3J7AR

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
98
Chain Sequence
VTAIQKVIKNAHVHDGLKIGIREVIKSIESQEAKVCFLSDVCSEPAYKKLITTLCAEMVQNDSKDLGHWAGLFIIGASSVAVVDFGEDSAEKDFLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 22
structure length 98
sequence length 114
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3j7aR00
2ALEA 5G4VC 3CC4F 3CC2F 1K73H 3G71F 3V7EA 3CMEF 1NMUB 3FFMA 3LWQC 2VGNA 2KG4A 1S72F 1K9MH 4X3MA 1E7KA 1Q7YH 4BW0B 1VQ5F 1X52A 1YI2F 3GYQA 3CCQF 3LFOA 1KC8H 1VQKF 2OTLF 3IR9A 3OBWA 3N4ZA 4LCKA 2OZBA 5A2QM 3WXMB 1GZ0A 4X3LA 1CK2A 3V7QA 5FJ4C 2AIFA 2LBWA 1YJWF 1SDSA 3CCLF 3NK6A 1YHQF 1N8RH 3CCRF 1Q86H 5GIOC 1W42A 2QEXF 3RA5A 1T0KB 3VI6A 2WALA 3LWRC 3CPQA 1VQOF 3CCUF 3JAMM 2BO1A 1QVGF 3NK7A 3CMAF 3N4YA 3CCJF 1Q81H 1IPAA 2KTUA 2VGMA 3VMFB 4TZZA 2JNBA 3CCSF 5EWRA 1Q82H 3O85A 3J81M 5G4UC 3E20B 2QA4F 1CN7A 2OTJF 5IT9M 4BY9D 3I55F 3CC7F 2QI2A 5FLXM 5GANK 3I56F 1YITF 1VQ7F 1W41A 1GO1A 3CXCF 1QVFF 1YJNF 3RA6A 3NMUC 5GIPC 1VQ9F 1VQNF 1KQSF 4C4WC 1W3EX 1X7PA 1W2BF 1M90H 3SIVA 3J80M 3LWVC 1YIJF 3JCMM 3NVIB 5GAPK 5GINC 2HVYD 3PAFA 1YJ9F 3CCVF 1DT9A 1W40A 1RLGA 3SIUA 2CZWA 1GO0A 1VQ8F 3HJWC 1VQ6F 3J7AR 1JJ2F 3CD6F 1XBIA 3AGKA 3CG6A 3OBYA 2I6DA 3G4SF 2LBXA 3G6EF 1VQ4F 3MCAB 1RA4A 1VQLF 1KD1H 2OHWA 1X7OA 1H7MA 2FC3A 3CPWF 3CCMF 3CCEF 1K8AH 3LWOC 1M1KH 2KTVA 4NUTA 5EO3A 1VQPF 3ON1A 3LWPC 1PXWA 3NVKE 3OW2F 5DCVA 3E1YA 1ZWZA 1VQMF 3PLAC 1NJIH 3HAXD
chains in the Genus database with same CATH superfamily
3S03A 5LA6A 5G4VC 5C8YB 3CC2F 2IQQA 3RYFB 3HKDA 2VGNA 2KG4A 1E7KA 1Q7YH 4BW0B 3GTZA 3Q8HA 2LBTA 1KC8H 3LFOA 3IR9A 1FFXA 3E22A 4TV8A 1SA0A 3CB2A 3N4ZA 4LCKA 4B45A 5LP6A 5FJ4C 4X20B 5J2TA 3WGLA 2LBWA 1YJWF 4LNUA 3HKEB 1W55A 3RYCA 3CCLF 4BT5A 1N8RH 2ZOVA 5JH7A 4BT4A 1Q86H 3JAKA 3MDOA 3UT5B 2UYKA 4NWOB 1XRGA 4X1KB 2HP0A 3EORA 3JATA 1T0KB 4BT6A 5ITZA 2CW4A 1VK3A 2GVIA 2Q1XA 3CCUF 1GX1A 2PHNA 3IMPA 3JASB 4B46A 3DC2A 3MBMA 4RQOA 3NK7A 4WBNB 1IPAA 2KTUA 3VMFB 2VAPA 3TD4A 5FNVA 5G4UC 2Z01A 3S0YA 1CN7A 4KWEA 2UYNA 3CC7F 3HKBB 1W57A 5FLXM 1JFFB 3WPXA 3GHZA 4PWTA 2GLZA 1U40A 2VAWA 4XCQA 5C8YA 3S02A 3N2KB 3RA6A 4G4YA 1X7PA 1W2BF 3J80M 3LWVC 4X1IA 2HS3A 4G4WA 4O4HB 5EYPB 5B8FA 1VQVA 5KX5A 3PAFA 3C9TA 1DT9A 1IV4A 4M8IA 4IIJB 4X20A 5JVDA 1RLGA 3MCQA 1TUBA 5JQGB 2CZWA 1T0AA 4EB6A 1OFUA 3WJPA 2YXZA 4HNAA 3D00A 5KMGB 3WGMA 4DRXB 2CWJA 2RHLA 5MN6A 3DDNA 5J2UB 3CG6A 5EZYA 3LDTA 3MCAB 3RYIB 3M84A 3IEWA 2I6RA 3CCMF 2MQEA 1QD9A 3LYBA 4O2BA 3IKFA 2HRUA 5GONB 3CYQA 3PLAC 3HAXD 1W5AA 1CLIA 2ALEA 3IKEA 3G71F 3V7EA 4C81A 3L7QA 4G4VA 3CMEF 5EB1B 3VCZA 4DXDA 3LWQC 5CA0A 3ZO8A 2H8CA 2HS4A 2RHOA 4U3JA 1U3PA 1X52A 1VQ5F 3GYQA 1VQKF 3JARB 3JAWB 3OBWA 3WXMB 1KNKA 5EB0A 1FNJA 4YJ3A 1QU9A 1IV2A 4IIJA 3ZP4A 3NK6A 5JQGA 3JVHA 2IG8A 3QHDA 5GIOC 3D01A 4C8IA 2QEXF 3RA5A 4DRXA 2WALA 5LYJA 1ONIA 1TVKA 3JAMM 3K12A 5LXTB 1QVGF 3HKCB 4U39A 4X1YB 3N4YA 1U43A 2VGMA 2JNBA 5EWRA 2BTUA 3JALB 2AIZP 3VTIC 3IEQA 4I55B 4BY9D 1IV3A 1W5BA 2QI2A 4I50A 5GANK 2Q1YA 4F6RB 1RLUA 3I56F 1YITF 1VQ7F 4ZOLB 3V3TA 5CA1B 5IYZB 2R6R1 1YJNF 1Q8RA 1VQ9F 1VQNF 5HXZA 5LP6C 5HY4A 4O4LA 1YIJF 1QAHA 5GAPK 4FFBA 4YJ2B 3VYTC 1H47A 3ESJA 3I3FA 1NQ3A 1VHAA 5BMVA 5MN5A 1COMA 1W40A 5IJ0B 1J7HA 3WJRA 3ZOPA 4IHJB 1VQ8F 3N2GB 1U3LA 2BTOA 4G4ZA 4TV9B 4ERHA 4ZI7A 3K2XA 2RHJA 3CD6F 4ZHYB 1XBIA 3AGKA 3OBYA 4ZHQB 2EWCA 2ZAUA 3RYHB 3CPWF 3RYFA 3CCEF 5CB4B 2ZVZA 1K8AH 2KTVA 3FD6A 3VYSC 3VO8A 3ON1A 1ODEA 2ZVYA 3OW2F 3E1YA 4ZK7A 1ZWZA 3FBAA 4I4TB 5JCOA 5HXUA 3WGJA 4I55A 2CVLA 2VAMA 3HKEA 5HY0A 4G88A 1H48A 2BTQB 3OONA 3R0PA 4O2AB 4F6RA 1FNKA 1NMUB 1UI9A 3K14A 5HP7A 1JN1A 5HY2A 3UT5A 4X3MA 1UFYA 3WGKA 1K9MH 4X1KA 4G4XA 3LMEA 3VOBA 4BVQA 3CCQF 2PMPA 1W581 4TUYB 4O4JB 2V9YA 5EIBC 5JCOC 3S06A 2HP3A 3I7TA 3JASA 5IJ9B 3V7QA 2AIFA 4YJ2A 4WBNA 5LA6B 5HP8A 3V4DA 1SDSA 5IJ0A 3RE3A 2YYEA 3HKDB 2HRYA 3QTYA 3CCRF 3HKBA 1JFFA 1KNJA 1Z5WA 4RHAA 2RHHA 3VI6A 2UYJA 1FFXB 3E22B 3CPQA 4TV8B 1SA0B 4ZHQA 1VQOF 3N2KA 5LP6B 2BO1A 5J2TB 1XV2A 3CMAF 1Q81H 2VXYA 4LNUB 4TZZA 3CCSF 5EYPA 4O4HA 3RYCB 3S0HA 1Q82H 5LOVB 3M4SA 5AVMA 1XHOA 2QA4F 2OTJF 3JAKB 4I4TA 2HP0B 2K1SA 3JATB 5ITZB 1W41A 1GO1A 3CXCF 2F9ZC 3NMUC 5GIPC 5KMGA 2Z1UA 3FD5A 4C4WC 1KQSF 2Z1FA 5J2UA 3F6MA 2L26A 3SIVA 3RYIA 3NVIB 5GINC 2HVYD 2IAFA 2UYNB 2Z1EA 1RQ2A 3KJJA 2AMTA 3K0TA 3WPWA 1IV1A 1VQ6F 3B6NA 4O4IB 5GONA 3MQWA 4BT2A 5EAZA 1JJ2F 2I6DA 3P10A 2LBXA 3F0DA 3G4SF 2ZF8A 2HQSC 4X1IB 2LCAA 3KE1A 3P4EA 1KD1H 1X7OA 4BVSA 3S0WA 3TD3A 3HWUA 5KX5B 1VQLF 3LWOC 1DBFA 1M1KH 4NQ3A 4NUTA 5EO3A 5JVDB 2B33A 1TUBB 3JARA 3ZP7A 5HWEA 3JAWA 3VYUC 2ZODA 3C8LA 3C9SA 1PXWA 3VOAA 3NVKE 5DCVA 4EB6B 4HNAB 5LOVA 1NJIH 2CSLA 1PF5A 2QTPA 3ERNA 3CC4F 3QUWA 1X25A 5EZYB 4E6EA 3C9UA 3WJQA 4EI9A 1K73H 2HX0A 3FFMA 5EIBD 1S72F 4BT3A 1YI2F 4O2BB 1YQNA 2OTLF 2GZLA 3F0FA 2HS0A 5A2QM 2OZBA 1GZ0A 3ELCA 1CK2A 4X3LA 5LXTA 3HKCA 4X1YA 1R1MA 4BT7A 5MN4A 3U0OA 4ZHWA 2P6YA 3JALA 2N48A 1YHQF 4C8EA 2Z1TA 1W5EA 4R40B 1OAPA 2UYPA 3WGNA 3BYQA 5CA0B 4O4IA 1W42A 4U3JB 3C9RA 5HY1A 4ZOLA 5CA1A 5IYZA 3LWRC 2G9IA 1VH8A 3HTNA 3CCJF 4YJ3B 2H6LA 2OTMA 3F0GA 3O85A 3J81M 3E20B 2FGYA 1JD1A 1Z5VA 5IT9M 3I55F 2CHSA 3CYPB 4EI7A 4B5CA 5LYJB 3D54A 4IHJA 3N2GA 1QVFF 4TV9A 1TVKB 3T80A 4ZHVA 4BVRA 1W3EX 3KJKA 3M1XA 4BVTA 1SZQA 1M90H 3P0ZA 3FPIA 3RYHA 3JCMM 2KGWA 2UZHA 5CB4A 1YJ9F 3KHNA 3CCVF 3F0EA 4I50B 3KIZA 4C82A 2DT4A 3SIUA 1W59A 5JH7B 1GO0A 1W5FA 3HJWC 1JY8A 2R751 4B62A 3J7AR 2CHTA 4C8GA 1VQ4F 3G6EF 4O4LB 1RA4A 1YGYA 2DYYA 2RB9A 2H8EA 2OHWA 2FC3A 1H7MA 4O2AA 4EI8A 4FFBB 2W8BC 5BMVB 3TD5A 1VQPF 1RQ7A 5FNVB 4TUYA 4O4JA 2NMUA 3LWPC 1VQMF 5IJ9A 3VIUA 1FSZA 4ZI7B
chains in the Genus database with same CATH topology
5HXUA 2ALEA 5G4VC 3CC4F 5HY0A 3CC2F 1K73H 4EI9A 3G71F 3V7EA 3CMEF 1NMUB 3FFMA 5HY2A 2VGNA 2KG4A 3LWQC 1S72F 4X3MA 1K9MH 1E7KA 1Q7YH 4BW0B 1VQ5F 1X52A 1YI2F 3GYQA 4BVQA 3CCQF 3LFOA 1KC8H 1VQKF 2OTLF 3IR9A 3OBWA 3N4ZA 4LCKA 2OZBA 5A2QM 3WXMB 1GZ0A 4X3LA 1CK2A 3V7QA 5FJ4C 2AIFA 2LBWA 1YJWF 1SDSA 3CCLF 3NK6A 1YHQF 1N8RH 3CCRF 1Q86H 5GIOC 1W42A 2QEXF 3RA5A 1T0KB 5HY1A 3VI6A 2WALA 3LWRC 3CPQA 1VQOF 3CCUF 3JAMM 2BO1A 1QVGF 3NK7A 3CMAF 3N4YA 3CCJF 1Q81H 1IPAA 2KTUA 2VGMA 3VMFB 4TZZA 2JNBA 3CCSF 5EWRA 1Q82H 3O85A 3J81M 5G4UC 3E20B 2FGYA 2QA4F 1CN7A 2OTJF 5IT9M 4BY9D 3I55F 3CC7F 2QI2A 5FLXM 5GANK 4EI7A 2GLZA 3I56F 1YITF 3V3TA 4XCQA 1W41A 1VQ7F 1GO1A 3CXCF 1QVFF 2F9ZC 1YJNF 3RA6A 3NMUC 5GIPC 4BVRA 1VQ9F 1VQNF 1KQSF 4C4WC 5HXZA 1W3EX 1X7PA 4BVTA 1W2BF 1M90H 3SIVA 5HY4A 3J80M 3LWVC 1YIJF 3JCMM 3NVIB 5GAPK 5GINC 2HVYD 3PAFA 1YJ9F 3CCVF 1DT9A 1W40A 1RLGA 3SIUA 2CZWA 1GO0A 1VQ8F 3HJWC 1VQ6F 3D00A 3J7AR 1JJ2F 3CD6F 1XBIA 3AGKA 3CG6A 3OBYA 2I6DA 3G4SF 2LBXA 3G6EF 1VQ4F 3MCAB 1RA4A 1VQLF 1KD1H 2OHWA 1X7OA 1H7MA 2FC3A 4BVSA 4EI8A 3CPWF 3CCMF 3CCEF 1K8AH 3LWOC 1M1KH 2KTVA 4NQ3A 4NUTA 5EO3A 1VQPF 3ON1A 5HWEA 3LWPC 1PXWA 3NVKE 3OW2F 5DCVA 3E1YA 1ZWZA 1VQMF 3PLAC 1NJIH 3HAXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALE A;  5G4V C;  3CC4 F;  3CC2 F;  1K73 H;  3G71 F;  3V7E A;  3CME F;  1NMU B;  3FFM A;  3LWQ C;  2VGN A;  2KG4 A;  1S72 F;  1K9M H;  4X3M A;  1E7K A;  1Q7Y H;  4BW0 B;  1VQ5 F;  1X52 A;  1YI2 F;  3GYQ A;  3CCQ F;  3LFO A;  1KC8 H;  1VQK F;  2OTL F;  3IR9 A;  3OBW A;  3N4Z A;  4LCK A;  2OZB A;  5A2Q M;  3WXM B;  1GZ0 A;  4X3L A;  1CK2 A;  3V7Q A;  5FJ4 C;  2AIF A;  2LBW A;  1YJW F;  1SDS A;  3CCL F;  3NK6 A;  1YHQ F;  1N8R H;  3CCR F;  1Q86 H;  5GIO C;  1W42 A;  2QEX F;  3RA5 A;  1T0K B;  3VI6 A;  2WAL A;  3LWR C;  3CPQ A;  1VQO F;  3CCU F;  3JAM M;  2BO1 A;  1QVG F;  3NK7 A;  3CMA F;  3N4Y A;  3CCJ F;  1Q81 H;  1IPA A;  2KTU A;  2VGM A;  3VMF B;  4TZZ A;  2JNB A;  3CCS F;  5EWR A;  1Q82 H;  3O85 A;  3J81 M;  5G4U C;  3E20 B;  2QA4 F;  1CN7 A;  2OTJ F;  5IT9 M;  4BY9 D;  3I55 F;  3CC7 F;  2QI2 A;  5FLX M;  5GAN K;  3I56 F;  1YIT F;  1VQ7 F;  1W41 A;  1GO1 A;  3CXC F;  1QVF F;  1YJN F;  3RA6 A;  3NMU C;  5GIP C;  1VQ9 F;  1VQN F;  1KQS F;  4C4W C;  1W3E X;  1X7P A;  1W2B F;  1M90 H;  3SIV A;  3J80 M;  3LWV C;  1YIJ F;  3JCM M;  3NVI B;  5GAP K;  5GIN C;  2HVY D;  3PAF A;  1YJ9 F;  3CCV F;  1DT9 A;  1W40 A;  1RLG A;  3SIU A;  2CZW A;  1GO0 A;  1VQ8 F;  3HJW C;  1VQ6 F;  3J7A R;  1JJ2 F;  3CD6 F;  1XBI A;  3AGK A;  3CG6 A;  3OBY A;  2I6D A;  3G4S F;  2LBX A;  3G6E F;  1VQ4 F;  3MCA B;  1RA4 A;  1VQL F;  1KD1 H;  2OHW A;  1X7O A;  1H7M A;  2FC3 A;  3CPW F;  3CCM F;  3CCE F;  1K8A H;  3LWO C;  1M1K H;  2KTV A;  4NUT A;  5EO3 A;  1VQP F;  3ON1 A;  3LWP C;  1PXW A;  3NVK E;  3OW2 F;  5DCV A;  3E1Y A;  1ZWZ A;  1VQM F;  3PLA C;  1NJI H;  3HAX D; 
#chains in the Genus database with same CATH topology
 3S03 A;  5LA6 A;  5G4V C;  5C8Y B;  3CC2 F;  2IQQ A;  3RYF B;  3HKD A;  2VGN A;  2KG4 A;  1E7K A;  1Q7Y H;  4BW0 B;  3GTZ A;  3Q8H A;  2LBT A;  1KC8 H;  3LFO A;  3IR9 A;  1FFX A;  3E22 A;  4TV8 A;  1SA0 A;  3CB2 A;  3N4Z A;  4LCK A;  4B45 A;  5LP6 A;  5FJ4 C;  4X20 B;  5J2T A;  3WGL A;  2LBW A;  1YJW F;  4LNU A;  3HKE B;  1W55 A;  3RYC A;  3CCL F;  4BT5 A;  1N8R H;  2ZOV A;  5JH7 A;  4BT4 A;  1Q86 H;  3JAK A;  3MDO A;  3UT5 B;  2UYK A;  4NWO B;  1XRG A;  4X1K B;  2HP0 A;  3EOR A;  3JAT A;  1T0K B;  4BT6 A;  5ITZ A;  2CW4 A;  1VK3 A;  2GVI A;  2Q1X A;  3CCU F;  1GX1 A;  2PHN A;  3IMP A;  3JAS B;  4B46 A;  3DC2 A;  3MBM A;  4RQO A;  3NK7 A;  4WBN B;  1IPA A;  2KTU A;  3VMF B;  2VAP A;  3TD4 A;  5FNV A;  5G4U C;  2Z01 A;  3S0Y A;  1CN7 A;  4KWE A;  2UYN A;  3CC7 F;  3HKB B;  1W57 A;  5FLX M;  1JFF B;  3WPX A;  3GHZ A;  4PWT A;  2GLZ A;  1U40 A;  2VAW A;  4XCQ A;  5C8Y A;  3S02 A;  3N2K B;  3RA6 A;  4G4Y A;  1X7P A;  1W2B F;  3J80 M;  3LWV C;  4X1I A;  2HS3 A;  4G4W A;  4O4H B;  5EYP B;  5B8F A;  1VQV A;  5KX5 A;  3PAF A;  3C9T A;  1DT9 A;  1IV4 A;  4M8I A;  4IIJ B;  4X20 A;  5JVD A;  1RLG A;  3MCQ A;  1TUB A;  5JQG B;  2CZW A;  1T0A A;  4EB6 A;  1OFU A;  3WJP A;  2YXZ A;  4HNA A;  3D00 A;  5KMG B;  3WGM A;  4DRX B;  2CWJ A;  2RHL A;  5MN6 A;  3DDN A;  5J2U B;  3CG6 A;  5EZY A;  3LDT A;  3MCA B;  3RYI B;  3M84 A;  3IEW A;  2I6R A;  3CCM F;  2MQE A;  1QD9 A;  3LYB A;  4O2B A;  3IKF A;  2HRU A;  5GON B;  3CYQ A;  3PLA C;  3HAX D;  1W5A A;  1CLI A;  2ALE A;  3IKE A;  3G71 F;  3V7E A;  4C81 A;  3L7Q A;  4G4V A;  3CME F;  5EB1 B;  3VCZ A;  4DXD A;  3LWQ C;  5CA0 A;  3ZO8 A;  2H8C A;  2HS4 A;  2RHO A;  4U3J A;  1U3P A;  1X52 A;  1VQ5 F;  3GYQ A;  1VQK F;  3JAR B;  3JAW B;  3OBW A;  3WXM B;  1KNK A;  5EB0 A;  1FNJ A;  4YJ3 A;  1QU9 A;  1IV2 A;  4IIJ A;  3ZP4 A;  3NK6 A;  5JQG A;  3JVH A;  2IG8 A;  3QHD A;  5GIO C;  3D01 A;  4C8I A;  2QEX F;  3RA5 A;  4DRX A;  2WAL A;  5LYJ A;  1ONI A;  1TVK A;  3JAM M;  3K12 A;  5LXT B;  1QVG F;  3HKC B;  4U39 A;  4X1Y B;  3N4Y A;  1U43 A;  2VGM A;  2JNB A;  5EWR A;  2BTU A;  3JAL B;  2AIZ P;  3VTI C;  3IEQ A;  4I55 B;  4BY9 D;  1IV3 A;  1W5B A;  2QI2 A;  4I50 A;  5GAN K;  2Q1Y A;  4F6R B;  1RLU A;  3I56 F;  1YIT F;  1VQ7 F;  4ZOL B;  3V3T A;  5CA1 B;  5IYZ B;  2R6R 1;  1YJN F;  1Q8R A;  1VQ9 F;  1VQN F;  5HXZ A;  5LP6 C;  5HY4 A;  4O4L A;  1YIJ F;  1QAH A;  5GAP K;  4FFB A;  4YJ2 B;  3VYT C;  1H47 A;  3ESJ A;  3I3F A;  1NQ3 A;  1VHA A;  5BMV A;  5MN5 A;  1COM A;  1W40 A;  5IJ0 B;  1J7H A;  3WJR A;  3ZOP A;  4IHJ B;  1VQ8 F;  3N2G B;  1U3L A;  2BTO A;  4G4Z A;  4TV9 B;  4ERH A;  4ZI7 A;  3K2X A;  2RHJ A;  3CD6 F;  4ZHY B;  1XBI A;  3AGK A;  3OBY A;  4ZHQ B;  2EWC A;  2ZAU A;  3RYH B;  3CPW F;  3RYF A;  3CCE F;  5CB4 B;  2ZVZ A;  1K8A H;  2KTV A;  3FD6 A;  3VYS C;  3VO8 A;  3ON1 A;  1ODE A;  2ZVY A;  3OW2 F;  3E1Y A;  4ZK7 A;  1ZWZ A;  3FBA A;  4I4T B;  5JCO A;  5HXU A;  3WGJ A;  4I55 A;  2CVL A;  2VAM A;  3HKE A;  5HY0 A;  4G88 A;  1H48 A;  2BTQ B;  3OON A;  3R0P A;  4O2A B;  4F6R A;  1FNK A;  1NMU B;  1UI9 A;  3K14 A;  5HP7 A;  1JN1 A;  5HY2 A;  3UT5 A;  4X3M A;  1UFY A;  3WGK A;  1K9M H;  4X1K A;  4G4X A;  3LME A;  3VOB A;  4BVQ A;  3CCQ F;  2PMP A;  1W58 1;  4TUY B;  4O4J B;  2V9Y A;  5EIB C;  5JCO C;  3S06 A;  2HP3 A;  3I7T A;  3JAS A;  5IJ9 B;  3V7Q A;  2AIF A;  4YJ2 A;  4WBN A;  5LA6 B;  5HP8 A;  3V4D A;  1SDS A;  5IJ0 A;  3RE3 A;  2YYE A;  3HKD B;  2HRY A;  3QTY A;  3CCR F;  3HKB A;  1JFF A;  1KNJ A;  1Z5W A;  4RHA A;  2RHH A;  3VI6 A;  2UYJ A;  1FFX B;  3E22 B;  3CPQ A;  4TV8 B;  1SA0 B;  4ZHQ A;  1VQO F;  3N2K A;  5LP6 B;  2BO1 A;  5J2T B;  1XV2 A;  3CMA F;  1Q81 H;  2VXY A;  4LNU B;  4TZZ A;  3CCS F;  5EYP A;  4O4H A;  3RYC B;  3S0H A;  1Q82 H;  5LOV B;  3M4S A;  5AVM A;  1XHO A;  2QA4 F;  2OTJ F;  3JAK B;  4I4T A;  2HP0 B;  2K1S A;  3JAT B;  5ITZ B;  1W41 A;  1GO1 A;  3CXC F;  2F9Z C;  3NMU C;  5GIP C;  5KMG A;  2Z1U A;  3FD5 A;  4C4W C;  1KQS F;  2Z1F A;  5J2U A;  3F6M A;  2L26 A;  3SIV A;  3RYI A;  3NVI B;  5GIN C;  2HVY D;  2IAF A;  2UYN B;  2Z1E A;  1RQ2 A;  3KJJ A;  2AMT A;  3K0T A;  3WPW A;  1IV1 A;  1VQ6 F;  3B6N A;  4O4I B;  5GON A;  3MQW A;  4BT2 A;  5EAZ A;  1JJ2 F;  2I6D A;  3P10 A;  2LBX A;  3F0D A;  3G4S F;  2ZF8 A;  2HQS C;  4X1I B;  2LCA A;  3KE1 A;  3P4E A;  1KD1 H;  1X7O A;  4BVS A;  3S0W A;  3TD3 A;  3HWU A;  5KX5 B;  1VQL F;  3LWO C;  1DBF A;  1M1K H;  4NQ3 A;  4NUT A;  5EO3 A;  5JVD B;  2B33 A;  1TUB B;  3JAR A;  3ZP7 A;  5HWE A;  3JAW A;  3VYU C;  2ZOD A;  3C8L A;  3C9S A;  1PXW A;  3VOA A;  3NVK E;  5DCV A;  4EB6 B;  4HNA B;  5LOV A;  1NJI H;  2CSL A;  1PF5 A;  2QTP A;  3ERN A;  3CC4 F;  3QUW A;  1X25 A;  5EZY B;  4E6E A;  3C9U A;  3WJQ A;  4EI9 A;  1K73 H;  2HX0 A;  3FFM A;  5EIB D;  1S72 F;  4BT3 A;  1YI2 F;  4O2B B;  1YQN A;  2OTL F;  2GZL A;  3F0F A;  2HS0 A;  5A2Q M;  2OZB A;  1GZ0 A;  3ELC A;  1CK2 A;  4X3L A;  5LXT A;  3HKC A;  4X1Y A;  1R1M A;  4BT7 A;  5MN4 A;  3U0O A;  4ZHW A;  2P6Y A;  3JAL A;  2N48 A;  1YHQ F;  4C8E A;  2Z1T A;  1W5E A;  4R40 B;  1OAP A;  2UYP A;  3WGN A;  3BYQ A;  5CA0 B;  4O4I A;  1W42 A;  4U3J B;  3C9R A;  5HY1 A;  4ZOL A;  5CA1 A;  5IYZ A;  3LWR C;  2G9I A;  1VH8 A;  3HTN A;  3CCJ F;  4YJ3 B;  2H6L A;  2OTM A;  3F0G A;  3O85 A;  3J81 M;  3E20 B;  2FGY A;  1JD1 A;  1Z5V A;  5IT9 M;  3I55 F;  2CHS A;  3CYP B;  4EI7 A;  4B5C A;  5LYJ B;  3D54 A;  4IHJ A;  3N2G A;  1QVF F;  4TV9 A;  1TVK B;  3T80 A;  4ZHV A;  4BVR A;  1W3E X;  3KJK A;  3M1X A;  4BVT A;  1SZQ A;  1M90 H;  3P0Z A;  3FPI A;  3RYH A;  3JCM M;  2KGW A;  2UZH A;  5CB4 A;  1YJ9 F;  3KHN A;  3CCV F;  3F0E A;  4I50 B;  3KIZ A;  4C82 A;  2DT4 A;  3SIU A;  1W59 A;  5JH7 B;  1GO0 A;  1W5F A;  3HJW C;  1JY8 A;  2R75 1;  4B62 A;  3J7A R;  2CHT A;  4C8G A;  1VQ4 F;  3G6E F;  4O4L B;  1RA4 A;  1YGY A;  2DYY A;  2RB9 A;  2H8E A;  2OHW A;  2FC3 A;  1H7M A;  4O2A A;  4EI8 A;  4FFB B;  2W8B C;  5BMV B;  3TD5 A;  1VQP F;  1RQ7 A;  5FNV B;  4TUY A;  4O4J A;  2NMU A;  3LWP C;  1VQM F;  5IJ9 A;  3VIU A;  1FSZ A;  4ZI7 B; 
#chains in the Genus database with same CATH homology
 5HXU A;  2ALE A;  5G4V C;  3CC4 F;  5HY0 A;  3CC2 F;  1K73 H;  4EI9 A;  3G71 F;  3V7E A;  3CME F;  1NMU B;  3FFM A;  5HY2 A;  2VGN A;  2KG4 A;  3LWQ C;  1S72 F;  4X3M A;  1K9M H;  1E7K A;  1Q7Y H;  4BW0 B;  1VQ5 F;  1X52 A;  1YI2 F;  3GYQ A;  4BVQ A;  3CCQ F;  3LFO A;  1KC8 H;  1VQK F;  2OTL F;  3IR9 A;  3OBW A;  3N4Z A;  4LCK A;  2OZB A;  5A2Q M;  3WXM B;  1GZ0 A;  4X3L A;  1CK2 A;  3V7Q A;  5FJ4 C;  2AIF A;  2LBW A;  1YJW F;  1SDS A;  3CCL F;  3NK6 A;  1YHQ F;  1N8R H;  3CCR F;  1Q86 H;  5GIO C;  1W42 A;  2QEX F;  3RA5 A;  1T0K B;  5HY1 A;  3VI6 A;  2WAL A;  3LWR C;  3CPQ A;  1VQO F;  3CCU F;  3JAM M;  2BO1 A;  1QVG F;  3NK7 A;  3CMA F;  3N4Y A;  3CCJ F;  1Q81 H;  1IPA A;  2KTU A;  2VGM A;  3VMF B;  4TZZ A;  2JNB A;  3CCS F;  5EWR A;  1Q82 H;  3O85 A;  3J81 M;  5G4U C;  3E20 B;  2FGY A;  2QA4 F;  1CN7 A;  2OTJ F;  5IT9 M;  4BY9 D;  3I55 F;  3CC7 F;  2QI2 A;  5FLX M;  5GAN K;  4EI7 A;  2GLZ A;  3I56 F;  1YIT F;  3V3T A;  4XCQ A;  1W41 A;  1VQ7 F;  1GO1 A;  3CXC F;  1QVF F;  2F9Z C;  1YJN F;  3RA6 A;  3NMU C;  5GIP C;  4BVR A;  1VQ9 F;  1VQN F;  1KQS F;  4C4W C;  5HXZ A;  1W3E X;  1X7P A;  4BVT A;  1W2B F;  1M90 H;  3SIV A;  5HY4 A;  3J80 M;  3LWV C;  1YIJ F;  3JCM M;  3NVI B;  5GAP K;  5GIN C;  2HVY D;  3PAF A;  1YJ9 F;  3CCV F;  1DT9 A;  1W40 A;  1RLG A;  3SIU A;  2CZW A;  1GO0 A;  1VQ8 F;  3HJW C;  1VQ6 F;  3D00 A;  3J7A R;  1JJ2 F;  3CD6 F;  1XBI A;  3AGK A;  3CG6 A;  3OBY A;  2I6D A;  3G4S F;  2LBX A;  3G6E F;  1VQ4 F;  3MCA B;  1RA4 A;  1VQL F;  1KD1 H;  2OHW A;  1X7O A;  1H7M A;  2FC3 A;  4BVS A;  4EI8 A;  3CPW F;  3CCM F;  3CCE F;  1K8A H;  3LWO C;  1M1K H;  2KTV A;  4NQ3 A;  4NUT A;  5EO3 A;  1VQP F;  3ON1 A;  5HWE A;  3LWP C;  1PXW A;  3NVK E;  3OW2 F;  5DCV A;  3E1Y A;  1ZWZ A;  1VQM F;  3PLA C;  1NJI H;  3HAX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...