3J7AR

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
98
Chain Sequence
VTAIQKVIKNAHVHDGLKIGIREVIKSIESQEAKVCFLSDVCSEPAYKKLITTLCAEMVQNDSKDLGHWAGLFIIGASSVAVVDFGEDSAEKDFLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 22
structure length 98
sequence length 114
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3j7aR00
3NK6A 5EO3A 3CPQA 3G4SF 4BW0B 3JAMM 1W41A 5EWRA 3NMUC 5GAPK 1KD1H 2KTUA 3CCJF 1VQOF 3V7EA 2KTVA 3E1YA 1K8AH 1GO1A 3LWPC 3CPWF 3N4YA 1K73H 3J7AR 3CC7F 2VGNA 1PXWA 3JCMM 3ON1A 2I6DA 3OW2F 3G71F 1X7OA 4TZZA 1M90H 1GZ0A 3LWRC 1VQPF 1VQMF 3V7QA 3PLAC 1T0KB 1RA4A 3VI6A 3CC4F 3GYQA 3LWVC 1KC8H 1K9MH 1YHQF 3CMEF 2KG4A 3PAFA 1JJ2F 1E7KA 3AGKA 3CCQF 3MCAB 2HVYD 3NK7A 5GINC 1W40A 3RA5A 1VQ7F 1W42A 2JNBA 2WALA 3LWOC 1YI2F 3CCUF 1KQSF 1YJWF 2OTLF 1Q86H 5GIOC 3I56F 3HJWC 3SIUA 3CCEF 5FJ4C 1IPAA 2FC3A 1DT9A 1S72F 2OTJF 3FFMA 3N4ZA 1Q7YH 1VQLF 5DCVA 1Q81H 3SIVA 2CZWA 4C4WC 2QI2A 4BY9D 1NMUB 1ZWZA 3LWQC 1VQKF 1Q82H 1YIJF 1QVGF 2LBWA 1H7MA 1VQ6F 3LFOA 3IR9A 3WXMB 3J81M 5A2QM 3I55F 1VQNF 1GO0A 3CXCF 2OHWA 1W3EX 1X52A 1VQ4F 1VQ9F 5G4VC 1VQ5F 1SDSA 3NVKE 1XBIA 1M1KH 5FLXM 1YJNF 1N8RH 1CK2A 2ALEA 3CCSF 1QVFF 3J80M 1VQ8F 4NUTA 3OBYA 3CMAF 4X3LA 1RLGA 1YITF 3CCVF 2QA4F 2LBXA 2BO1A 3CCLF 4LCKA 1X7PA 2QEXF 5GANK 5GIPC 3NVIB 3O85A 2OZBA 3OBWA 3CG6A 3RA6A 3E20B 1NJIH 3CC2F 3HAXD 1W2BF 2VGMA 5G4UC 3G6EF 1CN7A 2AIFA 3VMFB 3CCMF 3CCRF 4X3MA 1YJ9F 3CD6F 5IT9M
chains in the Genus database with same CATH superfamily
3NK6A 5KX5B 2H6LA 4U3JB 2HP3A 1W59A 3F0GA 1TVKB 5KMGA 5FNVB 5EWRA 3CCJF 3EORA 4X1IB 1COMA 1K8AH 2Q1YA 1XRGA 3LWPC 3VO8A 2ZVZA 3CC7F 1TUBA 1SZQA 5LOVB 4NWOB 1X7OA 3TD4A 1FNKA 4G4XA 5IYZA 1CLIA 2ZVYA 1VQPF 1KNKA 2Z1FA 4IIJA 3HKCB 3CC4F 2UYPA 3FD6A 1OFUA 1W5FA 5J2TB 4I4TA 3LWVC 1K9MH 3HKEB 1YHQF 3WGMA 4B45A 3P4EA 4IHJB 1IV2A 3MCAB 4U3JA 1JD1A 4DRXB 1W40A 3RA5A 4B62A 1VQ7F 1W42A 2DYYA 3DC2A 4I50B 4TV9B 2R6R1 4X1IA 2ZAUA 5IJ9B 5EIBC 1YI2F 4R40B 2HP0B 2IAFA 3S02A 5GIOC 2V9YA 2NMUA 5LOVA 3JARA 3N2KB 2HS4A 3F0EA 4G4ZA 3ZO8A 4ZK7A 5FJ4C 1OAPA 2DT4A 5EIBD 4ERHA 2CHSA 1U3PA 2OTJF 4G4WA 3WJRA 1Q8RA 3HKCA 3P0ZA 5HY1A 2CHTA 5HY2A 3HKEA 2P6YA 4C4WC 4NQ3A 1IV1A 1NMUB 3D01A 4RHAA 5LYJA 3S0WA 5BMVB 4IHJA 1H7MA 3RYCB 4B46A 3V3TA 3ZOPA 4DRXA 3LYBA 3IKFA 5LP6B 5CB4B 1GO0A 4I50A 1DBFA 5MN4A 1VQ4F 1VQ9F 2HP0A 2K1SA 1ONIA 3L7QA 2IG8A 4BT2A 3N2KA 1JN1A 3K2XA 4BT4A 1VQ8F 4NUTA 5JVDB 3K12A 3MBMA 2LBXA 3CCLF 3V4DA 3RA6A 5ITZB 4G88A 3VMFB 5LP6A 5CB4A 2B33A 5IT9M 3K14A 1RLUA 5EO3A 3C9SA 3JAMM 3VYSC 2QTPA 2RB9A 1W41A 5GAPK 1KD1H 4TUYB 4TV8B 1VQOF 1IV3A 2HQSC 4BVSA 4ZHVA 5JVDA 3E1YA 2YXZA 4O4JB 5LA6B 3S0HA 1GO1A 2L26A 1PXWA 5HXUA 5EYPA 1NQ3A 1VQMF 2UYNA 3HKDB 2UYJA 1T0KB 1RA4A 4BT5A 5CA0A 3GYQA 2OTMA 2RHJA 3CMEF 4EI7A 4X1KB 5AVMA 4M8IA 3WGJA 3WGNA 3WPXA 3CB2A 4C8IA 3C8LA 3VTIC 2HVYD 3NK7A 2Z01A 1W57A 2RHLA 4TUYA 4TV8A 1QD9A 3I7TA 5LA6A 1RQ2A 2OTLF 3RYIB 5EB0A 5HXZA 4ZOLB 5MN5A 4I55B 3CCEF 1DT9A 1S72F 3HKDA 3FFMA 1FSZA 5EAZA 2GVIA 2LBTA 2VAPA 4O4HB 1U40A 3KJKA 4KWEA 5HY4A 2QI2A 5KX5A 3LWQC 4C8GA 3VOBA 1TVKA 3TD3A 5FNVA 1QVGF 3QTYA 3JATB 3CXCF 2OHWA 2IQQA 4BVTA 1QU9A 1W3EX 2RHHA 1X52A 4O2BB 1ODEA 1VH8A 1SDSA 3RYIA 3NVKE 2HS3A 5FLXM 1YJNF 5C8YB 1CK2A 2ALEA 1QVFF 4ZOLA 4I55A 3JAKB 2ZF8A 2H8EA 2BTUA 4G4YA 4X3LA 2VAMA 5J2TA 1YITF 3CCVF 5EZYB 2PMPA 4C81A 5IJ0B 1X7PA 3S03A 4BT7A 3NVIB 3O85A 1T0AA 3WPWA 3OBWA 3RE3A 1NJIH 2VGMA 1VHAA 2LCAA 1FFXB 3G6EF 2VXYA 4TV9A 3ERNA 4ZHYB 3JATA 1W5BA 5J2UB 5IJ9A 3CCMF 3CCRF 4X3MA 3CD6F 1SA0B 5GONB 4O4IB 5HP8A 5HY0A 4O2BA 2AIZP 2PHNA 3CPQA 3G4SF 3IEQA 3R0PA 4BW0B 4F6RB 2RHOA 3ESJA 3V7EA 3JAKA 1JFFB 1QAHA 2KTVA 1W55A 2I6RA 1K73H 3CPWF 3J7AR 5EZYA 4BVRA 2GZLA 2VGNA 3S0YA 5IJ0A 3ON1A 2G9IA 2I6DA 3OW2F 3G71F 3BYQA 5BMVA 1M90H 3LWRC 3RYCA 3V7QA 2CVLA 3RYHB 3VI6A 4X20B 1FFXA 1KC8H 2Z1EA 5JQGB 5LP6C 1UI9A 3F0FA 1RQ7A 1SA0A 5GONA 2KG4A 4O4IA 1XV2A 1Z5VA 3PAFA 3DDNA 3JAWB 4WBNB 5JCOA 2R751 4F6RA 5GINC 3KJJA 4EB6B 3D00A 3K0TA 2HRUA 1Q86H 3I56F 3HJWC 3T80A 3SIUA 3OONA 5ITZA 2Z1TA 3F0DA 3VYTC 3HKBB 2VAWA 3RYHA 1YQNA 4X20A 1Q7YH 1VQLF 5DCVA 4EI8A 1Q81H 4C8EA 5JQGA 2CZWA 4XCQA 4BY9D 1IV4A 1FNJA 3MQWA 5MN6A 2ZODA 1VQKF 4YJ2B 4ZHQB 3JAWA 2LBWA 4WBNA 1VQ6F 2F9ZC 3IR9A 3QUWA 2CWJA 3KE1A 4O4JA 4EB6A 1VQNF 4G4VA 3VIUA 3WJPA 2Q1XA 5G4VC 1YGYA 1XBIA 1W581 1N8RH 1GX1A 3CCSF 4YJ3B 1U3LA 1U43A 3CMAF 3HKBA 1RLGA 1XHOA 3TD5A 2QA4F 2BO1A 4X1KA 4LCKA 2QEXF 5GANK 1VK3A 3IMPA 4X1YB 3P10A 2OZBA 3JARB 4EI9A 2BTQB 3QHDA 3C9RA 3RYFB 4YJ2A 4ZHQA 4ZI7B 1W2BF 5HP7A 3B6NA 1X25A 3CYPB 3ELCA 4FFBB 3Q8HA 2W8BC 3LMEA 3WGLA 5LYJB 3NMUC 1Z5WA 4YJ3A 2KTUA 1VQVA 3M84A 3S06A 3UT5B 3C9TA 4LNUB 3ZP4A 4O4HA 3N4YA 3GTZA 3VYUC 4PWTA 3JCMM 3JALB 4C82A 4TZZA 4BVQA 4X1YA 2EWCA 3HWUA 1R1MA 1GZ0A 1W5AA 2UZHA 1UFYA 4BT6A 3FBAA 3RYFA 3PLAC 4ZI7A 2HS0A 1W5EA 4FFBA 3MCQA 3ZP7A 5JH7B 1H47A 3LDTA 3IEWA 2BTOA 1JJ2F 3E22B 3VCZA 4BT3A 5C8YA 1E7KA 3AGKA 3CCQF 3F6MA 2FGYA 2CW4A 3VOAA 4O4LB 2HRYA 5B8FA 3JASB 2JNBA 2WALA 3M1XA 3UT5A 5HWEA 4RQOA 3WGKA 4DXDA 4LNUA 3M4SA 3LWOC 3I3FA 3CCUF 1KQSF 1YJWF 4O2AB 3KHNA 3KIZA 3JALA 3N2GB 3FPIA 1IPAA 2FC3A 2UYKA 5EB1B 3N4ZA 2H8CA 5J2UA 1H48A 2N48A 5LXTB 3SIVA 5JH7A 3IKEA 5CA1B 3HTNA 1ZWZA 4U39A 1JY8A 1Q82H 3E22A 1PF5A 3JVHA 1YIJF 5EYPB 5JCOC 3D54A 2UYNB 2CSLA 3LFOA 2MQEA 4O4LA 1JFFA 3U0OA 3WXMB 3JASA 5CA0B 2ZOVA 3J81M 1KNJA 5A2QM 3I55F 3CYQA 4HNAB 1J7HA 1VQ5F 2KGWA 4O2AA 2HX0A 2GLZA 1M1KH 3N2GA 2Z1UA 5KMGB 3J80M 3WJQA 4E6EA 3MDOA 3OBYA 2YYEA 4ZHWA 1TUBB 4B5CA 5LXTA 2AMTA 5CA1A 5GIPC 5IYZB 3FD5A 3CG6A 3E20B 3CC2F 4IIJB 3HAXD 3GHZA 5G4UC 1CN7A 2AIFA 4I4TB 3C9UA 1YJ9F 4HNAA
chains in the Genus database with same CATH topology
5HY0A 3NK6A 5EO3A 3CPQA 3G4SF 4BW0B 3JAMM 1W41A 5EWRA 3NMUC 5GAPK 1KD1H 2KTUA 3CCJF 4BVSA 1VQOF 3V7EA 2KTVA 3E1YA 1K8AH 1GO1A 3LWPC 3CPWF 3N4YA 1K73H 3J7AR 4BVRA 3CC7F 2VGNA 1PXWA 3JCMM 3ON1A 2I6DA 3OW2F 3G71F 1X7OA 4TZZA 5HXUA 4BVQA 1M90H 1GZ0A 3LWRC 1VQPF 1VQMF 3V7QA 3PLAC 1T0KB 1RA4A 3VI6A 3CC4F 3GYQA 3LWVC 1KC8H 1K9MH 1YHQF 3CMEF 4EI7A 2KG4A 3PAFA 1JJ2F 1E7KA 3AGKA 3CCQF 2FGYA 3MCAB 2HVYD 3NK7A 5GINC 1W40A 3RA5A 1VQ7F 3D00A 1W42A 2JNBA 2WALA 5HWEA 3LWOC 1YI2F 3CCUF 1KQSF 1YJWF 2OTLF 1Q86H 5GIOC 3I56F 3HJWC 5HXZA 3SIUA 3CCEF 5FJ4C 1IPAA 2FC3A 1DT9A 1S72F 2OTJF 3FFMA 3N4ZA 1Q7YH 5HY1A 1VQLF 5DCVA 4EI8A 1Q81H 5HY2A 3SIVA 2CZWA 4XCQA 5HY4A 4C4WC 2QI2A 4NQ3A 4BY9D 1NMUB 1ZWZA 3LWQC 1VQKF 1Q82H 1YIJF 1QVGF 2LBWA 1H7MA 1VQ6F 2F9ZC 3LFOA 3V3TA 3IR9A 3WXMB 3J81M 5A2QM 3I55F 1VQNF 1GO0A 3CXCF 2OHWA 4BVTA 1W3EX 1X52A 1VQ4F 1VQ9F 5G4VC 1VQ5F 1SDSA 3NVKE 2GLZA 1XBIA 1M1KH 5FLXM 1YJNF 1N8RH 1CK2A 2ALEA 3CCSF 1QVFF 3J80M 1VQ8F 4NUTA 3OBYA 3CMAF 4X3LA 1RLGA 1YITF 3CCVF 2QA4F 2LBXA 2BO1A 3CCLF 4LCKA 1X7PA 2QEXF 5GANK 5GIPC 3NVIB 3O85A 2OZBA 4EI9A 3OBWA 3CG6A 3RA6A 3E20B 1NJIH 3CC2F 3HAXD 1W2BF 2VGMA 5G4UC 3G6EF 1CN7A 2AIFA 3VMFB 3CCMF 3CCRF 4X3MA 1YJ9F 3CD6F 5IT9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK6 A;  5EO3 A;  3CPQ A;  3G4S F;  4BW0 B;  3JAM M;  1W41 A;  5EWR A;  3NMU C;  5GAP K;  1KD1 H;  2KTU A;  3CCJ F;  1VQO F;  3V7E A;  2KTV A;  3E1Y A;  1K8A H;  1GO1 A;  3LWP C;  3CPW F;  3N4Y A;  1K73 H;  3J7A R;  3CC7 F;  2VGN A;  1PXW A;  3JCM M;  3ON1 A;  2I6D A;  3OW2 F;  3G71 F;  1X7O A;  4TZZ A;  1M90 H;  1GZ0 A;  3LWR C;  1VQP F;  1VQM F;  3V7Q A;  3PLA C;  1T0K B;  1RA4 A;  3VI6 A;  3CC4 F;  3GYQ A;  3LWV C;  1KC8 H;  1K9M H;  1YHQ F;  3CME F;  2KG4 A;  3PAF A;  1JJ2 F;  1E7K A;  3AGK A;  3CCQ F;  3MCA B;  2HVY D;  3NK7 A;  5GIN C;  1W40 A;  3RA5 A;  1VQ7 F;  1W42 A;  2JNB A;  2WAL A;  3LWO C;  1YI2 F;  3CCU F;  1KQS F;  1YJW F;  2OTL F;  1Q86 H;  5GIO C;  3I56 F;  3HJW C;  3SIU A;  3CCE F;  5FJ4 C;  1IPA A;  2FC3 A;  1DT9 A;  1S72 F;  2OTJ F;  3FFM A;  3N4Z A;  1Q7Y H;  1VQL F;  5DCV A;  1Q81 H;  3SIV A;  2CZW A;  4C4W C;  2QI2 A;  4BY9 D;  1NMU B;  1ZWZ A;  3LWQ C;  1VQK F;  1Q82 H;  1YIJ F;  1QVG F;  2LBW A;  1H7M A;  1VQ6 F;  3LFO A;  3IR9 A;  3WXM B;  3J81 M;  5A2Q M;  3I55 F;  1VQN F;  1GO0 A;  3CXC F;  2OHW A;  1W3E X;  1X52 A;  1VQ4 F;  1VQ9 F;  5G4V C;  1VQ5 F;  1SDS A;  3NVK E;  1XBI A;  1M1K H;  5FLX M;  1YJN F;  1N8R H;  1CK2 A;  2ALE A;  3CCS F;  1QVF F;  3J80 M;  1VQ8 F;  4NUT A;  3OBY A;  3CMA F;  4X3L A;  1RLG A;  1YIT F;  3CCV F;  2QA4 F;  2LBX A;  2BO1 A;  3CCL F;  4LCK A;  1X7P A;  2QEX F;  5GAN K;  5GIP C;  3NVI B;  3O85 A;  2OZB A;  3OBW A;  3CG6 A;  3RA6 A;  3E20 B;  1NJI H;  3CC2 F;  3HAX D;  1W2B F;  2VGM A;  5G4U C;  3G6E F;  1CN7 A;  2AIF A;  3VMF B;  3CCM F;  3CCR F;  4X3M A;  1YJ9 F;  3CD6 F;  5IT9 M; 
#chains in the Genus database with same CATH topology
 3NK6 A;  5KX5 B;  2H6L A;  4U3J B;  2HP3 A;  1W59 A;  3F0G A;  1TVK B;  5KMG A;  5FNV B;  5EWR A;  3CCJ F;  3EOR A;  4X1I B;  1COM A;  1K8A H;  2Q1Y A;  1XRG A;  3LWP C;  3VO8 A;  2ZVZ A;  3CC7 F;  1TUB A;  1SZQ A;  5LOV B;  4NWO B;  1X7O A;  3TD4 A;  1FNK A;  4G4X A;  5IYZ A;  1CLI A;  2ZVY A;  1VQP F;  1KNK A;  2Z1F A;  4IIJ A;  3HKC B;  3CC4 F;  2UYP A;  3FD6 A;  1OFU A;  1W5F A;  5J2T B;  4I4T A;  3LWV C;  1K9M H;  3HKE B;  1YHQ F;  3WGM A;  4B45 A;  3P4E A;  4IHJ B;  1IV2 A;  3MCA B;  4U3J A;  1JD1 A;  4DRX B;  1W40 A;  3RA5 A;  4B62 A;  1VQ7 F;  1W42 A;  2DYY A;  3DC2 A;  4I50 B;  4TV9 B;  2R6R 1;  4X1I A;  2ZAU A;  5IJ9 B;  5EIB C;  1YI2 F;  4R40 B;  2HP0 B;  2IAF A;  3S02 A;  5GIO C;  2V9Y A;  2NMU A;  5LOV A;  3JAR A;  3N2K B;  2HS4 A;  3F0E A;  4G4Z A;  3ZO8 A;  4ZK7 A;  5FJ4 C;  1OAP A;  2DT4 A;  5EIB D;  4ERH A;  2CHS A;  1U3P A;  2OTJ F;  4G4W A;  3WJR A;  1Q8R A;  3HKC A;  3P0Z A;  5HY1 A;  2CHT A;  5HY2 A;  3HKE A;  2P6Y A;  4C4W C;  4NQ3 A;  1IV1 A;  1NMU B;  3D01 A;  4RHA A;  5LYJ A;  3S0W A;  5BMV B;  4IHJ A;  1H7M A;  3RYC B;  4B46 A;  3V3T A;  3ZOP A;  4DRX A;  3LYB A;  3IKF A;  5LP6 B;  5CB4 B;  1GO0 A;  4I50 A;  1DBF A;  5MN4 A;  1VQ4 F;  1VQ9 F;  2HP0 A;  2K1S A;  1ONI A;  3L7Q A;  2IG8 A;  4BT2 A;  3N2K A;  1JN1 A;  3K2X A;  4BT4 A;  1VQ8 F;  4NUT A;  5JVD B;  3K12 A;  3MBM A;  2LBX A;  3CCL F;  3V4D A;  3RA6 A;  5ITZ B;  4G88 A;  3VMF B;  5LP6 A;  5CB4 A;  2B33 A;  5IT9 M;  3K14 A;  1RLU A;  5EO3 A;  3C9S A;  3JAM M;  3VYS C;  2QTP A;  2RB9 A;  1W41 A;  5GAP K;  1KD1 H;  4TUY B;  4TV8 B;  1VQO F;  1IV3 A;  2HQS C;  4BVS A;  4ZHV A;  5JVD A;  3E1Y A;  2YXZ A;  4O4J B;  5LA6 B;  3S0H A;  1GO1 A;  2L26 A;  1PXW A;  5HXU A;  5EYP A;  1NQ3 A;  1VQM F;  2UYN A;  3HKD B;  2UYJ A;  1T0K B;  1RA4 A;  4BT5 A;  5CA0 A;  3GYQ A;  2OTM A;  2RHJ A;  3CME F;  4EI7 A;  4X1K B;  5AVM A;  4M8I A;  3WGJ A;  3WGN A;  3WPX A;  3CB2 A;  4C8I A;  3C8L A;  3VTI C;  2HVY D;  3NK7 A;  2Z01 A;  1W57 A;  2RHL A;  4TUY A;  4TV8 A;  1QD9 A;  3I7T A;  5LA6 A;  1RQ2 A;  2OTL F;  3RYI B;  5EB0 A;  5HXZ A;  4ZOL B;  5MN5 A;  4I55 B;  3CCE F;  1DT9 A;  1S72 F;  3HKD A;  3FFM A;  1FSZ A;  5EAZ A;  2GVI A;  2LBT A;  2VAP A;  4O4H B;  1U40 A;  3KJK A;  4KWE A;  5HY4 A;  2QI2 A;  5KX5 A;  3LWQ C;  4C8G A;  3VOB A;  1TVK A;  3TD3 A;  5FNV A;  1QVG F;  3QTY A;  3JAT B;  3CXC F;  2OHW A;  2IQQ A;  4BVT A;  1QU9 A;  1W3E X;  2RHH A;  1X52 A;  4O2B B;  1ODE A;  1VH8 A;  1SDS A;  3RYI A;  3NVK E;  2HS3 A;  5FLX M;  1YJN F;  5C8Y B;  1CK2 A;  2ALE A;  1QVF F;  4ZOL A;  4I55 A;  3JAK B;  2ZF8 A;  2H8E A;  2BTU A;  4G4Y A;  4X3L A;  2VAM A;  5J2T A;  1YIT F;  3CCV F;  5EZY B;  2PMP A;  4C81 A;  5IJ0 B;  1X7P A;  3S03 A;  4BT7 A;  3NVI B;  3O85 A;  1T0A A;  3WPW A;  3OBW A;  3RE3 A;  1NJI H;  2VGM A;  1VHA A;  2LCA A;  1FFX B;  3G6E F;  2VXY A;  4TV9 A;  3ERN A;  4ZHY B;  3JAT A;  1W5B A;  5J2U B;  5IJ9 A;  3CCM F;  3CCR F;  4X3M A;  3CD6 F;  1SA0 B;  5GON B;  4O4I B;  5HP8 A;  5HY0 A;  4O2B A;  2AIZ P;  2PHN A;  3CPQ A;  3G4S F;  3IEQ A;  3R0P A;  4BW0 B;  4F6R B;  2RHO A;  3ESJ A;  3V7E A;  3JAK A;  1JFF B;  1QAH A;  2KTV A;  1W55 A;  2I6R A;  1K73 H;  3CPW F;  3J7A R;  5EZY A;  4BVR A;  2GZL A;  2VGN A;  3S0Y A;  5IJ0 A;  3ON1 A;  2G9I A;  2I6D A;  3OW2 F;  3G71 F;  3BYQ A;  5BMV A;  1M90 H;  3LWR C;  3RYC A;  3V7Q A;  2CVL A;  3RYH B;  3VI6 A;  4X20 B;  1FFX A;  1KC8 H;  2Z1E A;  5JQG B;  5LP6 C;  1UI9 A;  3F0F A;  1RQ7 A;  1SA0 A;  5GON A;  2KG4 A;  4O4I A;  1XV2 A;  1Z5V A;  3PAF A;  3DDN A;  3JAW B;  4WBN B;  5JCO A;  2R75 1;  4F6R A;  5GIN C;  3KJJ A;  4EB6 B;  3D00 A;  3K0T A;  2HRU A;  1Q86 H;  3I56 F;  3HJW C;  3T80 A;  3SIU A;  3OON A;  5ITZ A;  2Z1T A;  3F0D A;  3VYT C;  3HKB B;  2VAW A;  3RYH A;  1YQN A;  4X20 A;  1Q7Y H;  1VQL F;  5DCV A;  4EI8 A;  1Q81 H;  4C8E A;  5JQG A;  2CZW A;  4XCQ A;  4BY9 D;  1IV4 A;  1FNJ A;  3MQW A;  5MN6 A;  2ZOD A;  1VQK F;  4YJ2 B;  4ZHQ B;  3JAW A;  2LBW A;  4WBN A;  1VQ6 F;  2F9Z C;  3IR9 A;  3QUW A;  2CWJ A;  3KE1 A;  4O4J A;  4EB6 A;  1VQN F;  4G4V A;  3VIU A;  3WJP A;  2Q1X A;  5G4V C;  1YGY A;  1XBI A;  1W58 1;  1N8R H;  1GX1 A;  3CCS F;  4YJ3 B;  1U3L A;  1U43 A;  3CMA F;  3HKB A;  1RLG A;  1XHO A;  3TD5 A;  2QA4 F;  2BO1 A;  4X1K A;  4LCK A;  2QEX F;  5GAN K;  1VK3 A;  3IMP A;  4X1Y B;  3P10 A;  2OZB A;  3JAR B;  4EI9 A;  2BTQ B;  3QHD A;  3C9R A;  3RYF B;  4YJ2 A;  4ZHQ A;  4ZI7 B;  1W2B F;  5HP7 A;  3B6N A;  1X25 A;  3CYP B;  3ELC A;  4FFB B;  3Q8H A;  2W8B C;  3LME A;  3WGL A;  5LYJ B;  3NMU C;  1Z5W A;  4YJ3 A;  2KTU A;  1VQV A;  3M84 A;  3S06 A;  3UT5 B;  3C9T A;  4LNU B;  3ZP4 A;  4O4H A;  3N4Y A;  3GTZ A;  3VYU C;  4PWT A;  3JCM M;  3JAL B;  4C82 A;  4TZZ A;  4BVQ A;  4X1Y A;  2EWC A;  3HWU A;  1R1M A;  1GZ0 A;  1W5A A;  2UZH A;  1UFY A;  4BT6 A;  3FBA A;  3RYF A;  3PLA C;  4ZI7 A;  2HS0 A;  1W5E A;  4FFB A;  3MCQ A;  3ZP7 A;  5JH7 B;  1H47 A;  3LDT A;  3IEW A;  2BTO A;  1JJ2 F;  3E22 B;  3VCZ A;  4BT3 A;  5C8Y A;  1E7K A;  3AGK A;  3CCQ F;  3F6M A;  2FGY A;  2CW4 A;  3VOA A;  4O4L B;  2HRY A;  5B8F A;  3JAS B;  2JNB A;  2WAL A;  3M1X A;  3UT5 A;  5HWE A;  4RQO A;  3WGK A;  4DXD A;  4LNU A;  3M4S A;  3LWO C;  3I3F A;  3CCU F;  1KQS F;  1YJW F;  4O2A B;  3KHN A;  3KIZ A;  3JAL A;  3N2G B;  3FPI A;  1IPA A;  2FC3 A;  2UYK A;  5EB1 B;  3N4Z A;  2H8C A;  5J2U A;  1H48 A;  2N48 A;  5LXT B;  3SIV A;  5JH7 A;  3IKE A;  5CA1 B;  3HTN A;  1ZWZ A;  4U39 A;  1JY8 A;  1Q82 H;  3E22 A;  1PF5 A;  3JVH A;  1YIJ F;  5EYP B;  5JCO C;  3D54 A;  2UYN B;  2CSL A;  3LFO A;  2MQE A;  4O4L A;  1JFF A;  3U0O A;  3WXM B;  3JAS A;  5CA0 B;  2ZOV A;  3J81 M;  1KNJ A;  5A2Q M;  3I55 F;  3CYQ A;  4HNA B;  1J7H A;  1VQ5 F;  2KGW A;  4O2A A;  2HX0 A;  2GLZ A;  1M1K H;  3N2G A;  2Z1U A;  5KMG B;  3J80 M;  3WJQ A;  4E6E A;  3MDO A;  3OBY A;  2YYE A;  4ZHW A;  1TUB B;  4B5C A;  5LXT A;  2AMT A;  5CA1 A;  5GIP C;  5IYZ B;  3FD5 A;  3CG6 A;  3E20 B;  3CC2 F;  4IIJ B;  3HAX D;  3GHZ A;  5G4U C;  1CN7 A;  2AIF A;  4I4T B;  3C9U A;  1YJ9 F;  4HNA A; 
#chains in the Genus database with same CATH homology
 5HY0 A;  3NK6 A;  5EO3 A;  3CPQ A;  3G4S F;  4BW0 B;  3JAM M;  1W41 A;  5EWR A;  3NMU C;  5GAP K;  1KD1 H;  2KTU A;  3CCJ F;  4BVS A;  1VQO F;  3V7E A;  2KTV A;  3E1Y A;  1K8A H;  1GO1 A;  3LWP C;  3CPW F;  3N4Y A;  1K73 H;  3J7A R;  4BVR A;  3CC7 F;  2VGN A;  1PXW A;  3JCM M;  3ON1 A;  2I6D A;  3OW2 F;  3G71 F;  1X7O A;  4TZZ A;  5HXU A;  4BVQ A;  1M90 H;  1GZ0 A;  3LWR C;  1VQP F;  1VQM F;  3V7Q A;  3PLA C;  1T0K B;  1RA4 A;  3VI6 A;  3CC4 F;  3GYQ A;  3LWV C;  1KC8 H;  1K9M H;  1YHQ F;  3CME F;  4EI7 A;  2KG4 A;  3PAF A;  1JJ2 F;  1E7K A;  3AGK A;  3CCQ F;  2FGY A;  3MCA B;  2HVY D;  3NK7 A;  5GIN C;  1W40 A;  3RA5 A;  1VQ7 F;  3D00 A;  1W42 A;  2JNB A;  2WAL A;  5HWE A;  3LWO C;  1YI2 F;  3CCU F;  1KQS F;  1YJW F;  2OTL F;  1Q86 H;  5GIO C;  3I56 F;  3HJW C;  5HXZ A;  3SIU A;  3CCE F;  5FJ4 C;  1IPA A;  2FC3 A;  1DT9 A;  1S72 F;  2OTJ F;  3FFM A;  3N4Z A;  1Q7Y H;  5HY1 A;  1VQL F;  5DCV A;  4EI8 A;  1Q81 H;  5HY2 A;  3SIV A;  2CZW A;  4XCQ A;  5HY4 A;  4C4W C;  2QI2 A;  4NQ3 A;  4BY9 D;  1NMU B;  1ZWZ A;  3LWQ C;  1VQK F;  1Q82 H;  1YIJ F;  1QVG F;  2LBW A;  1H7M A;  1VQ6 F;  2F9Z C;  3LFO A;  3V3T A;  3IR9 A;  3WXM B;  3J81 M;  5A2Q M;  3I55 F;  1VQN F;  1GO0 A;  3CXC F;  2OHW A;  4BVT A;  1W3E X;  1X52 A;  1VQ4 F;  1VQ9 F;  5G4V C;  1VQ5 F;  1SDS A;  3NVK E;  2GLZ A;  1XBI A;  1M1K H;  5FLX M;  1YJN F;  1N8R H;  1CK2 A;  2ALE A;  3CCS F;  1QVF F;  3J80 M;  1VQ8 F;  4NUT A;  3OBY A;  3CMA F;  4X3L A;  1RLG A;  1YIT F;  3CCV F;  2QA4 F;  2LBX A;  2BO1 A;  3CCL F;  4LCK A;  1X7P A;  2QEX F;  5GAN K;  5GIP C;  3NVI B;  3O85 A;  2OZB A;  4EI9 A;  3OBW A;  3CG6 A;  3RA6 A;  3E20 B;  1NJI H;  3CC2 F;  3HAX D;  1W2B F;  2VGM A;  5G4U C;  3G6E F;  1CN7 A;  2AIF A;  3VMF B;  3CCM F;  3CCR F;  4X3M A;  1YJ9 F;  3CD6 F;  5IT9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...