3J7AR

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
98
Chain Sequence
b'VTAIQKVIKNAHVHDGLKIGIREVIKSIESQEAKVCFLSDVCSEPAYKKLITTLCAEMVQNDSKDLGHWAGLFIIGASSVAVVDFGEDSAEKDFLLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
molecule tags Ribosome/inhibitor
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 22
structure length 98
sequence length 114
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3j7aR00
1VQKF 1YI2F 3G6EF 3G4SF 3LFOA 2QA4F 1T0KB 1DT9A 5GINC 3CC2F 3CCVF 1W41A 5FJ4C 3CXCF 3N4YA 2BO1A 1VQMF 1W2BF 1K73H 4C4WC 3LWPC 3NMUC 5A2QM 3CCUF 3LWOC 3GYQA 3NK6A 3I55F 3LWVC 3E20B 1YJ9F 2KG4A 1YIJF 1M1KH 5GANK 5GIPC 4X3LA 1NJIH 2OHWA 2VGMA 2AIFA 3CCQF 2I6DA 1KD1H 2OTLF 3PLAC 5G4UC 1VQPF 2WALA 1Q81H 3SIVA 1W40A 3CD6F 3HJWC 2ALEA 3NVIB 3LWQC 3IR9A 3CMEF 1GZ0A 2FC3A 3LWRC 1X7PA 3CMAF 1SDSA 2CZWA 3V7EA 2VGNA 3J81M 1JJ2F 1W42A 2JNBA 5EWRA 1VQ4F 1YJNF 1S72F 1VQ6F 4BY9D 3WXMB 1Q82H 3CCJF 1VQ5F 3SIUA 5GAPK 1QVGF 1CK2A 3JAMM 1IPAA 1YJWF 4NUTA 1M90H 1VQ9F 4X3MA 1VQLF 1Q86H 1XBIA 5G4VC 3CC4F 1GO0A 3OBWA 1KQSF 2QEXF 1GO1A 1K8AH 3VMFB 5IT9M 3V7QA 1W3EX 1ZWZA 4LCKA 3MCAB 3RA6A 1VQOF 3G71F 2LBXA 3NVKE 1RA4A 1E7KA 1X7OA 1Q7YH 3I56F 1YHQF 3VI6A 3CCMF 2KTUA 3O85A 3ON1A 5FLXM 3CCEF 1K9MH 3RA5A 3N4ZA 5EO3A 1N8RH 1NMUB 1RLGA 3CG6A 3J7AR 4BW0B 1YITF 2OZBA 3CCLF 3HAXD 5DCVA 3AGKA 2KTVA 4TZZA 3CPQA 1VQ8F 1QVFF 1X52A 3PAFA 2HVYD 3OW2F 1VQNF 3CCSF 1H7MA 3J80M 3OBYA 2QI2A 1PXWA 1KC8H 3CC7F 3CCRF 2OTJF 3CPWF 1VQ7F 1CN7A 3E1YA 2LBWA 5GIOC 3JCMM 3FFMA 3NK7A
chains in the Genus database with same CATH superfamily
1GX1A 5LOVA 1KNKA 3G4SF 3LFOA 4ZHQB 5GINC 2YXZA 5B8FA 3N4YA 1W2BF 4ZOLA 3LWPC 3NMUC 3CCUF 3LDTA 1OAPA 4X20B 5CA1B 4ERHA 2KG4A 4I50A 4O2BB 4NQ3A 2OTMA 5GANK 3KJJA 4B5CA 3FD5A 3RYIA 2UZHA 3CCQF 3QHDA 5JH7B 3PLAC 3HKDA 5JQGB 1W40A 2Z1UA 5LP6A 3HJWC 1UFYA 3JAKA 3IR9A 2Z1EA 3HKCB 1W57A 3JARA 3CMAF 5EIBC 2PHNA 5LYJA 2VGNA 1JJ2F 1W42A 4R40B 3M1XA 1H48A 5EWRA 3VOBA 1NQ3A 1YJNF 1W55A 4DRXA 4BT2A 3VTIC 2V9YA 2BTOA 2RHHA 5HY1A 1W5AA 1CK2A 4BT6A 3JAMM 1IPAA 5KMGA 5IJ0A 4U39A 4ZI7B 4X3MA 4ZI7A 4C8EA 3VOAA 3WGNA 5J2TA 4IIJB 2RHLA 3VO8A 1GO0A 1XHOA 1PF5A 4G4VA 3TD4A 5GONB 5HY2A 3V7QA 1IV3A 1QAHA 3RA6A 1JD1A 1ONIA 4G4WA 5EZYB 3NVKE 3K14A 3RYFA 5LYJB 3VI6A 3CCMF 5FLXM 4O4JB 3CCEF 5FNVB 2HX0A 2UYPA 3N4ZA 1U3LA 5LP6C 3HKDB 5JQGA 4YJ3B 4O4IA 3J7AR 1YITF 3HAXD 5C8YB 2YYEA 1JFFA 3F0DA 1FFXB 1X52A 4X1KA 4X1YA 2Q1YA 1DBFA 4ZHVA 3BYQA 3J80M 2QI2A 1KC8H 5AVMA 1J7HA 3CCRF 3QUWA 2K1SA 2Z1TA 1VQ7F 1CN7A 1QU9A 4ZHYB 4U3JB 3KJKA 4RHAA 4O2AB 3JALA 2BTQB 1VQKF 3S0HA 2H8CA 3RE3A 4FFBA 2QA4F 1T0KB 1R1MA 1DT9A 2IQQA 2Z1FA 3FD6A 4ZK7A 3HKCA 2HP0B 3HWUA 1VQMF 1VH8A 5LXTB 2HS3A 2H8EA 3LWOC 1TUBA 3VYTC 5HXZA 3L7QA 4B46A 3E20B 4O2AA 2P6YA 3IEWA 4I55B 2G9IA 3V3TA 5IYZB 1Z5VA 1VQPF 2ZF8A 5HWEA 5KX5A 1CLIA 3HTNA 3CD6F 2ALEA 3LWQC 1GZ0A 4G4ZA 2F9ZC 4LNUA 3LWRC 1SDSA 3V7EA 4I4TA 1IV1A 2VAPA 3J81M 3ZP7A 2ZVYA 3JALB 2ZOVA 1S72F 3HKBB 4O4HA 5J2UB 2DT4A 5MN5A 3IKEA 5HY4A 4XCQA 3CCJF 2NMUA 3JAWA 1ODEA 1QVGF 3SIUA 2HQSC 1YJWF 5JVDA 1U40A 3HKBA 3KE1A 4O4HB 1VQLF 2W8BC 5G4VC 1JN1A 4G4XA 4ZHQA 1FSZA 3UT5A 4BVQA 4I55A 2KGWA 3D01A 4O4LB 1TVKA 1ZWZA 1RQ2A 3ZOPA 1VQOF 2RB9A 3G71F 3P0ZA 3MDOA 1RA4A 3E22A 5MN6A 1Q7YH 1KNJA 3I56F 1YHQF 1IV4A 2QTPA 3ON1A 1YQNA 5JCOA 4DRXB 1K9MH 3RA5A 3ERNA 3K2XA 4DXDA 2BTUA 5IYZA 1SA0B 3VCZA 2Z01A 5EO3A 5HY0A 5J2UA 3LYBA 3U0OA 4BVSA 3IMPA 1RLGA 4U3JA 4BT5A 3CCLF 5LXTA 4X1IB 3CPQA 1VQ8F 3I7TA 1QVFF 3VYUC 3S02A 4F6RB 4IHJA 2LBTA 5IJ0B 3S0YA 5ITZA 2N48A 3CB2A 3CPWF 3WJRA 3S03A 1SA0A 3F6MA 5HP8A 2LBWA 3JCMM 3UT5B 1FNKA 5ITZB 3LMEA 1YI2F 5J2TB 5FNVA 3WPXA 3VYSC 3WJPA 4EB6A 3JVHA 5EAZA 5JVDB 4F6RA 3CC2F 1W41A 3CCVF 2HP0A 1Q8RA 3CXCF 5FJ4C 2BO1A 4O4LA 1K73H 3M4SA 2CSLA 3CYPB 3NK6A 4FFBB 3I55F 2L26A 3IKFA 3WGJA 4C82A 1YIJF 1M1KH 2CWJA 1COMA 5GIPC 2OHWA 2AIFA 2HRUA 2ZODA 2I6DA 4LNUB 1KD1H 5CA1A 5G4UC 1Q81H 3SIVA 3DC2A 3P4EA 3RYHB 3C8LA 3R0PA 3CMEF 2GZLA 3HKEB 5CA0A 2CZWA 3T80A 3GHZA 1VQVA 2EWCA 3OONA 1TUBB 4X20A 3S06A 4WBNA 4ZHWA 2CHTA 5CB4B 2CW4A 3WXMB 4X1KB 1VQ5F 3JAWB 3K12A 2CVLA 1W5EA 3JAKB 5GAPK 4NUTA 3KIZA 3S0WA 1X25A 2HS4A 2I6RA 4NWOB 1Q86H 3N2KA 1U43A 4YJ3A 3CC4F 3OBWA 1W581 1H47A 1Z5WA 2VAWA 2HRYA 3VMFB 5IT9M 1FNJA 5GONA 2HP3A 3JARB 4B62A 3C9SA 2MQEA 4IIJA 2LBXA 1X7OA 5HXUA 3B6NA 3EORA 3O85A 2R6R1 3RYCB 3MBMA 5EB1B 1RLUA 3D00A 3DDNA 4G88A 3RYIB 5IJ9A 1JFFB 3V4DA 3M84A 4TUYB 4EI8A 1NMUB 4O4IB 3CG6A 2UYNA 4HNAB 4TV9B 3ZP4A 1W5FA 5DCVA 2FGYA 3AGKA 2KTVA 4TZZA 1RQ7A 1FFXA 3PAFA 3OW2F 1H7MA 3FBAA 1W5BA 5EB0A 2UYKA 5EZYA 5LOVB 5JH7A 5LA6B 5EYPB 3K0TA 3N2GB 4EI7A 4I4TB 4M8IA 4BT7A 4EB6B 2RHOA 4HNAA 5GIOC 4O4JA 3FFMA 3WGLA 3P10A 1JY8A 4C81A 4TUYA 3G6EF 2ZAUA 5BMVA 3CYQA 5LP6B 1XRGA 3C9RA 1SZQA 4X1YB 2GLZA 3TD3A 4BT3A 1XV2A 4C4WC 3MCQA 5A2QM 1VK3A 4YJ2A 3JASA 5MN4A 3GYQA 3ELCA 3LWVC 1YJ9F 2VXYA 4PWTA 4B45A 4TV8B 4X3LA 4WBNB 5HP7A 5KMGB 2VGMA 5LA6A 1NJIH 2OTLF 2VAMA 2WALA 3C9TA 3D54A 4C8IA 3NVIB 1IV2A 4E6EA 3HKEA 2FC3A 1X7PA 3KHNA 3JATA 3IEQA 3VIUA 3WPWA 4O2BA 3WGKA 3WJQA 4I50B 2ZVZA 2JNBA 1VQ4F 1T0AA 2R751 5IJ9B 1TVKB 3JATB 3ZO8A 1VQ6F 4YJ2B 5EYPA 4BY9D 1Q82H 2IAFA 2AMTA 4G4YA 5EIBD 2UYJA 1M90H 5C8YA 1YGYA 1VQ9F 4BVRA 2CHSA 2Q1XA 2GVIA 4IHJB 1XBIA 4X1IA 4EI9A 1KQSF 2QEXF 1GO1A 1K8AH 4TV9A 2RHJA 3QTYA 1UI9A 1W3EX 2DYYA 4LCKA 3MCAB 3N2GA 1E7KA 3RYFB 1OFUA 1U3PA 2KTUA 3TD5A 4KWEA 3I3FA 3RYHA 5BMVB 3WGMA 2B33A 2LCAA 3E22B 1N8RH 5KX5B 3ESJA 3MQWA 2H6LA 4BT4A 1W59A 2HS0A 4BW0B 3F0EA 2OZBA 5JCOC 4C8GA 3F0GA 3JASB 5CA0B 4ZOLB 2IG8A 1QD9A 3Q8HA 4RQOA 3N2KB 2HVYD 1VQNF 2AIZP 3RYCA 3CCSF 2PMPA 3OBYA 3F0FA 1PXWA 3CC7F 2OTJF 1VHAA 5CB4A 3FPIA 3C9UA 3E1YA 2UYNB 4BVTA 3GTZA 4TV8A 3NK7A
chains in the Genus database with same CATH topology
1VQKF 1YI2F 3G6EF 2GLZA 3LFOA 3G4SF 2QA4F 1T0KB 1DT9A 5GINC 3CC2F 3CCVF 1W41A 5FJ4C 3CXCF 3N4YA 2BO1A 1VQMF 1W2BF 1K73H 4C4WC 3LWPC 3NMUC 5A2QM 3CCUF 3LWOC 3GYQA 3NK6A 5HXZA 3I55F 3LWVC 3E20B 1YJ9F 2KG4A 4NQ3A 3V3TA 1YIJF 1M1KH 5GANK 5GIPC 4X3LA 1NJIH 2OHWA 2VGMA 2AIFA 3CCQF 2I6DA 1KD1H 2OTLF 3PLAC 5G4UC 1VQPF 2WALA 1Q81H 5HWEA 3SIVA 1W40A 3CD6F 3HJWC 2ALEA 3NVIB 3LWQC 3IR9A 3CMEF 1GZ0A 2FC3A 3LWRC 2F9ZC 1X7PA 3CMAF 1SDSA 2CZWA 3V7EA 2VGNA 3J81M 1JJ2F 1W42A 2JNBA 5EWRA 1VQ4F 1YJNF 1S72F 1VQ6F 4BY9D 3WXMB 5HY4A 4XCQA 1Q82H 3CCJF 1VQ5F 3SIUA 5HY1A 5GAPK 1QVGF 1CK2A 3JAMM 1IPAA 1YJWF 4NUTA 1M90H 1VQ9F 4BVRA 4X3MA 1VQLF 1Q86H 1XBIA 5G4VC 3CC4F 1GO0A 3OBWA 4EI9A 2QEXF 1KQSF 1GO1A 1K8AH 3VMFB 4BVQA 5IT9M 5HY2A 3V7QA 1W3EX 1ZWZA 4LCKA 3MCAB 3RA6A 1VQOF 3G71F 2LBXA 3NVKE 1RA4A 1E7KA 1X7OA 5HXUA 1Q7YH 3I56F 1YHQF 3VI6A 3CCMF 2KTUA 3O85A 3ON1A 5FLXM 3D00A 3CCEF 1K9MH 3RA5A 3N4ZA 5EO3A 5HY0A 1N8RH 4EI8A 4BVSA 1NMUB 1RLGA 3CG6A 3J7AR 4BW0B 1YITF 2OZBA 3CCLF 3HAXD 5DCVA 2FGYA 3AGKA 2KTVA 4TZZA 3CPQA 1VQ8F 1QVFF 1X52A 3PAFA 2HVYD 3OW2F 1VQNF 3CCSF 1H7MA 3J80M 3OBYA 2QI2A 1PXWA 1KC8H 3CC7F 3CCRF 2OTJF 3CPWF 4EI7A 1VQ7F 1CN7A 3E1YA 2LBWA 4BVTA 5GIOC 3JCMM 3FFMA 3NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK F;  1YI2 F;  3G6E F;  3G4S F;  3LFO A;  2QA4 F;  1T0K B;  1DT9 A;  5GIN C;  3CC2 F;  3CCV F;  1W41 A;  5FJ4 C;  3CXC F;  3N4Y A;  2BO1 A;  1VQM F;  1W2B F;  1K73 H;  4C4W C;  3LWP C;  3NMU C;  5A2Q M;  3CCU F;  3LWO C;  3GYQ A;  3NK6 A;  3I55 F;  3LWV C;  3E20 B;  1YJ9 F;  2KG4 A;  1YIJ F;  1M1K H;  5GAN K;  5GIP C;  4X3L A;  1NJI H;  2OHW A;  2VGM A;  2AIF A;  3CCQ F;  2I6D A;  1KD1 H;  2OTL F;  3PLA C;  5G4U C;  1VQP F;  2WAL A;  1Q81 H;  3SIV A;  1W40 A;  3CD6 F;  3HJW C;  2ALE A;  3NVI B;  3LWQ C;  3IR9 A;  3CME F;  1GZ0 A;  2FC3 A;  3LWR C;  1X7P A;  3CMA F;  1SDS A;  2CZW A;  3V7E A;  2VGN A;  3J81 M;  1JJ2 F;  1W42 A;  2JNB A;  5EWR A;  1VQ4 F;  1YJN F;  1S72 F;  1VQ6 F;  4BY9 D;  3WXM B;  1Q82 H;  3CCJ F;  1VQ5 F;  3SIU A;  5GAP K;  1QVG F;  1CK2 A;  3JAM M;  1IPA A;  1YJW F;  4NUT A;  1M90 H;  1VQ9 F;  4X3M A;  1VQL F;  1Q86 H;  1XBI A;  5G4V C;  3CC4 F;  1GO0 A;  3OBW A;  1KQS F;  2QEX F;  1GO1 A;  1K8A H;  3VMF B;  5IT9 M;  3V7Q A;  1W3E X;  1ZWZ A;  4LCK A;  3MCA B;  3RA6 A;  1VQO F;  3G71 F;  2LBX A;  3NVK E;  1RA4 A;  1E7K A;  1X7O A;  1Q7Y H;  3I56 F;  1YHQ F;  3VI6 A;  3CCM F;  2KTU A;  3O85 A;  3ON1 A;  5FLX M;  3CCE F;  1K9M H;  3RA5 A;  3N4Z A;  5EO3 A;  1N8R H;  1NMU B;  1RLG A;  3CG6 A;  3J7A R;  4BW0 B;  1YIT F;  2OZB A;  3CCL F;  3HAX D;  5DCV A;  3AGK A;  2KTV A;  4TZZ A;  3CPQ A;  1VQ8 F;  1QVF F;  1X52 A;  3PAF A;  2HVY D;  3OW2 F;  1VQN F;  3CCS F;  1H7M A;  3J80 M;  3OBY A;  2QI2 A;  1PXW A;  1KC8 H;  3CC7 F;  3CCR F;  2OTJ F;  3CPW F;  1VQ7 F;  1CN7 A;  3E1Y A;  2LBW A;  5GIO C;  3JCM M;  3FFM A;  3NK7 A; 
#chains in the Genus database with same CATH topology
 1GX1 A;  5LOV A;  1KNK A;  3G4S F;  3LFO A;  4ZHQ B;  5GIN C;  2YXZ A;  5B8F A;  3N4Y A;  1W2B F;  4ZOL A;  3LWP C;  3NMU C;  3CCU F;  3LDT A;  1OAP A;  4X20 B;  5CA1 B;  4ERH A;  2KG4 A;  4I50 A;  4O2B B;  4NQ3 A;  2OTM A;  5GAN K;  3KJJ A;  4B5C A;  3FD5 A;  3RYI A;  2UZH A;  3CCQ F;  3QHD A;  5JH7 B;  3PLA C;  3HKD A;  5JQG B;  1W40 A;  2Z1U A;  5LP6 A;  3HJW C;  1UFY A;  3JAK A;  3IR9 A;  2Z1E A;  3HKC B;  1W57 A;  3JAR A;  3CMA F;  5EIB C;  2PHN A;  5LYJ A;  2VGN A;  1JJ2 F;  1W42 A;  4R40 B;  3M1X A;  1H48 A;  5EWR A;  3VOB A;  1NQ3 A;  1YJN F;  1W55 A;  4DRX A;  4BT2 A;  3VTI C;  2V9Y A;  2BTO A;  2RHH A;  5HY1 A;  1W5A A;  1CK2 A;  4BT6 A;  3JAM M;  1IPA A;  5KMG A;  5IJ0 A;  4U39 A;  4ZI7 B;  4X3M A;  4ZI7 A;  4C8E A;  3VOA A;  3WGN A;  5J2T A;  4IIJ B;  2RHL A;  3VO8 A;  1GO0 A;  1XHO A;  1PF5 A;  4G4V A;  3TD4 A;  5GON B;  5HY2 A;  3V7Q A;  1IV3 A;  1QAH A;  3RA6 A;  1JD1 A;  1ONI A;  4G4W A;  5EZY B;  3NVK E;  3K14 A;  3RYF A;  5LYJ B;  3VI6 A;  3CCM F;  5FLX M;  4O4J B;  3CCE F;  5FNV B;  2HX0 A;  2UYP A;  3N4Z A;  1U3L A;  5LP6 C;  3HKD B;  5JQG A;  4YJ3 B;  4O4I A;  3J7A R;  1YIT F;  3HAX D;  5C8Y B;  2YYE A;  1JFF A;  3F0D A;  1FFX B;  1X52 A;  4X1K A;  4X1Y A;  2Q1Y A;  1DBF A;  4ZHV A;  3BYQ A;  3J80 M;  2QI2 A;  1KC8 H;  5AVM A;  1J7H A;  3CCR F;  3QUW A;  2K1S A;  2Z1T A;  1VQ7 F;  1CN7 A;  1QU9 A;  4ZHY B;  4U3J B;  3KJK A;  4RHA A;  4O2A B;  3JAL A;  2BTQ B;  1VQK F;  3S0H A;  2H8C A;  3RE3 A;  4FFB A;  2QA4 F;  1T0K B;  1R1M A;  1DT9 A;  2IQQ A;  2Z1F A;  3FD6 A;  4ZK7 A;  3HKC A;  2HP0 B;  3HWU A;  1VQM F;  1VH8 A;  5LXT B;  2HS3 A;  2H8E A;  3LWO C;  1TUB A;  3VYT C;  5HXZ A;  3L7Q A;  4B46 A;  3E20 B;  4O2A A;  2P6Y A;  3IEW A;  4I55 B;  2G9I A;  3V3T A;  5IYZ B;  1Z5V A;  1VQP F;  2ZF8 A;  5HWE A;  5KX5 A;  1CLI A;  3HTN A;  3CD6 F;  2ALE A;  3LWQ C;  1GZ0 A;  4G4Z A;  2F9Z C;  4LNU A;  3LWR C;  1SDS A;  3V7E A;  4I4T A;  1IV1 A;  2VAP A;  3J81 M;  3ZP7 A;  2ZVY A;  3JAL B;  2ZOV A;  1S72 F;  3HKB B;  4O4H A;  5J2U B;  2DT4 A;  5MN5 A;  3IKE A;  5HY4 A;  4XCQ A;  3CCJ F;  2NMU A;  3JAW A;  1ODE A;  1QVG F;  3SIU A;  2HQS C;  1YJW F;  5JVD A;  1U40 A;  3HKB A;  3KE1 A;  4O4H B;  1VQL F;  2W8B C;  5G4V C;  1JN1 A;  4G4X A;  4ZHQ A;  1FSZ A;  3UT5 A;  4BVQ A;  4I55 A;  2KGW A;  3D01 A;  4O4L B;  1TVK A;  1ZWZ A;  1RQ2 A;  3ZOP A;  1VQO F;  2RB9 A;  3G71 F;  3P0Z A;  3MDO A;  1RA4 A;  3E22 A;  5MN6 A;  1Q7Y H;  1KNJ A;  3I56 F;  1YHQ F;  1IV4 A;  2QTP A;  3ON1 A;  1YQN A;  5JCO A;  4DRX B;  1K9M H;  3RA5 A;  3ERN A;  3K2X A;  4DXD A;  2BTU A;  5IYZ A;  1SA0 B;  3VCZ A;  2Z01 A;  5EO3 A;  5HY0 A;  5J2U A;  3LYB A;  3U0O A;  4BVS A;  3IMP A;  1RLG A;  4U3J A;  4BT5 A;  3CCL F;  5LXT A;  4X1I B;  3CPQ A;  1VQ8 F;  3I7T A;  1QVF F;  3VYU C;  3S02 A;  4F6R B;  4IHJ A;  2LBT A;  5IJ0 B;  3S0Y A;  5ITZ A;  2N48 A;  3CB2 A;  3CPW F;  3WJR A;  3S03 A;  1SA0 A;  3F6M A;  5HP8 A;  2LBW A;  3JCM M;  3UT5 B;  1FNK A;  5ITZ B;  3LME A;  1YI2 F;  5J2T B;  5FNV A;  3WPX A;  3VYS C;  3WJP A;  4EB6 A;  3JVH A;  5EAZ A;  5JVD B;  4F6R A;  3CC2 F;  1W41 A;  3CCV F;  2HP0 A;  1Q8R A;  3CXC F;  5FJ4 C;  2BO1 A;  4O4L A;  1K73 H;  3M4S A;  2CSL A;  3CYP B;  3NK6 A;  4FFB B;  3I55 F;  2L26 A;  3IKF A;  3WGJ A;  4C82 A;  1YIJ F;  1M1K H;  2CWJ A;  1COM A;  5GIP C;  2OHW A;  2AIF A;  2HRU A;  2ZOD A;  2I6D A;  4LNU B;  1KD1 H;  5CA1 A;  5G4U C;  1Q81 H;  3SIV A;  3DC2 A;  3P4E A;  3RYH B;  3C8L A;  3R0P A;  3CME F;  2GZL A;  3HKE B;  5CA0 A;  2CZW A;  3T80 A;  3GHZ A;  1VQV A;  2EWC A;  3OON A;  1TUB B;  4X20 A;  3S06 A;  4WBN A;  4ZHW A;  2CHT A;  5CB4 B;  2CW4 A;  3WXM B;  4X1K B;  1VQ5 F;  3JAW B;  3K12 A;  2CVL A;  1W5E A;  3JAK B;  5GAP K;  4NUT A;  3KIZ A;  3S0W A;  1X25 A;  2HS4 A;  2I6R A;  4NWO B;  1Q86 H;  3N2K A;  1U43 A;  4YJ3 A;  3CC4 F;  3OBW A;  1W58 1;  1H47 A;  1Z5W A;  2VAW A;  2HRY A;  3VMF B;  5IT9 M;  1FNJ A;  5GON A;  2HP3 A;  3JAR B;  4B62 A;  3C9S A;  2MQE A;  4IIJ A;  2LBX A;  1X7O A;  5HXU A;  3B6N A;  3EOR A;  3O85 A;  2R6R 1;  3RYC B;  3MBM A;  5EB1 B;  1RLU A;  3D00 A;  3DDN A;  4G88 A;  3RYI B;  5IJ9 A;  1JFF B;  3V4D A;  3M84 A;  4TUY B;  4EI8 A;  1NMU B;  4O4I B;  3CG6 A;  2UYN A;  4HNA B;  4TV9 B;  3ZP4 A;  1W5F A;  5DCV A;  2FGY A;  3AGK A;  2KTV A;  4TZZ A;  1RQ7 A;  1FFX A;  3PAF A;  3OW2 F;  1H7M A;  3FBA A;  1W5B A;  5EB0 A;  2UYK A;  5EZY A;  5LOV B;  5JH7 A;  5LA6 B;  5EYP B;  3K0T A;  3N2G B;  4EI7 A;  4I4T B;  4M8I A;  4BT7 A;  4EB6 B;  2RHO A;  4HNA A;  5GIO C;  4O4J A;  3FFM A;  3WGL A;  3P10 A;  1JY8 A;  4C81 A;  4TUY A;  3G6E F;  2ZAU A;  5BMV A;  3CYQ A;  5LP6 B;  1XRG A;  3C9R A;  1SZQ A;  4X1Y B;  2GLZ A;  3TD3 A;  4BT3 A;  1XV2 A;  4C4W C;  3MCQ A;  5A2Q M;  1VK3 A;  4YJ2 A;  3JAS A;  5MN4 A;  3GYQ A;  3ELC A;  3LWV C;  1YJ9 F;  2VXY A;  4PWT A;  4B45 A;  4TV8 B;  4X3L A;  4WBN B;  5HP7 A;  5KMG B;  2VGM A;  5LA6 A;  1NJI H;  2OTL F;  2VAM A;  2WAL A;  3C9T A;  3D54 A;  4C8I A;  3NVI B;  1IV2 A;  4E6E A;  3HKE A;  2FC3 A;  1X7P A;  3KHN A;  3JAT A;  3IEQ A;  3VIU A;  3WPW A;  4O2B A;  3WGK A;  3WJQ A;  4I50 B;  2ZVZ A;  2JNB A;  1VQ4 F;  1T0A A;  2R75 1;  5IJ9 B;  1TVK B;  3JAT B;  3ZO8 A;  1VQ6 F;  4YJ2 B;  5EYP A;  4BY9 D;  1Q82 H;  2IAF A;  2AMT A;  4G4Y A;  5EIB D;  2UYJ A;  1M90 H;  5C8Y A;  1YGY A;  1VQ9 F;  4BVR A;  2CHS A;  2Q1X A;  2GVI A;  4IHJ B;  1XBI A;  4X1I A;  4EI9 A;  1KQS F;  2QEX F;  1GO1 A;  1K8A H;  4TV9 A;  2RHJ A;  3QTY A;  1UI9 A;  1W3E X;  2DYY A;  4LCK A;  3MCA B;  3N2G A;  1E7K A;  3RYF B;  1OFU A;  1U3P A;  2KTU A;  3TD5 A;  4KWE A;  3I3F A;  3RYH A;  5BMV B;  3WGM A;  2B33 A;  2LCA A;  3E22 B;  1N8R H;  5KX5 B;  3ESJ A;  3MQW A;  2H6L A;  4BT4 A;  1W59 A;  2HS0 A;  4BW0 B;  3F0E A;  2OZB A;  5JCO C;  4C8G A;  3F0G A;  3JAS B;  5CA0 B;  4ZOL B;  2IG8 A;  1QD9 A;  3Q8H A;  4RQO A;  3N2K B;  2HVY D;  1VQN F;  2AIZ P;  3RYC A;  3CCS F;  2PMP A;  3OBY A;  3F0F A;  1PXW A;  3CC7 F;  2OTJ F;  1VHA A;  5CB4 A;  3FPI A;  3C9U A;  3E1Y A;  2UYN B;  4BVT A;  3GTZ A;  4TV8 A;  3NK7 A; 
#chains in the Genus database with same CATH homology
 1VQK F;  1YI2 F;  3G6E F;  2GLZ A;  3LFO A;  3G4S F;  2QA4 F;  1T0K B;  1DT9 A;  5GIN C;  3CC2 F;  3CCV F;  1W41 A;  5FJ4 C;  3CXC F;  3N4Y A;  2BO1 A;  1VQM F;  1W2B F;  1K73 H;  4C4W C;  3LWP C;  3NMU C;  5A2Q M;  3CCU F;  3LWO C;  3GYQ A;  3NK6 A;  5HXZ A;  3I55 F;  3LWV C;  3E20 B;  1YJ9 F;  2KG4 A;  4NQ3 A;  3V3T A;  1YIJ F;  1M1K H;  5GAN K;  5GIP C;  4X3L A;  1NJI H;  2OHW A;  2VGM A;  2AIF A;  3CCQ F;  2I6D A;  1KD1 H;  2OTL F;  3PLA C;  5G4U C;  1VQP F;  2WAL A;  1Q81 H;  5HWE A;  3SIV A;  1W40 A;  3CD6 F;  3HJW C;  2ALE A;  3NVI B;  3LWQ C;  3IR9 A;  3CME F;  1GZ0 A;  2FC3 A;  3LWR C;  2F9Z C;  1X7P A;  3CMA F;  1SDS A;  2CZW A;  3V7E A;  2VGN A;  3J81 M;  1JJ2 F;  1W42 A;  2JNB A;  5EWR A;  1VQ4 F;  1YJN F;  1S72 F;  1VQ6 F;  4BY9 D;  3WXM B;  5HY4 A;  4XCQ A;  1Q82 H;  3CCJ F;  1VQ5 F;  3SIU A;  5HY1 A;  5GAP K;  1QVG F;  1CK2 A;  3JAM M;  1IPA A;  1YJW F;  4NUT A;  1M90 H;  1VQ9 F;  4BVR A;  4X3M A;  1VQL F;  1Q86 H;  1XBI A;  5G4V C;  3CC4 F;  1GO0 A;  3OBW A;  4EI9 A;  2QEX F;  1KQS F;  1GO1 A;  1K8A H;  3VMF B;  4BVQ A;  5IT9 M;  5HY2 A;  3V7Q A;  1W3E X;  1ZWZ A;  4LCK A;  3MCA B;  3RA6 A;  1VQO F;  3G71 F;  2LBX A;  3NVK E;  1RA4 A;  1E7K A;  1X7O A;  5HXU A;  1Q7Y H;  3I56 F;  1YHQ F;  3VI6 A;  3CCM F;  2KTU A;  3O85 A;  3ON1 A;  5FLX M;  3D00 A;  3CCE F;  1K9M H;  3RA5 A;  3N4Z A;  5EO3 A;  5HY0 A;  1N8R H;  4EI8 A;  4BVS A;  1NMU B;  1RLG A;  3CG6 A;  3J7A R;  4BW0 B;  1YIT F;  2OZB A;  3CCL F;  3HAX D;  5DCV A;  2FGY A;  3AGK A;  2KTV A;  4TZZ A;  3CPQ A;  1VQ8 F;  1QVF F;  1X52 A;  3PAF A;  2HVY D;  3OW2 F;  1VQN F;  3CCS F;  1H7M A;  3J80 M;  3OBY A;  2QI2 A;  1PXW A;  1KC8 H;  3CC7 F;  3CCR F;  2OTJ F;  3CPW F;  4EI7 A;  1VQ7 F;  1CN7 A;  3E1Y A;  2LBW A;  4BVT A;  5GIO C;  3JCM M;  3FFM A;  3NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...