3J7AR

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
98
Chain Sequence
VTAIQKVIKNAHVHDGLKIGIREVIKSIESQEAKVCFLSDVCSEPAYKKLITTLCAEMVQNDSKDLGHWAGLFIIGASSVAVVDFGEDSAEKDFLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 22
structure length 98
sequence length 114
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3j7aR00
3LWRC 2JNBA 3OW2F 1K73H 3N4YA 3CG6A 3CXCF 3CC7F 1W40A 1Q81H 3NMUC 1PXWA 2KG4A 1E7KA 2CZWA 1VQ4F 3V7EA 3G71F 2ALEA 1VQ8F 3OBWA 1KC8H 1QVFF 3OBYA 5GINC 1DT9A 2WALA 1VQOF 1NJIH 2FC3A 1YITF 3CCSF 1ZWZA 3VMFB 1W41A 3CCEF 1N8RH 5FJ4C 5EWRA 3HJWC 2I6DA 1RA4A 5GAPK 1GO1A 2KTVA 3CMAF 3CD6F 1CN7A 5GIPC 3SIVA 3CCJF 2OHWA 3RA5A 1W42A 3V7QA 5IT9M 3J80M 4X3MA 1VQLF 3JCMM 1XBIA 3I56F 3LFOA 3LWPC 4X3LA 5GANK 3CPWF 3MCAB 1VQ5F 1VQ9F 3CCUF 1VQKF 3GYQA 3CPQA 4BY9D 3PLAC 2OZBA 1T0KB 1IPAA 3J7AR 1Q86H 2LBXA 1K8AH 3O85A 2VGNA 5GIOC 1YI2F 2AIFA 5A2QM 3NVIB 1GZ0A 3I55F 3CCLF 4BW0B 5DCVA 1S72F 1M90H 3CCVF 3LWVC 2LBWA 3LWQC 1VQMF 1KD1H 2BO1A 3NK7A 3LWOC 1YHQF 2QI2A 3CCRF 1W2BF 2OTJF 1X7OA 3VI6A 1YJWF 3E20B 3ON1A 3E1YA 1KQSF 3CMEF 2KTUA 1X7PA 1YJ9F 3FFMA 5EO3A 3HAXD 1H7MA 1VQNF 3G6EF 3CC4F 3N4ZA 4TZZA 1CK2A 1Q7YH 1VQ7F 1VQPF 3CCMF 2QA4F 1JJ2F 1GO0A 3NVKE 3PAFA 1K9MH 3G4SF 4NUTA 1RLGA 1X52A 2VGMA 1M1KH 1YJNF 3CC2F 3AGKA 1W3EX 3CCQF 3RA6A 3SIUA 1QVGF 2OTLF 4C4WC 2QEXF 3IR9A 5FLXM 3WXMB 1SDSA 2HVYD 1VQ6F 3NK6A 4LCKA 5G4UC 1Q82H 5G4VC 3J81M 1YIJF 3JAMM 1NMUB
chains in the Genus database with same CATH superfamily
2ZVZA 5MN4A 1U3LA 1K73H 2LCAA 5BMVB 5ITZA 3RYCA 2Z1EA 1RQ7A 1E7KA 4X1KB 4B46A 1VQ4F 3WGJA 4I4TB 3G71F 2ALEA 3OBWA 3C8LA 2UYNA 1H48A 2YYEA 3M1XA 1DT9A 3ERNA 2HQSC 2DYYA 4ZI7A 1FNKA 3U0OA 4O4IA 4E6EA 2CSLA 2G9IA 4ERHA 5EWRA 2CWJA 1JFFB 4B45A 2KTVA 5IJ0A 3CD6F 1W59A 3SIVA 1W55A 4X1IA 3P0ZA 4BT5A 3MQWA 3V7QA 3N2KA 4O4HB 2UYJA 4IIJA 5CA0A 2CVLA 1IV4A 1QAHA 3C9UA 3E22A 1VQLF 2W8BC 4U3JA 3LFOA 3LWPC 4X3LA 3MCAB 1VQ9F 4IHJB 1VQKF 1KNKA 3GYQA 3CB2A 4C81A 5LA6B 3KJKA 3R0PA 4X1YB 1K8AH 2FGYA 3C9SA 2AIFA 1OFUA 1UFYA 3WGNA 5HXZA 4YJ2A 3WGKA 4BW0B 5DCVA 3LYBA 1Q8RA 3LWVC 2LBWA 2GLZA 3FD6A 3TD3A 3S02A 3NK7A 1SA0B 1RLUA 1X7OA 3K14A 4X20B 2Z1FA 3VI6A 2QTPA 2BTQB 4WBNA 3ON1A 3E1YA 1KQSF 3GHZA 3FFMA 2RHOA 4YJ3A 1H47A 1T0AA 5LYJA 3T80A 3HKCA 2ZAUA 5MN5A 4BVQA 2CHTA 3WJQA 3VTIC 1GO0A 5IJ9A 2IAFA 5FNVA 5ITZB 4RHAA 2H8EA 1OAPA 2VGMA 2L26A 5LP6C 3CC2F 3AGKA 4I50A 3S0HA 3RA6A 2BTUA 4HNAA 5LOVB 2VAPA 3IR9A 1TVKB 2HRUA 4LCKA 1ODEA 2ZODA 1W5BA 3ESJA 5GONA 3JAMM 1R1MA 2CW4A 1NMUB 1SZQA 5KMGA 4O4LA 3F6MA 3OW2F 4FFBA 4TV9A 3CG6A 3K0TA 4ZHQA 4XCQA 4BVRA 5HP8A 1Q81H 1FFXA 4DRXA 5MN6A 3EORA 1U3PA 3JAKA 2MQEA 1KC8H 1QVFF 5GINC 3N2KB 1W57A 4IIJB 5CA0B 3E22B 2WALA 4U3JB 3BYQA 4ZHWA 2H8CA 2OTMA 5JVDA 2FC3A 3VYUC 1YQNA 2KGWA 3CCSF 2RHJA 1ONIA 3V4DA 1KNJA 1N8RH 5FJ4C 1Z5VA 4KWEA 3UT5B 4YJ2B 3S0WA 4TUYB 2IG8A 3I3FA 3VYSC 3IEQA 4RQOA 3RE3A 2OHWA 2HS3A 2HS4A 1XBIA 1GX1A 3KE1A 3JCMM 3F0FA 4I55A 1VQ5F 3CCUF 5KX5B 3JVHA 4LNUA 2OZBA 4TV8A 4WBNB 1IPAA 3J7AR 2LBXA 2VGNA 1YI2F 1YGYA 3DC2A 3HKCB 4O4JB 1JD1A 4BT3A 3CCLF 3S06A 5FNVB 1M90H 3ZO8A 3CCVF 4G4VA 4G88A 3WJRA 2BO1A 2PHNA 3F0DA 1X25A 4ZOLB 3LWOC 2R6R1 3C9RA 2KTUA 3RYHA 2PMPA 3JATA 5GONB 5B8FA 3TD5A 3G6EF 5KMGB 4U39A 5LP6A 2HS0A 5CA1B 4TV9B 4C8GA 2HP0A 3NVKE 1XHOA 2HX0A 1RQ2A 4BT6A 3MDOA 3V3TA 1FFXB 1RLGA 4DRXB 3IEWA 5JCOA 2Z01A 3ZOPA 3KJJA 3JAKB 1W3EX 3HKBA 3QUWA 4O2BA 4O2AB 4BT7A 2OTLF 3K12A 4C4WC 5HWEA 2Q1YA 3JASA 5LXTA 3WXMB 3CYPB 2HVYD 1VQ6F 3KIZA 5EB0A 3MBMA 5G4UC 1Q82H 3QHDA 3FBAA 5G4VC 4EB6B 5JVDB 1CLIA 1TUBB 5C8YB 3HKDA 5IYZB 3VOBA 3N4YA 3CC7F 3ZP4A 1UI9A 5EIBC 1W40A 3NMUC 4X1KA 5EB1B 2KG4A 2CZWA 2HRYA 3RYCB 5HY1A 3V7EA 1VQ8F 3OBYA 3LDTA 3S03A 3FPIA 3M4SA 3TD4A 2UYNB 3DDNA 5JQGA 3WGMA 3Q8HA 1YITF 5HY2A 1ZWZA 1QD9A 3RYFA 4ZI7B 4ZHYB 3CCEF 4O4IB 5EZYA 1Z5WA 2VAMA 3HJWC 2I6DA 4R40B 5GAPK 2V9YA 2Z1UA 3F0GA 2YXZA 1W5AA 3D01A 5GIPC 2EWCA 4O4HA 5IJ0B 1IV2A 4EI8A 3CCJF 2R751 4X1IB 4EI9A 1W581 4X3MA 3I56F 4IHJA 2N48A 5GANK 5LA6A 3N2GA 3CPQA 2UYKA 1T0KB 2ZOVA 2K1SA 5HY0A 1Q86H 2AMTA 3WJPA 4G4ZA 5GIOC 3NVIB 1GZ0A 3I55F 2HP0B 4ZK7A 2I6RA 3GTZA 3ELCA 2H6LA 1VQMF 1IV3A 1DBFA 1KD1H 3JAWA 3HKEA 3LMEA 1YHQF 2QI2A 3CCRF 1W2BF 2OTJF 4O2BB 3M84A 3E20B 3L7QA 2GZLA 2AIZP 1VK3A 1X7PA 3HTNA 5EO3A 1VHAA 1H7MA 1VQNF 3CC4F 1J7HA 3N4ZA 4TZZA 1CK2A 1VQ7F 2P6YA 3HKDB 2VXYA 4DXDA 4YJ3B 2QA4F 3WGLA 3WPWA 5LYJB 3IKEA 1K9MH 2Q1XA 3G4SF 5IJ9B 5HP7A 1NQ3A 4F6RA 1X52A 3P4EA 1YJNF 5J2UA 1W5EA 3VYTC 1U43A 3CCQF 4B5CA 5LOVA 3SIUA 1COMA 1XRGA 4I50B 2QEXF 1TVKA 5FLXM 1SDSA 1W5FA 3KHNA 3NK6A 4HNAB 5EYPA 3JARA 5JQGB 2B33A 3LWRC 2HP3A 2JNBA 1JY8A 5JH7A 3RYFB 3CXCF 3B6NA 4O4LB 3D54A 5EZYB 4FFBB 5AVMA 3D00A 4ZHQB 3S0YA 1PXWA 3RYIA 1U40A 4G4WA 5J2TA 3VOAA 2DT4A 5CB4A 2ZF8A 3ZP7A 4NQ3A 2UZHA 1VQOF 5EAZA 3JALA 3N2GB 1NJIH 3C9TA 2GVIA 3VMFB 1W41A 4G4YA 5BMVA 3UT5A 3WPXA 2ZVYA 4EI7A 4TUYA 1RA4A 1VQVA 1GO1A 2Z1TA 3CMAF 4PWTA 1CN7A 4I4TA 1VH8A 3RA5A 1W42A 5IT9M 3J80M 3F0EA 3JAWB 3HKEB 2IQQA 5KX5A 4BT4A 4G4XA 3CPWF 4BY9D 3PLAC 4I55B 1IV1A 4LNUB 4TV8B 3O85A 3OONA 4O4JA 5HXUA 5A2QM 1JN1A 1JFFA 4BT2A 2F9ZC 2RHHA 3MCQA 1PF5A 4M8IA 1S72F 2CHSA 3VIUA 3FD5A 3LWQC 4F6RB 4ZOLA 2UYPA 5J2UB 3CYQA 4BVTA 1QU9A 2RB9A 3IMPA 5JCOC 1YJWF 2NMUA 3CMEF 4X1YA 4C8IA 1YJ9F 5EYPB 3JARB 3HAXD 3VCZA 5CA1A 1Q7YH 4BVSA 3RYHB 2BTOA 3JATB 1VQPF 5JH7B 3CCMF 1JJ2F 2LBTA 5LP6B 3PAFA 3QTYA 3K2XA 3P10A 4NUTA 3HWUA 3RYIB 1FNJA 4C8EA 4ZHVA 3IKFA 5J2TB 1M1KH 4C82A 5HY4A 4O2AA 1SA0A 1XV2A 2RHLA 5CB4B 4B62A 1QVGF 5EIBD 4X20A 1FSZA 3HKBB 4NWOB 3I7TA 4EB6A 1TUBA 3VO8A 2VAWA 3JASB 5C8YA 5LXTB 3JALB 3J81M 5IYZA 1YIJF
chains in the Genus database with same CATH topology
3LWRC 2JNBA 3OW2F 1K73H 3N4YA 3CG6A 3CXCF 3CC7F 4XCQA 4BVRA 3D00A 1W40A 1Q81H 3NMUC 1PXWA 2KG4A 1E7KA 2CZWA 1VQ4F 5HY1A 3G71F 2ALEA 1VQ8F 3V7EA 3OBWA 1KC8H 1QVFF 3OBYA 5GINC 1DT9A 2WALA 4NQ3A 1VQOF 1NJIH 2FC3A 1YITF 3CCSF 5HY2A 1ZWZA 3VMFB 1W41A 3CCEF 4EI7A 1N8RH 5FJ4C 5EWRA 3HJWC 2I6DA 1RA4A 5GAPK 1GO1A 2KTVA 3CMAF 3CD6F 1CN7A 5GIPC 3SIVA 4EI8A 3CCJF 2OHWA 3RA5A 1W42A 3V7QA 4EI9A 5IT9M 3J80M 4X3MA 1VQLF 3JCMM 1XBIA 3I56F 3LFOA 3LWPC 4X3LA 5GANK 3CPWF 3MCAB 1VQ5F 1VQ9F 3CCUF 1VQKF 3GYQA 3CPQA 4BY9D 3PLAC 2OZBA 1T0KB 5HY0A 1IPAA 3J7AR 1Q86H 2LBXA 1K8AH 3O85A 2FGYA 5HXUA 2VGNA 5GIOC 1YI2F 2AIFA 5A2QM 5HXZA 3NVIB 1GZ0A 2F9ZC 3I55F 3CCLF 4BW0B 5DCVA 1S72F 1M90H 3CCVF 3LWVC 2LBWA 3LWQC 2GLZA 1VQMF 1KD1H 2BO1A 3NK7A 4BVTA 3LWOC 1YHQF 2QI2A 3CCRF 1W2BF 2OTJF 1X7OA 3VI6A 1YJWF 3E20B 3ON1A 3E1YA 1KQSF 3CMEF 2KTUA 1X7PA 1YJ9F 3FFMA 5EO3A 3HAXD 1H7MA 1VQNF 3G6EF 3CC4F 3N4ZA 4TZZA 1CK2A 1Q7YH 1VQ7F 4BVSA 1VQPF 3CCMF 4BVQA 2QA4F 1JJ2F 1GO0A 3NVKE 3PAFA 1K9MH 3G4SF 3V3TA 4NUTA 1RLGA 1X52A 2VGMA 1M1KH 1YJNF 5HY4A 3CC2F 3AGKA 1W3EX 3CCQF 3RA6A 3SIUA 1QVGF 2OTLF 4C4WC 5HWEA 2QEXF 3IR9A 5FLXM 3WXMB 1SDSA 2HVYD 1VQ6F 3NK6A 4LCKA 5G4UC 1Q82H 5G4VC 3J81M 1YIJF 3JAMM 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR C;  2JNB A;  3OW2 F;  1K73 H;  3N4Y A;  3CG6 A;  3CXC F;  3CC7 F;  1W40 A;  1Q81 H;  3NMU C;  1PXW A;  2KG4 A;  1E7K A;  2CZW A;  1VQ4 F;  3V7E A;  3G71 F;  2ALE A;  1VQ8 F;  3OBW A;  1KC8 H;  1QVF F;  3OBY A;  5GIN C;  1DT9 A;  2WAL A;  1VQO F;  1NJI H;  2FC3 A;  1YIT F;  3CCS F;  1ZWZ A;  3VMF B;  1W41 A;  3CCE F;  1N8R H;  5FJ4 C;  5EWR A;  3HJW C;  2I6D A;  1RA4 A;  5GAP K;  1GO1 A;  2KTV A;  3CMA F;  3CD6 F;  1CN7 A;  5GIP C;  3SIV A;  3CCJ F;  2OHW A;  3RA5 A;  1W42 A;  3V7Q A;  5IT9 M;  3J80 M;  4X3M A;  1VQL F;  3JCM M;  1XBI A;  3I56 F;  3LFO A;  3LWP C;  4X3L A;  5GAN K;  3CPW F;  3MCA B;  1VQ5 F;  1VQ9 F;  3CCU F;  1VQK F;  3GYQ A;  3CPQ A;  4BY9 D;  3PLA C;  2OZB A;  1T0K B;  1IPA A;  3J7A R;  1Q86 H;  2LBX A;  1K8A H;  3O85 A;  2VGN A;  5GIO C;  1YI2 F;  2AIF A;  5A2Q M;  3NVI B;  1GZ0 A;  3I55 F;  3CCL F;  4BW0 B;  5DCV A;  1S72 F;  1M90 H;  3CCV F;  3LWV C;  2LBW A;  3LWQ C;  1VQM F;  1KD1 H;  2BO1 A;  3NK7 A;  3LWO C;  1YHQ F;  2QI2 A;  3CCR F;  1W2B F;  2OTJ F;  1X7O A;  3VI6 A;  1YJW F;  3E20 B;  3ON1 A;  3E1Y A;  1KQS F;  3CME F;  2KTU A;  1X7P A;  1YJ9 F;  3FFM A;  5EO3 A;  3HAX D;  1H7M A;  1VQN F;  3G6E F;  3CC4 F;  3N4Z A;  4TZZ A;  1CK2 A;  1Q7Y H;  1VQ7 F;  1VQP F;  3CCM F;  2QA4 F;  1JJ2 F;  1GO0 A;  3NVK E;  3PAF A;  1K9M H;  3G4S F;  4NUT A;  1RLG A;  1X52 A;  2VGM A;  1M1K H;  1YJN F;  3CC2 F;  3AGK A;  1W3E X;  3CCQ F;  3RA6 A;  3SIU A;  1QVG F;  2OTL F;  4C4W C;  2QEX F;  3IR9 A;  5FLX M;  3WXM B;  1SDS A;  2HVY D;  1VQ6 F;  3NK6 A;  4LCK A;  5G4U C;  1Q82 H;  5G4V C;  3J81 M;  1YIJ F;  3JAM M;  1NMU B; 
#chains in the Genus database with same CATH topology
 2ZVZ A;  5MN4 A;  1U3L A;  1K73 H;  2LCA A;  5BMV B;  5ITZ A;  3RYC A;  2Z1E A;  1RQ7 A;  1E7K A;  4X1K B;  4B46 A;  1VQ4 F;  3WGJ A;  4I4T B;  3G71 F;  2ALE A;  3OBW A;  3C8L A;  2UYN A;  1H48 A;  2YYE A;  3M1X A;  1DT9 A;  3ERN A;  2HQS C;  2DYY A;  4ZI7 A;  1FNK A;  3U0O A;  4O4I A;  4E6E A;  2CSL A;  2G9I A;  4ERH A;  5EWR A;  2CWJ A;  1JFF B;  4B45 A;  2KTV A;  5IJ0 A;  3CD6 F;  1W59 A;  3SIV A;  1W55 A;  4X1I A;  3P0Z A;  4BT5 A;  3MQW A;  3V7Q A;  3N2K A;  4O4H B;  2UYJ A;  4IIJ A;  5CA0 A;  2CVL A;  1IV4 A;  1QAH A;  3C9U A;  3E22 A;  1VQL F;  2W8B C;  4U3J A;  3LFO A;  3LWP C;  4X3L A;  3MCA B;  1VQ9 F;  4IHJ B;  1VQK F;  1KNK A;  3GYQ A;  3CB2 A;  4C81 A;  5LA6 B;  3KJK A;  3R0P A;  4X1Y B;  1K8A H;  2FGY A;  3C9S A;  2AIF A;  1OFU A;  1UFY A;  3WGN A;  5HXZ A;  4YJ2 A;  3WGK A;  4BW0 B;  5DCV A;  3LYB A;  1Q8R A;  3LWV C;  2LBW A;  2GLZ A;  3FD6 A;  3TD3 A;  3S02 A;  3NK7 A;  1SA0 B;  1RLU A;  1X7O A;  3K14 A;  4X20 B;  2Z1F A;  3VI6 A;  2QTP A;  2BTQ B;  4WBN A;  3ON1 A;  3E1Y A;  1KQS F;  3GHZ A;  3FFM A;  2RHO A;  4YJ3 A;  1H47 A;  1T0A A;  5LYJ A;  3T80 A;  3HKC A;  2ZAU A;  5MN5 A;  4BVQ A;  2CHT A;  3WJQ A;  3VTI C;  1GO0 A;  5IJ9 A;  2IAF A;  5FNV A;  5ITZ B;  4RHA A;  2H8E A;  1OAP A;  2VGM A;  2L26 A;  5LP6 C;  3CC2 F;  3AGK A;  4I50 A;  3S0H A;  3RA6 A;  2BTU A;  4HNA A;  5LOV B;  2VAP A;  3IR9 A;  1TVK B;  2HRU A;  4LCK A;  1ODE A;  2ZOD A;  1W5B A;  3ESJ A;  5GON A;  3JAM M;  1R1M A;  2CW4 A;  1NMU B;  1SZQ A;  5KMG A;  4O4L A;  3F6M A;  3OW2 F;  4FFB A;  4TV9 A;  3CG6 A;  3K0T A;  4ZHQ A;  4XCQ A;  4BVR A;  5HP8 A;  1Q81 H;  1FFX A;  4DRX A;  5MN6 A;  3EOR A;  1U3P A;  3JAK A;  2MQE A;  1KC8 H;  1QVF F;  5GIN C;  3N2K B;  1W57 A;  4IIJ B;  5CA0 B;  3E22 B;  2WAL A;  4U3J B;  3BYQ A;  4ZHW A;  2H8C A;  2OTM A;  5JVD A;  2FC3 A;  3VYU C;  1YQN A;  2KGW A;  3CCS F;  2RHJ A;  1ONI A;  3V4D A;  1KNJ A;  1N8R H;  5FJ4 C;  1Z5V A;  4KWE A;  3UT5 B;  4YJ2 B;  3S0W A;  4TUY B;  2IG8 A;  3I3F A;  3VYS C;  3IEQ A;  4RQO A;  3RE3 A;  2OHW A;  2HS3 A;  2HS4 A;  1XBI A;  1GX1 A;  3KE1 A;  3JCM M;  3F0F A;  4I55 A;  1VQ5 F;  3CCU F;  5KX5 B;  3JVH A;  4LNU A;  2OZB A;  4TV8 A;  4WBN B;  1IPA A;  3J7A R;  2LBX A;  2VGN A;  1YI2 F;  1YGY A;  3DC2 A;  3HKC B;  4O4J B;  1JD1 A;  4BT3 A;  3CCL F;  3S06 A;  5FNV B;  1M90 H;  3ZO8 A;  3CCV F;  4G4V A;  4G88 A;  3WJR A;  2BO1 A;  2PHN A;  3F0D A;  1X25 A;  4ZOL B;  3LWO C;  2R6R 1;  3C9R A;  2KTU A;  3RYH A;  2PMP A;  3JAT A;  5GON B;  5B8F A;  3TD5 A;  3G6E F;  5KMG B;  4U39 A;  5LP6 A;  2HS0 A;  5CA1 B;  4TV9 B;  4C8G A;  2HP0 A;  3NVK E;  1XHO A;  2HX0 A;  1RQ2 A;  4BT6 A;  3MDO A;  3V3T A;  1FFX B;  1RLG A;  4DRX B;  3IEW A;  5JCO A;  2Z01 A;  3ZOP A;  3KJJ A;  3JAK B;  1W3E X;  3HKB A;  3QUW A;  4O2B A;  4O2A B;  4BT7 A;  2OTL F;  3K12 A;  4C4W C;  5HWE A;  2Q1Y A;  3JAS A;  5LXT A;  3WXM B;  3CYP B;  2HVY D;  1VQ6 F;  3KIZ A;  5EB0 A;  3MBM A;  5G4U C;  1Q82 H;  3QHD A;  3FBA A;  5G4V C;  4EB6 B;  5JVD B;  1CLI A;  1TUB B;  5C8Y B;  3HKD A;  5IYZ B;  3VOB A;  3N4Y A;  3CC7 F;  3ZP4 A;  1UI9 A;  5EIB C;  1W40 A;  3NMU C;  4X1K A;  5EB1 B;  2KG4 A;  2CZW A;  2HRY A;  3RYC B;  5HY1 A;  3V7E A;  1VQ8 F;  3OBY A;  3LDT A;  3S03 A;  3FPI A;  3M4S A;  3TD4 A;  2UYN B;  3DDN A;  5JQG A;  3WGM A;  3Q8H A;  1YIT F;  5HY2 A;  1ZWZ A;  1QD9 A;  3RYF A;  4ZI7 B;  4ZHY B;  3CCE F;  4O4I B;  5EZY A;  1Z5W A;  2VAM A;  3HJW C;  2I6D A;  4R40 B;  5GAP K;  2V9Y A;  2Z1U A;  3F0G A;  2YXZ A;  1W5A A;  3D01 A;  5GIP C;  2EWC A;  4O4H A;  5IJ0 B;  1IV2 A;  4EI8 A;  3CCJ F;  2R75 1;  4X1I B;  4EI9 A;  1W58 1;  4X3M A;  3I56 F;  4IHJ A;  2N48 A;  5GAN K;  5LA6 A;  3N2G A;  3CPQ A;  2UYK A;  1T0K B;  2ZOV A;  2K1S A;  5HY0 A;  1Q86 H;  2AMT A;  3WJP A;  4G4Z A;  5GIO C;  3NVI B;  1GZ0 A;  3I55 F;  2HP0 B;  4ZK7 A;  2I6R A;  3GTZ A;  3ELC A;  2H6L A;  1VQM F;  1IV3 A;  1DBF A;  1KD1 H;  3JAW A;  3HKE A;  3LME A;  1YHQ F;  2QI2 A;  3CCR F;  1W2B F;  2OTJ F;  4O2B B;  3M84 A;  3E20 B;  3L7Q A;  2GZL A;  2AIZ P;  1VK3 A;  1X7P A;  3HTN A;  5EO3 A;  1VHA A;  1H7M A;  1VQN F;  3CC4 F;  1J7H A;  3N4Z A;  4TZZ A;  1CK2 A;  1VQ7 F;  2P6Y A;  3HKD B;  2VXY A;  4DXD A;  4YJ3 B;  2QA4 F;  3WGL A;  3WPW A;  5LYJ B;  3IKE A;  1K9M H;  2Q1X A;  3G4S F;  5IJ9 B;  5HP7 A;  1NQ3 A;  4F6R A;  1X52 A;  3P4E A;  1YJN F;  5J2U A;  1W5E A;  3VYT C;  1U43 A;  3CCQ F;  4B5C A;  5LOV A;  3SIU A;  1COM A;  1XRG A;  4I50 B;  2QEX F;  1TVK A;  5FLX M;  1SDS A;  1W5F A;  3KHN A;  3NK6 A;  4HNA B;  5EYP A;  3JAR A;  5JQG B;  2B33 A;  3LWR C;  2HP3 A;  2JNB A;  1JY8 A;  5JH7 A;  3RYF B;  3CXC F;  3B6N A;  4O4L B;  3D54 A;  5EZY B;  4FFB B;  5AVM A;  3D00 A;  4ZHQ B;  3S0Y A;  1PXW A;  3RYI A;  1U40 A;  4G4W A;  5J2T A;  3VOA A;  2DT4 A;  5CB4 A;  2ZF8 A;  3ZP7 A;  4NQ3 A;  2UZH A;  1VQO F;  5EAZ A;  3JAL A;  3N2G B;  1NJI H;  3C9T A;  2GVI A;  3VMF B;  1W41 A;  4G4Y A;  5BMV A;  3UT5 A;  3WPX A;  2ZVY A;  4EI7 A;  4TUY A;  1RA4 A;  1VQV A;  1GO1 A;  2Z1T A;  3CMA F;  4PWT A;  1CN7 A;  4I4T A;  1VH8 A;  3RA5 A;  1W42 A;  5IT9 M;  3J80 M;  3F0E A;  3JAW B;  3HKE B;  2IQQ A;  5KX5 A;  4BT4 A;  4G4X A;  3CPW F;  4BY9 D;  3PLA C;  4I55 B;  1IV1 A;  4LNU B;  4TV8 B;  3O85 A;  3OON A;  4O4J A;  5HXU A;  5A2Q M;  1JN1 A;  1JFF A;  4BT2 A;  2F9Z C;  2RHH A;  3MCQ A;  1PF5 A;  4M8I A;  1S72 F;  2CHS A;  3VIU A;  3FD5 A;  3LWQ C;  4F6R B;  4ZOL A;  2UYP A;  5J2U B;  3CYQ A;  4BVT A;  1QU9 A;  2RB9 A;  3IMP A;  5JCO C;  1YJW F;  2NMU A;  3CME F;  4X1Y A;  4C8I A;  1YJ9 F;  5EYP B;  3JAR B;  3HAX D;  3VCZ A;  5CA1 A;  1Q7Y H;  4BVS A;  3RYH B;  2BTO A;  3JAT B;  1VQP F;  5JH7 B;  3CCM F;  1JJ2 F;  2LBT A;  5LP6 B;  3PAF A;  3QTY A;  3K2X A;  3P10 A;  4NUT A;  3HWU A;  3RYI B;  1FNJ A;  4C8E A;  4ZHV A;  3IKF A;  5J2T B;  1M1K H;  4C82 A;  5HY4 A;  4O2A A;  1SA0 A;  1XV2 A;  2RHL A;  5CB4 B;  4B62 A;  1QVG F;  5EIB D;  4X20 A;  1FSZ A;  3HKB B;  4NWO B;  3I7T A;  4EB6 A;  1TUB A;  3VO8 A;  2VAW A;  3JAS B;  5C8Y A;  5LXT B;  3JAL B;  3J81 M;  5IYZ A;  1YIJ F; 
#chains in the Genus database with same CATH homology
 3LWR C;  2JNB A;  3OW2 F;  1K73 H;  3N4Y A;  3CG6 A;  3CXC F;  3CC7 F;  4XCQ A;  4BVR A;  3D00 A;  1W40 A;  1Q81 H;  3NMU C;  1PXW A;  2KG4 A;  1E7K A;  2CZW A;  1VQ4 F;  5HY1 A;  3G71 F;  2ALE A;  1VQ8 F;  3V7E A;  3OBW A;  1KC8 H;  1QVF F;  3OBY A;  5GIN C;  1DT9 A;  2WAL A;  4NQ3 A;  1VQO F;  1NJI H;  2FC3 A;  1YIT F;  3CCS F;  5HY2 A;  1ZWZ A;  3VMF B;  1W41 A;  3CCE F;  4EI7 A;  1N8R H;  5FJ4 C;  5EWR A;  3HJW C;  2I6D A;  1RA4 A;  5GAP K;  1GO1 A;  2KTV A;  3CMA F;  3CD6 F;  1CN7 A;  5GIP C;  3SIV A;  4EI8 A;  3CCJ F;  2OHW A;  3RA5 A;  1W42 A;  3V7Q A;  4EI9 A;  5IT9 M;  3J80 M;  4X3M A;  1VQL F;  3JCM M;  1XBI A;  3I56 F;  3LFO A;  3LWP C;  4X3L A;  5GAN K;  3CPW F;  3MCA B;  1VQ5 F;  1VQ9 F;  3CCU F;  1VQK F;  3GYQ A;  3CPQ A;  4BY9 D;  3PLA C;  2OZB A;  1T0K B;  5HY0 A;  1IPA A;  3J7A R;  1Q86 H;  2LBX A;  1K8A H;  3O85 A;  2FGY A;  5HXU A;  2VGN A;  5GIO C;  1YI2 F;  2AIF A;  5A2Q M;  5HXZ A;  3NVI B;  1GZ0 A;  2F9Z C;  3I55 F;  3CCL F;  4BW0 B;  5DCV A;  1S72 F;  1M90 H;  3CCV F;  3LWV C;  2LBW A;  3LWQ C;  2GLZ A;  1VQM F;  1KD1 H;  2BO1 A;  3NK7 A;  4BVT A;  3LWO C;  1YHQ F;  2QI2 A;  3CCR F;  1W2B F;  2OTJ F;  1X7O A;  3VI6 A;  1YJW F;  3E20 B;  3ON1 A;  3E1Y A;  1KQS F;  3CME F;  2KTU A;  1X7P A;  1YJ9 F;  3FFM A;  5EO3 A;  3HAX D;  1H7M A;  1VQN F;  3G6E F;  3CC4 F;  3N4Z A;  4TZZ A;  1CK2 A;  1Q7Y H;  1VQ7 F;  4BVS A;  1VQP F;  3CCM F;  4BVQ A;  2QA4 F;  1JJ2 F;  1GO0 A;  3NVK E;  3PAF A;  1K9M H;  3G4S F;  3V3T A;  4NUT A;  1RLG A;  1X52 A;  2VGM A;  1M1K H;  1YJN F;  5HY4 A;  3CC2 F;  3AGK A;  1W3E X;  3CCQ F;  3RA6 A;  3SIU A;  1QVG F;  2OTL F;  4C4W C;  5HWE A;  2QEX F;  3IR9 A;  5FLX M;  3WXM B;  1SDS A;  2HVY D;  1VQ6 F;  3NK6 A;  4LCK A;  5G4U C;  1Q82 H;  5G4V C;  3J81 M;  1YIJ F;  3JAM M;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...