 5MN4A 5HY1A 1RQ7A 1COMA 5JQGA 3S0HA 5AVMA 4BW0B 4ZI7B 4NWOB 1OFUA 3CCUF 3RYCA 4FFBB 4X3MA 3KIZA 3NVIB 1T0KB 3LFOA 1Q7YH 5LOVA 2HX0A 3MDOA 3RE3A 4WBNA 2UYPA 5GONA 2Z1FA 1U43A 3N2KA 5CA0A 3KE1A 1XV2A 4O4JB 3KHNA 1QVFF 2RHOA 3PAFA 3RYFB 3S0YA 5JH7A 4RQOA 5CB4A 1CN7A 4TV9B 1W59A 2AIFA 5LXTA 3M84A 4G4YA 5HP7A 2I6DA 2KG4A 3ZO8A 5CA1B 1TVKB 3CD6F 3P10A 3CXCF 5B8FA 1W42A 4C8EA 4HNAB 4TV8A 4ZHVA 1R1MA 3FD5A 4I50A 3PLAC 1JN1A 1VQ5F 3S0WA 3HKEA 2MQEA 3VOBA 3C9RA 5ITZB 3CCMF 1VQNF 4BT7A 1FFXB 2ZAUA 1E7KA 2VGMA 5A2QM 1KNKA 4YJ3A 2Z1UA 3FD6A 3HKBA 5KMGB 2G9IA 4IHJB 4O4LB 4EI7A 2H8CA 2BO1A 4BVRA 3MCAB 3HWUA 4X20A 5HP8A 4KWEA 4TUYB 5IJ0A 5G4UC 3C9TA 1H47A 3KJKA 1QD9A 4U3JA 4R40B
chains in the Genus database with same CATH topology
4BVQA 3LWRC 1VQKF 2JNBA 4BVSA 1KQSF 3NK6A 2FC3A 4X3LA 1NMUB 2F9ZC 1GO0A 3V3TA 5GINC 3N4YA 2KTUA 3V7QA 3VMFB 4BVTA 3CCLF 3CC4F 3OBWA 3JCMM 1W3EX 2QA4F 5DCVA 5HXUA 5HY0A 1W40A 3CPQA 3WXMB 1M1KH 3NVKE 5HY2A 3CG6A 1DT9A 4NQ3A 1KC8H 1VQPF 1W41A 3G6EF 1YJNF 3LWPC 2WALA 3FFMA 1H7MA 2LBWA 3IR9A 1N8RH 3LWOC 3CCRF 3CMAF 4EI9A 1GZ0A 3CCSF 2QI2A 3HJWC 3SIUA 3J80M 4EI8A 1S72F 3RA6A 5FLXM 2HVYD 3SIVA 1YHQF 2QEXF 1VQ8F 3OW2F 1XBIA 3HAXD 1K8AH 3NMUC 5HXZA 5HY1A 2KTVA 1JJ2F 1YJWF 1VQ6F 3LWQC 3JAMM 2OHWA 5HY4A 5GIPC 1M90H 2FGYA 1RLGA 4BW0B 3CCUF 1RA4A 4X3MA 3CCQF 3NVIB 1W2BF 1T0KB 3J7AR 3CMEF 3LFOA 1Q7YH 3I55F 4TZZA 3V7EA 1CK2A 5GANK 3OBYA 1Q81H 3RA5A 2CZWA 3E1YA 1SDSA 1VQ7F 3J81M 1VQMF 1Q86H 4NUTA 3G4SF 1QVFF 2OTJF 1X7PA 5EWRA 3PAFA 3ON1A 1K73H 1QVGF 2LBXA 4XCQA 1CN7A 3D00A 1NJIH 3CC7F 3E20B 3VI6A 3CC2F 1X7OA 2AIFA 3G71F 5GAPK 1VQOF 1Q82H 2I6DA 1YJ9F 4C4WC 2KG4A 3N4ZA 3CD6F 3CXCF 1KD1H 1W42A 1VQLF 3CCJF 2OZBA 4BY9D 3PLAC 5G4VC 3AGKA 2OTLF 1VQ5F 5IT9M 5FJ4C 3CPWF 1ZWZA 4LCKA 1IPAA 3LWVC 3CCMF 3NK7A 5EO3A 3CCVF 1VQNF 2ALEA 1PXWA 3GYQA 1E7KA 2VGMA 5A2QM 1K9MH 1YITF 1VQ9F 1YI2F 1YIJF 1GO1A 3O85A 2GLZA 4EI7A 1VQ4F 2BO1A 4BVRA 5GIOC 3MCAB 2VGNA 3I56F 5G4UC 1X52A 3CCEF 5HWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR C;  1VQK F;  2JNB A;  1KQS F;  3NK6 A;  2FC3 A;  4X3L A;  1NMU B;  1GO0 A;  5GIN C;  3N4Y A;  2KTU A;  3V7Q A;  3VMF B;  3CCL F;  3CC4 F;  3OBW A;  3JCM M;  1W3E X;  2QA4 F;  5DCV A;  1W40 A;  3CPQ A;  3WXM B;  1M1K H;  3NVK E;  3CG6 A;  1DT9 A;  1KC8 H;  1VQP F;  1W41 A;  3G6E F;  1YJN F;  3LWP C;  2WAL A;  3FFM A;  1H7M A;  2LBW A;  3IR9 A;  1N8R H;  3LWO C;  3CCR F;  3CMA F;  3CCS F;  1GZ0 A;  3HJW C;  2QI2 A;  3SIU A;  3J80 M;  1S72 F;  3RA6 A;  5FLX M;  2HVY D;  3SIV A;  1YHQ F;  2QEX F;  1VQ8 F;  3OW2 F;  1XBI A;  3HAX D;  1K8A H;  3NMU C;  2KTV A;  1JJ2 F;  1YJW F;  1VQ6 F;  3LWQ C;  3JAM M;  2OHW A;  5GIP C;  1M90 H;  1RLG A;  4BW0 B;  3CCU F;  1RA4 A;  4X3M A;  3CCQ F;  3NVI B;  1W2B F;  1T0K B;  3J7A R;  3CME F;  3LFO A;  1Q7Y H;  3I55 F;  4TZZ A;  3V7E A;  1CK2 A;  5GAN K;  3OBY A;  1Q81 H;  3RA5 A;  2CZW A;  3E1Y A;  1SDS A;  1VQ7 F;  3J81 M;  1VQM F;  1Q86 H;  4NUT A;  3G4S F;  1QVF F;  2OTJ F;  1X7P A;  5EWR A;  3PAF A;  3ON1 A;  1K73 H;  1QVG F;  2LBX A;  1CN7 A;  1NJI H;  3CC7 F;  3E20 B;  3VI6 A;  3CC2 F;  1X7O A;  2AIF A;  3G71 F;  5GAP K;  1VQO F;  1Q82 H;  2I6D A;  1YJ9 F;  4C4W C;  2KG4 A;  3N4Z A;  3CD6 F;  3CXC F;  1KD1 H;  1W42 A;  1VQL F;  3CCJ F;  2OZB A;  4BY9 D;  3PLA C;  5G4V C;  3AGK A;  2OTL F;  1VQ5 F;  5IT9 M;  5FJ4 C;  3CPW F;  1ZWZ A;  4LCK A;  1IPA A;  3LWV C;  3CCM F;  3NK7 A;  5EO3 A;  3CCV F;  1VQN F;  2ALE A;  1PXW A;  3GYQ A;  1E7K A;  2VGM A;  5A2Q M;  1K9M H;  1YIT F;  1VQ9 F;  1YI2 F;  1YIJ F;  1GO1 A;  3O85 A;  1VQ4 F;  2BO1 A;  5GIO C;  3MCA B;  2VGN A;  3I56 F;  5G4U C;  1X52 A;  3CCE F; 
#chains in the Genus database with same CATH topology
 2AMT A;  1XRG A;  5EZY A;  1Z5V A;  2W8B C;  3ESJ A;  3JAL B;  3NK6 A;  4PWT A;  4LNU A;  3VTI C;  4C8G A;  2L26 A;  1NMU B;  2F9Z C;  3B6N A;  3R0P A;  5GIN C;  5EB0 A;  3VMF B;  1IV2 A;  3CC4 F;  4X1I A;  3JCM M;  5FNV A;  3JAR B;  5DCV A;  2N48 A;  3JAT B;  3CPQ A;  3T80 A;  1DT9 A;  3VIU A;  1KC8 H;  1ODE A;  3F6M A;  1YJN F;  2WAL A;  3LDT A;  2CVL A;  4ZHW A;  3FFM A;  3CCR F;  4X1K A;  3J80 M;  4E6E A;  3UT5 A;  2DT4 A;  2RHL A;  2QEX F;  1H48 A;  3IEW A;  5HXZ A;  2Q1X A;  1JJ2 F;  2HP0 A;  1YJW F;  3LWQ C;  3DC2 A;  3D54 A;  5GIP C;  1M90 H;  4O2B B;  2CW4 A;  1VHA A;  1RA4 A;  1J7H A;  3P0Z A;  3J7A R;  3CME F;  4ZHQ B;  4TZZ A;  3V7E A;  4I4T A;  3P4E A;  4C82 A;  5EYP B;  3RYI A;  1Q81 H;  4U39 A;  2UYN A;  3J81 M;  1Q86 H;  4G88 A;  2HRY A;  3WGN A;  4IIJ B;  2VAW A;  1XHO A;  1K73 H;  4YJ2 B;  5IJ9 B;  3LME A;  4G4W A;  3VI6 A;  4EB6 B;  2VAP A;  1OAP A;  3IMP A;  4M8I A;  3HTN A;  1Q82 H;  3N4Z A;  3ZP7 A;  3N2G A;  3ZP4 A;  2ZVZ A;  3D01 A;  5LP6 A;  1TUB B;  2OZB A;  3WGJ A;  5G4V C;  5J2U A;  1PF5 A;  5IT9 M;  5FJ4 C;  3CPW F;  4LCK A;  5LYJ B;  5C8Y A;  2CSL A;  2PHN A;  3NK7 A;  2DYY A;  5EIB D;  4ERH A;  3S03 A;  3JAK A;  3ZOP A;  2I6R A;  2UYK A;  3TD4 A;  5KX5 A;  4O4I A;  2R75 1;  3O85 A;  2GLZ A;  3Q8H A;  5GIO C;  4C81 A;  1Z5W A;  3E22 A;  1U40 A;  3K12 A;  1QU9 A;  5J2T A;  3M1X A;  1W5A A;  2ZF8 A;  3TD5 A;  2JNB A;  4B46 A;  5IYZ B;  3HKD A;  5BMV B;  3JAS B;  4O4H B;  4BVT A;  4B5C A;  3RYH A;  1W3E X;  1T0A A;  3ELC A;  2OTM A;  5HXU A;  2CHT A;  2RHJ A;  1SA0 B;  4F6R B;  2BTQ B;  3KJJ A;  2HS4 A;  3F0F A;  3FPI A;  3G6E F;  4ZI7 A;  4X1Y B;  4ZHY B;  5LA6 B;  4FFB A;  3HKC B;  3TD3 A;  3VO8 A;  3CCS F;  3JAW B;  1GZ0 A;  1RLU A;  4O2A B;  4EI8 A;  1S72 F;  3CYQ A;  3RA6 A;  2HVY D;  2R6R 1;  1KNJ A;  4C8I A;  1VQ8 F;  3L7Q A;  3C9U A;  3NMU C;  4I55 B;  4O4J A;  2IG8 A;  3S02 A;  1JFF B;  3MCQ A;  3JAM M;  2OHW A;  4ZOL B;  3RYF A;  1RLG A;  3K14 A;  1W58 1;  3QTY A;  5MN6 A;  2UYJ A;  1IV3 A;  1IV4 A;  2Z1T A;  1W2B F;  4TV9 A;  5MN5 A;  2ZVY A;  2YYE A;  1CK2 A;  5GAN K;  3VOA A;  1JY8 A;  5JVD B;  3RA5 A;  5CA1 A;  3U0O A;  1TVK A;  3IKE A;  1SDS A;  3F0G A;  4DRX B;  4HNA A;  3IKF A;  5JQG B;  3WGL A;  2YXZ A;  1W5E A;  3LYB A;  5LP6 C;  3K2X A;  4BT5 A;  3RYC B;  4XCQ A;  5ITZ A;  3CC7 F;  3E20 B;  3CC2 F;  5LOV B;  1FFX A;  3G71 F;  3VYS C;  2NMU A;  5GAP K;  1VQO F;  4WBN B;  5GON B;  3N2K B;  3QHD A;  2LBT A;  3VCZ A;  5CA0 B;  4IHJ A;  5KMG A;  1X25 A;  4O4L A;  1KD1 H;  1VQL F;  4TUY A;  3CCJ F;  4B45 A;  3AGK A;  1VH8 A;  2HP3 A;  3WGK A;  5JH7 B;  5CB4 B;  2VXY A;  3WJQ A;  4BT3 A;  3GTZ A;  5EO3 A;  3JAL A;  1ONI A;  3CCV F;  1PXW A;  3WPX A;  3DDN A;  5LXT B;  1QAH A;  2IQQ A;  1K9M H;  3VYU C;  1FNK A;  1VQ9 F;  4G4V A;  1YI2 F;  3BYQ A;  1GO1 A;  1VQ4 F;  3JAR A;  3JAT A;  4TV8 B;  3F0E A;  4BT6 A;  4I50 B;  2Z01 A;  5EAZ A;  1X52 A;  3I3F A;  4ZK7 A;  2HRU A;  3CCE F;  3C8L A;  4RHA A;  2AIZ P;  2CHS A;  3HKE B;  1NQ3 A;  3LWR C;  2UZH A;  3EOR A;  3VYT C;  4BVS A;  4X3L A;  5JCO A;  4YJ3 B;  3V3T A;  3N4Y A;  3CCL F;  3CYP B;  3HKB B;  3OBW A;  2KGW A;  3ERN A;  3C9S A;  3S06 A;  2BTO A;  1W40 A;  4X20 B;  5IJ0 B;  2H8E A;  5HY2 A;  1W41 A;  4U3J B;  4O2B A;  3GHZ A;  5EZY B;  1H7M A;  2LBW A;  2Q1Y A;  1U3L A;  3IR9 A;  4LNU B;  2K1S A;  2HS3 A;  4ZHQ A;  1U3P A;  4B62 A;  2EWC A;  4X1I B;  5EYP A;  5FNV B;  1YHQ F;  1W55 A;  2CWJ A;  3JVH A;  3HAX D;  1K8A H;  2LCA A;  2KTV A;  1VQV A;  2H6L A;  4IIJ A;  1VQ6 F;  5HY4 A;  2IAF A;  4DXD A;  1VK3 A;  2FGY A;  4YJ2 A;  3F0D A;  5IJ9 A;  1DBF A;  3CCQ F;  3QUW A;  4X1K B;  4EB6 A;  5EB1 B;  3I55 F;  3OBY A;  3UT5 B;  2CZW A;  3E1Y A;  1VQ7 F;  1VQM F;  2GZL A;  1TUB A;  1YQN A;  3MBM A;  4NUT A;  3G4S F;  2HP0 B;  2OTJ F;  1X7P A;  1YGY A;  5EWR A;  3ON1 A;  1QVG F;  2LBX A;  3IEQ A;  5LYJ A;  3D00 A;  1NJI H;  3WJP A;  4BT2 A;  4G4X A;  1X7O A;  3M4S A;  3WJR A;  4I4T B;  4C4W C;  1YJ9 F;  3RYI B;  2P6Y A;  2RHH A;  2UYN B;  2HS0 A;  1JD1 A;  4G4Z A;  5EIB C;  2V9Y A;  4BY9 D;  2OTL F;  1W5F A;  1ZWZ A;  1IPA A;  3LWV C;  1W57 A;  5IYZ A;  2ALE A;  3K0T A;  4BT4 A;  5BMV A;  3GYQ A;  3JAS A;  2ZOV A;  4O4H A;  1YIT F;  1YIJ F;  2BTU A;  5JCO C;  3N2G B;  3I7T A;  5LP6 B;  1UI9 A;  3WGM A;  1SA0 A;  1UFY A;  2VGN A;  4F6R A;  3I56 F;  5J2U B;  1IV1 A;  4X1Y A;  5HWE A;  4BVQ A;  1GX1 A;  5LA6 A;  1VQK F;  5C8Y B;  2GVI A;  1FNJ A;  1SZQ A;  3HKC A;  1KQS F;  2FC3 A;  3V4D A;  2HQS C;  3JAW A;  4O2A A;  1GO0 A;  3JAK B;  3V7Q A;  2KTU A;  2RB9 A;  5KX5 B;  4O4I B;  2QA4 F;  1CLI A;  1FSZ A;  3CB2 A;  5HY0 A;  3E22 B;  2VAM A;  3WXM B;  4I55 A;  1M1K H;  3NVK E;  5J2T B;  1JFF A;  3CG6 A;  4NQ3 A;  4ZOL A;  1VQP F;  2PMP A;  3OON A;  2Z1E A;  3LWP C;  1Q8R A;  3FBA A;  1N8R H;  3HKD B;  2ZOD A;  3LWO C;  3CMA F;  4EI9 A;  3HJW C;  3SIU A;  2QI2 A;  3MQW A;  3SIV A;  5FLX M;  5JVD A;  3RYH B;  2B33 A;  2QTP A;  3WPW A;  3OW2 F;  1W5B A;  1RQ2 A;  1XBI A;  4DRX A;  5MN4 A;  5HY1 A;  1RQ7 A;  1COM A;  5JQG A;  3S0H A;  5AVM A;  4BW0 B;  4ZI7 B;  4NWO B;  1OFU A;  3CCU F;  3RYC A;  4FFB B;  4X3M A;  3KIZ A;  3NVI B;  1T0K B;  3LFO A;  1Q7Y H;  5LOV A;  2HX0 A;  3MDO A;  3RE3 A;  4WBN A;  2UYP A;  5GON A;  2Z1F A;  1U43 A;  3N2K A;  5CA0 A;  3KE1 A;  1XV2 A;  4O4J B;  3KHN A;  1QVF F;  2RHO A;  3PAF A;  3RYF B;  3S0Y A;  5JH7 A;  4RQO A;  5CB4 A;  1CN7 A;  4TV9 B;  1W59 A;  2AIF A;  5LXT A;  3M84 A;  4G4Y A;  5HP7 A;  2I6D A;  2KG4 A;  3ZO8 A;  5CA1 B;  1TVK B;  3CD6 F;  3P10 A;  3CXC F;  5B8F A;  1W42 A;  4C8E A;  4HNA B;  4TV8 A;  4ZHV A;  1R1M A;  3FD5 A;  4I50 A;  3PLA C;  1JN1 A;  1VQ5 F;  3S0W A;  3HKE A;  2MQE A;  3VOB A;  3C9R A;  5ITZ B;  3CCM F;  1VQN F;  4BT7 A;  1FFX B;  2ZAU A;  1E7K A;  2VGM A;  5A2Q M;  1KNK A;  4YJ3 A;  2Z1U A;  3FD6 A;  3HKB A;  5KMG B;  2G9I A;  4IHJ B;  4O4L B;  4EI7 A;  2H8C A;  2BO1 A;  4BVR A;  3MCA B;  3HWU A;  4X20 A;  5HP8 A;  4KWE A;  4TUY B;  5IJ0 A;  5G4U C;  3C9T A;  1H47 A;  3KJK A;  1QD9 A;  4U3J A;  4R40 B; 
#chains in the Genus database with same CATH homology
 4BVQ A;  3LWR C;  1VQK F;  2JNB A;  4BVS A;  1KQS F;  3NK6 A;  2FC3 A;  4X3L A;  1NMU B;  2F9Z C;  1GO0 A;  3V3T A;  5GIN C;  3N4Y A;  2KTU A;  3V7Q A;  3VMF B;  4BVT A;  3CCL F;  3CC4 F;  3OBW A;  3JCM M;  1W3E X;  2QA4 F;  5DCV A;  5HXU A;  5HY0 A;  1W40 A;  3CPQ A;  3WXM B;  1M1K H;  3NVK E;  5HY2 A;  3CG6 A;  1DT9 A;  4NQ3 A;  1KC8 H;  1VQP F;  1W41 A;  3G6E F;  1YJN F;  3LWP C;  2WAL A;  3FFM A;  1H7M A;  2LBW A;  3IR9 A;  1N8R H;  3LWO C;  3CCR F;  3CMA F;  4EI9 A;  1GZ0 A;  3CCS F;  2QI2 A;  3HJW C;  3SIU A;  3J80 M;  4EI8 A;  1S72 F;  3RA6 A;  5FLX M;  2HVY D;  3SIV A;  1YHQ F;  2QEX F;  1VQ8 F;  3OW2 F;  1XBI A;  3HAX D;  1K8A H;  3NMU C;  5HXZ A;  5HY1 A;  2KTV A;  1JJ2 F;  1YJW F;  1VQ6 F;  3LWQ C;  3JAM M;  2OHW A;  5HY4 A;  5GIP C;  1M90 H;  2FGY A;  1RLG A;  4BW0 B;  3CCU F;  1RA4 A;  4X3M A;  3CCQ F;  3NVI B;  1W2B F;  1T0K B;  3J7A R;  3CME F;  3LFO A;  1Q7Y H;  3I55 F;  4TZZ A;  3V7E A;  1CK2 A;  5GAN K;  3OBY A;  1Q81 H;  3RA5 A;  2CZW A;  3E1Y A;  1SDS A;  1VQ7 F;  3J81 M;  1VQM F;  1Q86 H;  4NUT A;  3G4S F;  1QVF F;  2OTJ F;  1X7P A;  5EWR A;  3PAF A;  3ON1 A;  1K73 H;  1QVG F;  2LBX A;  4XCQ A;  1CN7 A;  3D00 A;  1NJI H;  3CC7 F;  3E20 B;  3VI6 A;  3CC2 F;  1X7O A;  2AIF A;  3G71 F;  5GAP K;  1VQO F;  1Q82 H;  2I6D A;  1YJ9 F;  4C4W C;  2KG4 A;  3N4Z A;  3CD6 F;  3CXC F;  1KD1 H;  1W42 A;  1VQL F;  3CCJ F;  2OZB A;  4BY9 D;  3PLA C;  5G4V C;  3AGK A;  2OTL F;  1VQ5 F;  5IT9 M;  5FJ4 C;  3CPW F;  1ZWZ A;  4LCK A;  1IPA A;  3LWV C;  3CCM F;  3NK7 A;  5EO3 A;  3CCV F;  1VQN F;  2ALE A;  1PXW A;  3GYQ A;  1E7K A;  2VGM A;  5A2Q M;  1K9M H;  1YIT F;  1VQ9 F;  1YI2 F;  1YIJ F;  1GO1 A;  3O85 A;  2GLZ A;  4EI7 A;  1VQ4 F;  2BO1 A;  4BVR A;  5GIO C;  3MCA B;  2VGN A;  3I56 F;  5G4U C;  1X52 A;  3CCE F;  5HWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...