3CCJF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccjF00
1GO1A 2AIFA 3NVIB 3WXMB 3CCSF 3NMUC 1X7OA 2QI2A 1XBIA 2I6DA 3RA5A 2CZWA 3PLAC 4X3MA 3E20B 3SIVA 4X3LA 2QA4F 3NK7A 3OBWA 1IPAA 2QEXF 3JCMM 3OW2F 3E1YA 1YIJF 3I55F 2OHWA 5GIOC 5GANK 1W40A 1N8RH 1SDSA 1GZ0A 5FLXM 1K8AH 3I56F 3HAXD 1VQ7F 3NK6A 1GO0A 2HVYD 3V7EA 4BW0B 1Q81H 3MCAB 3N4ZA 2VGNA 1QVGF 2OZBA 3CC2F 1W42A 3CMEF 1YJNF 5EWRA 1YI2F 3IR9A 1Q86H 5IT9M 3RA6A 3G4SF 3CMAF 1RLGA 4NUTA 1VQLF 3J81M 3V7QA 3N4YA 3JAMM 1KC8H 1PXWA 1X7PA 3LWOC 3HJWC 1KD1H 3SIUA 4LCKA 1VQ5F 4TZZA 3G6EF 1Q7YH 2KG4A 1VQ9F 1VQMF 2ALEA 2KTVA 5G4VC 2WALA 3CG6A 1E7KA 1W3EX 3J7AR 2VGMA 2OTLF 3LFOA 1S72F 3VMFB 1VQNF 1CK2A 2OTJF 3CCQF 2KTUA 3AGKA 1H7MA 3VI6A 5FJ4C 5G4UC 3CC4F 1M90H 5GAPK 1Q82H 1YHQF 3CCEF 1X52A 1NMUB 1T0KB 3CCMF 5GIPC 1NJIH 5A2QM 1VQ6F 3CCLF 5DCVA 3CCVF 1M1KH 3NVKE 1DT9A 2JNBA 3LWQC 3CXCF 3OBYA 3FFMA 5EO3A 1VQPF 3LWPC 3LWRC 3CPQA 3CCRF 1RA4A 3J80M 3PAFA 1VQ4F 1YJ9F 1W2BF 3CPWF 4C4WC 1VQ8F 3ON1A 4BY9D 1ZWZA 3GYQA 3G71F 1VQKF 5GINC 3LWVC 1YJWF 1CN7A 1QVFF 1JJ2F 2LBWA 3CCJF 1YITF 1K9MH 1W41A 3CCUF 1VQOF 1K73H 3CC7F 2FC3A 3CD6F 2BO1A 3O85A 2LBXA 1KQSF
chains in the Genus database with same CATH superfamily
2AIFA 3F0FA 4TUYA 3KJJA 4B45A 3CCSF 3RA5A 4DRXA 3PLAC 3SIVA 4X3LA 5B8FA 5IJ9A 1T0AA 2HX0A 3JAWB 4ZI7B 4U39A 3KJKA 3VCZA 2OHWA 2ZVZA 5GIOC 3D00A 3BYQA 4ZOLA 4O4LB 3RE3A 3HKEB 1XV2A 4FFBB 1XHOA 4ZI7A 3LMEA 2VGNA 1QVGF 4EI8A 4G4VA 1TVKB 5LXTB 2PMPA 5J2UA 1YI2F 5IYZA 2VXYA 3WGJA 3WGLA 3G4SF 4C82A 1JY8A 4NUTA 1VQLF 3J81M 3WJQA 5BMVB 5J2UB 1X7PA 3KHNA 3JATA 1JFFA 3E22A 4TZZA 1TUBA 3KIZA 3MCQA 1VQ9F 5HXUA 5BMVA 2ALEA 4WBNB 2H8EA 3JARB 1FNJA 2BTQB 4O4IA 5JQGB 1W3EX 2OTLF 4C81A 5HP8A 1VHAA 2RHOA 3HWUA 4X1KA 4BT3A 4BVSA 1H7MA 1W57A 3VI6A 5G4UC 3CC4F 3I3FA 4TV9A 4F6RA 5EYPB 3WJRA 5GONB 1YHQF 3CCEF 3V3TA 4BT7A 2MQEA 4X1KB 1T0KB 3CCMF 5MN6A 3F0GA 3C9TA 4BT4A 2YYEA 3MQWA 1IV4A 5LA6B 3CCLF 3WGKA 3HTNA 4RQOA 1VH8A 1M1KH 1IV2A 3LWQC 5EO3A 2HS0A 1XRGA 1VQ4F 1H48A 3VIUA 2YXZA 4O2BB 4C8EA 3IMPA 1J7HA 3HKCA 5EAZA 1QAHA 1RLUA 3DC2A 3VO8A 2NMUA 4X20A 1RQ7A 2LBWA 1KNJA 1ODEA 1YITF 3FPIA 4E6EA 2Z1TA 5JH7A 4YJ2A 3CC7F 2BO1A 2GLZA 5HY1A 4O4JA 1GX1A 1GO1A 3ERNA 3WXMB 3NVIB 1Q8RA 2CZWA 3E20B 2V9YA 3DDNA 3NK7A 4IHJB 1PF5A 3GHZA 4TV8B 2ZAUA 1U43A 1YIJF 5HXZA 3FD5A 1W40A 3HKDB 5IYZB 2QTPA 5LYJA 3K14A 1K8AH 3HAXD 1GO0A 2HVYD 4R40B 3N4ZA 2KGWA 5JCOA 2OZBA 4ERHA 3S0HA 1W42A 4O2AB 2CWJA 4I4TB 5EWRA 4HNAB 3S02A 1QU9A 2RB9A 1Q86H 5IJ0A 2DYYA 5EZYB 1SA0A 4U3JA 3JARA 4LNUA 3JASA 1PXWA 3LWOC 4X1YA 4HNAA 2HP0B 3L7QA 3SIUA 3RYHB 4LCKA 5CA0A 4BT6A 5MN4A 3M1XA 3C9RA 3RYIA 3FD6A 4TV9B 4ZHQA 2KTVA 3JALA 4C8GA 2WALA 3VYTC 3M84A 3CG6A 5CA0B 3LFOA 2R6R1 3TD5A 2UYNB 3ELCA 1CK2A 2Z1FA 3RYIB 1U3PA 2P6YA 3AGKA 4ZHQB 3VYUC 4I50B 4NWOB 1ONIA 3IKFA 4TUYB 5C8YB 2H6LA 1M90H 4KWEA 1KNKA 3IEQA 5FNVB 5C8YA 3WJPA 2CW4A 2RHHA 1W5EA 1DT9A 5JVDA 3D01A 1FFXA 3ZOPA 3LWPC 1CLIA 3ESJA 4X20B 3U0OA 1RA4A 3HKEA 4ZK7A 1YJ9F 3CPWF 1W5FA 3K0TA 4YJ3B 4B62A 1FFXB 3RYCA 3WPWA 3LYBA 2HQSC 5GINC 3CB2A 3EORA 2Q1YA 3CYQA 4I55A 4O4HB 1FNKA 2DT4A 3MDOA 4IHJA 1W581 3ZP7A 1K9MH 4NQ3A 1X25A 2Z1EA 2CSLA 5EIBC 4EI7A 3G71F 3GTZA 5EB0A 1KQSF 3LDTA 1QD9A 2QI2A 1XBIA 5JCOC 2GVIA 4BT2A 3IEWA 4X3MA 4C8IA 3OBWA 1IPAA 2ZODA 5EIBD 3JCMM 1TUBB 4EB6B 2QEXF 3IKEA 1OAPA 1Z5VA 3E1YA 2W8BC 4G88A 5AVMA 4O4IB 5GANK 1UFYA 2HRUA 3S0YA 1GZ0A 3B6NA 5IJ0B 5EZYA 5LOVA 3I56F 1OFUA 1VQ7F 1VQVA 3NK6A 2HS4A 1W55A 3HKBB 5MN5A 3MCAB 1FSZA 3N2GB 3N2KB 3QUWA 5KMGA 4BT5A 3RYFA 3CMEF 1YJNF 4G4XA 4IIJA 2VAMA 5KX5B 3HKBA 4PWTA 5GONA 3F0DA 2R751 3RA6A 3CMAF 3JVHA 5LA6A 5KMGB 2HRYA 5J2TB 3V7QA 2F9ZC 3N4YA 2G9IA 4IIJB 1UI9A 5KX5A 3WGMA 1U3LA 5LP6A 4DRXB 3P0ZA 3S0WA 2HS3A 1VQ5F 3G6EF 2I6RA 5HY2A 1Q7YH 2KG4A 1RQ2A 4XCQA 3JAWA 4ZOLB 3D54A 2N48A 2LBTA 1COMA 3J7AR 3HKCB 1H47A 1VK3A 1YQNA 3VMFB 2RHLA 3TD3A 2OTJF 4YJ2B 5JH7B 3CCQF 4FFBA 2IAFA 1W59A 5JVDB 5FJ4C 3R0PA 1SZQA 2PHNA 5GAPK 2BTOA 1JN1A 4O4JB 1Q82H 1IV1A 2ZF8A 5HP7A 1X52A 1NMUB 4BVRA 5GIPC 3MBMA 3P4EA 2IQQA 3CCVF 3NVKE 4ZHYB 1NQ3A 3CXCF 3P10A 3OBYA 3FFMA 4X1IB 3HKDA 2CHSA 1R1MA 3CCRF 3J80M 3PAFA 3E22B 1VQ8F 3ON1A 2H8CA 4G4WA 3S06A 3VYSC 3GYQA 1VQKF 4X1IA 3LWVC 2VAWA 1YJWF 3WGNA 5JQGA 1QVFF 2UYKA 3K2XA 5ITZB 1CN7A 3S03A 3VOBA 4LNUB 3CCJF 1VQOF 3QTYA 4RHAA 3VTIC 5CA1A 3F0EA 5LOVB 2RHJA 3QHDA 5ITZA 3NMUC 1X7OA 4F6RB 5EYPA 2I6DA 2CHTA 2HP0A 3V4DA 2QA4F 3N2GA 1U40A 3RYFB 3OW2F 5CA1B 3I55F 2Q1XA 1N8RH 4B46A 1SDSA 3C9UA 2UZHA 2Z01A 5FLXM 4EI9A 2AMTA 4ZHWA 3V7EA 5J2TA 4BW0B 2UYNA 1Q81H 5IJ9B 3CC2F 3I7TA 3TD4A 3KE1A 3IR9A 2IG8A 2VAPA 4O4LA 1JD1A 5IT9M 1RLGA 3UT5A 2BTUA 2Z1UA 5FNVA 3JAMM 1KC8H 2GZLA 2HP3A 5CB4B 3HJWC 1KD1H 3FBAA 1TVKA 5EB1B 5LXTA 2CVLA 4BVQA 3UT5B 4TV8A 1VQMF 4DXDA 3RYCB 1IV3A 3M4SA 5CB4A 2LCAA 3Q8HA 3CYPB 4YJ3A 2K1SA 5G4VC 5LYJB 4G4ZA 4I55B 1E7KA 4O4HA 2VGMA 2UYPA 1S72F 3JATB 5HWEA 1JFFB 1VQNF 2KTUA 2AIZP 4O2AA 3ZO8A 5HY4A 4WBNA 4B5CA 1SA0B 4I4TA 3C9SA 3JAKA 3OONA 1Z5WA 4G4YA 4U3JB 4EB6A 1NJIH 5A2QM 3JASB 4BVTA 1DBFA 1VQ6F 2EWCA 4X1YB 5DCVA 2ZVYA 3RYHA 2JNBA 2UYJA 2OTMA 3JAKB 1VQPF 3LWRC 3CPQA 1YGYA 3T80A 1W2BF 4C4WC 1W5BA 3JALB 3VOAA 4BY9D 3ZP4A 2FGYA 1ZWZA 3N2KA 4M8IA 3F6MA 2ZOVA 3C8LA 3K12A 1JJ2F 3WPXA 5HY0A 4I50A 1W41A 3CCUF 1K73H 2FC3A 5LP6C 3CD6F 2B33A 4ZHVA 4O2BA 5LP6B 3O85A 2LBXA 1W5AA 2L26A
chains in the Genus database with same CATH topology
1GO1A 2AIFA 3NVIB 3WXMB 3CCSF 3NMUC 1X7OA 2QI2A 1XBIA 2I6DA 3RA5A 2CZWA 3PLAC 4X3MA 3E20B 3SIVA 4X3LA 2QA4F 3NK7A 3OBWA 1IPAA 2QEXF 3JCMM 3OW2F 3E1YA 1YIJF 5HXZA 3I55F 2OHWA 5GIOC 5GANK 1W40A 1N8RH 1SDSA 3D00A 1GZ0A 4EI9A 5FLXM 1K8AH 3I56F 3HAXD 1VQ7F 3NK6A 1GO0A 2HVYD 3V7EA 4BW0B 1Q81H 3MCAB 3N4ZA 2VGNA 1QVGF 4EI8A 2OZBA 3CC2F 1W42A 3CMEF 1YJNF 5EWRA 1YI2F 3IR9A 1Q86H 5IT9M 3RA6A 3G4SF 3CMAF 1RLGA 4NUTA 1VQLF 3J81M 3V7QA 2F9ZC 3N4YA 3JAMM 1KC8H 1PXWA 1X7PA 3LWOC 3HJWC 1KD1H 3SIUA 4LCKA 1VQ5F 4BVQA 4TZZA 3G6EF 5HY2A 1Q7YH 2KG4A 1VQ9F 5HXUA 1VQMF 2ALEA 4XCQA 2KTVA 2WALA 5G4VC 3CG6A 1E7KA 1W3EX 3J7AR 2VGMA 2OTLF 3LFOA 1S72F 5HWEA 3VMFB 1VQNF 1CK2A 2OTJF 3CCQF 2KTUA 3AGKA 4BVSA 1H7MA 3VI6A 5FJ4C 5G4UC 3CC4F 1M90H 5HY4A 5GAPK 1Q82H 1YHQF 3CCEF 3V3TA 1X52A 1NMUB 4BVRA 1T0KB 3CCMF 5GIPC 1NJIH 5A2QM 4BVTA 1VQ6F 3CCLF 5DCVA 3CCVF 1M1KH 3NVKE 1DT9A 2JNBA 3LWQC 3CXCF 3OBYA 3FFMA 5EO3A 1VQPF 3LWPC 3LWRC 3CPQA 3CCRF 1RA4A 3J80M 3PAFA 1VQ4F 1YJ9F 1W2BF 3CPWF 4C4WC 1VQ8F 3ON1A 4BY9D 2FGYA 1ZWZA 3GYQA 3G71F 1VQKF 5GINC 3LWVC 1YJWF 1CN7A 1QVFF 1JJ2F 2LBWA 5HY0A 3CCJF 1YITF 1K9MH 1W41A 3CCUF 1VQOF 1K73H 3CC7F 2FC3A 4NQ3A 3CD6F 2BO1A 2GLZA 5HY1A 3O85A 2LBXA 1KQSF 4EI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO1 A;  2AIF A;  3NVI B;  3WXM B;  3CCS F;  3NMU C;  1X7O A;  2QI2 A;  1XBI A;  2I6D A;  3RA5 A;  2CZW A;  3PLA C;  4X3M A;  3E20 B;  3SIV A;  4X3L A;  2QA4 F;  3NK7 A;  3OBW A;  1IPA A;  2QEX F;  3JCM M;  3OW2 F;  3E1Y A;  1YIJ F;  3I55 F;  2OHW A;  5GIO C;  5GAN K;  1W40 A;  1N8R H;  1SDS A;  1GZ0 A;  5FLX M;  1K8A H;  3I56 F;  3HAX D;  1VQ7 F;  3NK6 A;  1GO0 A;  2HVY D;  3V7E A;  4BW0 B;  1Q81 H;  3MCA B;  3N4Z A;  2VGN A;  1QVG F;  2OZB A;  3CC2 F;  1W42 A;  3CME F;  1YJN F;  5EWR A;  1YI2 F;  3IR9 A;  1Q86 H;  5IT9 M;  3RA6 A;  3G4S F;  3CMA F;  1RLG A;  4NUT A;  1VQL F;  3J81 M;  3V7Q A;  3N4Y A;  3JAM M;  1KC8 H;  1PXW A;  1X7P A;  3LWO C;  3HJW C;  1KD1 H;  3SIU A;  4LCK A;  1VQ5 F;  4TZZ A;  3G6E F;  1Q7Y H;  2KG4 A;  1VQ9 F;  1VQM F;  2ALE A;  2KTV A;  5G4V C;  2WAL A;  3CG6 A;  1E7K A;  1W3E X;  3J7A R;  2VGM A;  2OTL F;  3LFO A;  1S72 F;  3VMF B;  1VQN F;  1CK2 A;  2OTJ F;  3CCQ F;  2KTU A;  3AGK A;  1H7M A;  3VI6 A;  5FJ4 C;  5G4U C;  3CC4 F;  1M90 H;  5GAP K;  1Q82 H;  1YHQ F;  3CCE F;  1X52 A;  1NMU B;  1T0K B;  3CCM F;  5GIP C;  1NJI H;  5A2Q M;  1VQ6 F;  3CCL F;  5DCV A;  3CCV F;  1M1K H;  3NVK E;  1DT9 A;  2JNB A;  3LWQ C;  3CXC F;  3OBY A;  3FFM A;  5EO3 A;  1VQP F;  3LWP C;  3LWR C;  3CPQ A;  3CCR F;  1RA4 A;  3J80 M;  3PAF A;  1VQ4 F;  1YJ9 F;  1W2B F;  3CPW F;  4C4W C;  1VQ8 F;  3ON1 A;  4BY9 D;  1ZWZ A;  3GYQ A;  3G71 F;  1VQK F;  5GIN C;  3LWV C;  1YJW F;  1CN7 A;  1QVF F;  1JJ2 F;  2LBW A;  3CCJ F;  1YIT F;  1K9M H;  1W41 A;  3CCU F;  1VQO F;  1K73 H;  3CC7 F;  2FC3 A;  3CD6 F;  2BO1 A;  3O85 A;  2LBX A;  1KQS F; 
#chains in the Genus database with same CATH topology
 2AIF A;  3F0F A;  4TUY A;  3KJJ A;  4B45 A;  3CCS F;  3RA5 A;  4DRX A;  3PLA C;  3SIV A;  4X3L A;  5B8F A;  5IJ9 A;  1T0A A;  2HX0 A;  3JAW B;  4ZI7 B;  4U39 A;  3KJK A;  3VCZ A;  2OHW A;  2ZVZ A;  5GIO C;  3D00 A;  3BYQ A;  4ZOL A;  4O4L B;  3RE3 A;  3HKE B;  1XV2 A;  4FFB B;  1XHO A;  4ZI7 A;  3LME A;  2VGN A;  1QVG F;  4EI8 A;  4G4V A;  1TVK B;  5LXT B;  2PMP A;  5J2U A;  1YI2 F;  5IYZ A;  2VXY A;  3WGJ A;  3WGL A;  3G4S F;  4C82 A;  1JY8 A;  4NUT A;  1VQL F;  3J81 M;  3WJQ A;  5BMV B;  5J2U B;  1X7P A;  3KHN A;  3JAT A;  1JFF A;  3E22 A;  4TZZ A;  1TUB A;  3KIZ A;  3MCQ A;  1VQ9 F;  5HXU A;  5BMV A;  2ALE A;  4WBN B;  2H8E A;  3JAR B;  1FNJ A;  2BTQ B;  4O4I A;  5JQG B;  1W3E X;  2OTL F;  4C81 A;  5HP8 A;  1VHA A;  2RHO A;  3HWU A;  4X1K A;  4BT3 A;  4BVS A;  1H7M A;  1W57 A;  3VI6 A;  5G4U C;  3CC4 F;  3I3F A;  4TV9 A;  4F6R A;  5EYP B;  3WJR A;  5GON B;  1YHQ F;  3CCE F;  3V3T A;  4BT7 A;  2MQE A;  4X1K B;  1T0K B;  3CCM F;  5MN6 A;  3F0G A;  3C9T A;  4BT4 A;  2YYE A;  3MQW A;  1IV4 A;  5LA6 B;  3CCL F;  3WGK A;  3HTN A;  4RQO A;  1VH8 A;  1M1K H;  1IV2 A;  3LWQ C;  5EO3 A;  2HS0 A;  1XRG A;  1VQ4 F;  1H48 A;  3VIU A;  2YXZ A;  4O2B B;  4C8E A;  3IMP A;  1J7H A;  3HKC A;  5EAZ A;  1QAH A;  1RLU A;  3DC2 A;  3VO8 A;  2NMU A;  4X20 A;  1RQ7 A;  2LBW A;  1KNJ A;  1ODE A;  1YIT F;  3FPI A;  4E6E A;  2Z1T A;  5JH7 A;  4YJ2 A;  3CC7 F;  2BO1 A;  2GLZ A;  5HY1 A;  4O4J A;  1GX1 A;  1GO1 A;  3ERN A;  3WXM B;  3NVI B;  1Q8R A;  2CZW A;  3E20 B;  2V9Y A;  3DDN A;  3NK7 A;  4IHJ B;  1PF5 A;  3GHZ A;  4TV8 B;  2ZAU A;  1U43 A;  1YIJ F;  5HXZ A;  3FD5 A;  1W40 A;  3HKD B;  5IYZ B;  2QTP A;  5LYJ A;  3K14 A;  1K8A H;  3HAX D;  1GO0 A;  2HVY D;  4R40 B;  3N4Z A;  2KGW A;  5JCO A;  2OZB A;  4ERH A;  3S0H A;  1W42 A;  4O2A B;  2CWJ A;  4I4T B;  5EWR A;  4HNA B;  3S02 A;  1QU9 A;  2RB9 A;  1Q86 H;  5IJ0 A;  2DYY A;  5EZY B;  1SA0 A;  4U3J A;  3JAR A;  4LNU A;  3JAS A;  1PXW A;  3LWO C;  4X1Y A;  4HNA A;  2HP0 B;  3L7Q A;  3SIU A;  3RYH B;  4LCK A;  5CA0 A;  4BT6 A;  5MN4 A;  3M1X A;  3C9R A;  3RYI A;  3FD6 A;  4TV9 B;  4ZHQ A;  2KTV A;  3JAL A;  4C8G A;  2WAL A;  3VYT C;  3M84 A;  3CG6 A;  5CA0 B;  3LFO A;  2R6R 1;  3TD5 A;  2UYN B;  3ELC A;  1CK2 A;  2Z1F A;  3RYI B;  1U3P A;  2P6Y A;  3AGK A;  4ZHQ B;  3VYU C;  4I50 B;  4NWO B;  1ONI A;  3IKF A;  4TUY B;  5C8Y B;  2H6L A;  1M90 H;  4KWE A;  1KNK A;  3IEQ A;  5FNV B;  5C8Y A;  3WJP A;  2CW4 A;  2RHH A;  1W5E A;  1DT9 A;  5JVD A;  3D01 A;  1FFX A;  3ZOP A;  3LWP C;  1CLI A;  3ESJ A;  4X20 B;  3U0O A;  1RA4 A;  3HKE A;  4ZK7 A;  1YJ9 F;  3CPW F;  1W5F A;  3K0T A;  4YJ3 B;  4B62 A;  1FFX B;  3RYC A;  3WPW A;  3LYB A;  2HQS C;  5GIN C;  3CB2 A;  3EOR A;  2Q1Y A;  3CYQ A;  4I55 A;  4O4H B;  1FNK A;  2DT4 A;  3MDO A;  4IHJ A;  1W58 1;  3ZP7 A;  1K9M H;  4NQ3 A;  1X25 A;  2Z1E A;  2CSL A;  5EIB C;  4EI7 A;  3G71 F;  3GTZ A;  5EB0 A;  1KQS F;  3LDT A;  1QD9 A;  2QI2 A;  1XBI A;  5JCO C;  2GVI A;  4BT2 A;  3IEW A;  4X3M A;  4C8I A;  3OBW A;  1IPA A;  2ZOD A;  5EIB D;  3JCM M;  1TUB B;  4EB6 B;  2QEX F;  3IKE A;  1OAP A;  1Z5V A;  3E1Y A;  2W8B C;  4G88 A;  5AVM A;  4O4I B;  5GAN K;  1UFY A;  2HRU A;  3S0Y A;  1GZ0 A;  3B6N A;  5IJ0 B;  5EZY A;  5LOV A;  3I56 F;  1OFU A;  1VQ7 F;  1VQV A;  3NK6 A;  2HS4 A;  1W55 A;  3HKB B;  5MN5 A;  3MCA B;  1FSZ A;  3N2G B;  3N2K B;  3QUW A;  5KMG A;  4BT5 A;  3RYF A;  3CME F;  1YJN F;  4G4X A;  4IIJ A;  2VAM A;  5KX5 B;  3HKB A;  4PWT A;  5GON A;  3F0D A;  2R75 1;  3RA6 A;  3CMA F;  3JVH A;  5LA6 A;  5KMG B;  2HRY A;  5J2T B;  3V7Q A;  2F9Z C;  3N4Y A;  2G9I A;  4IIJ B;  1UI9 A;  5KX5 A;  3WGM A;  1U3L A;  5LP6 A;  4DRX B;  3P0Z A;  3S0W A;  2HS3 A;  1VQ5 F;  3G6E F;  2I6R A;  5HY2 A;  1Q7Y H;  2KG4 A;  1RQ2 A;  4XCQ A;  3JAW A;  4ZOL B;  3D54 A;  2N48 A;  2LBT A;  1COM A;  3J7A R;  3HKC B;  1H47 A;  1VK3 A;  1YQN A;  3VMF B;  2RHL A;  3TD3 A;  2OTJ F;  4YJ2 B;  5JH7 B;  3CCQ F;  4FFB A;  2IAF A;  1W59 A;  5JVD B;  5FJ4 C;  3R0P A;  1SZQ A;  2PHN A;  5GAP K;  2BTO A;  1JN1 A;  4O4J B;  1Q82 H;  1IV1 A;  2ZF8 A;  5HP7 A;  1X52 A;  1NMU B;  4BVR A;  5GIP C;  3MBM A;  3P4E A;  2IQQ A;  3CCV F;  3NVK E;  4ZHY B;  1NQ3 A;  3CXC F;  3P10 A;  3OBY A;  3FFM A;  4X1I B;  3HKD A;  2CHS A;  1R1M A;  3CCR F;  3J80 M;  3PAF A;  3E22 B;  1VQ8 F;  3ON1 A;  2H8C A;  4G4W A;  3S06 A;  3VYS C;  3GYQ A;  1VQK F;  4X1I A;  3LWV C;  2VAW A;  1YJW F;  3WGN A;  5JQG A;  1QVF F;  2UYK A;  3K2X A;  5ITZ B;  1CN7 A;  3S03 A;  3VOB A;  4LNU B;  3CCJ F;  1VQO F;  3QTY A;  4RHA A;  3VTI C;  5CA1 A;  3F0E A;  5LOV B;  2RHJ A;  3QHD A;  5ITZ A;  3NMU C;  1X7O A;  4F6R B;  5EYP A;  2I6D A;  2CHT A;  2HP0 A;  3V4D A;  2QA4 F;  3N2G A;  1U40 A;  3RYF B;  3OW2 F;  5CA1 B;  3I55 F;  2Q1X A;  1N8R H;  4B46 A;  1SDS A;  3C9U A;  2UZH A;  2Z01 A;  5FLX M;  4EI9 A;  2AMT A;  4ZHW A;  3V7E A;  5J2T A;  4BW0 B;  2UYN A;  1Q81 H;  5IJ9 B;  3CC2 F;  3I7T A;  3TD4 A;  3KE1 A;  3IR9 A;  2IG8 A;  2VAP A;  4O4L A;  1JD1 A;  5IT9 M;  1RLG A;  3UT5 A;  2BTU A;  2Z1U A;  5FNV A;  3JAM M;  1KC8 H;  2GZL A;  2HP3 A;  5CB4 B;  3HJW C;  1KD1 H;  3FBA A;  1TVK A;  5EB1 B;  5LXT A;  2CVL A;  4BVQ A;  3UT5 B;  4TV8 A;  1VQM F;  4DXD A;  3RYC B;  1IV3 A;  3M4S A;  5CB4 A;  2LCA A;  3Q8H A;  3CYP B;  4YJ3 A;  2K1S A;  5G4V C;  5LYJ B;  4G4Z A;  4I55 B;  1E7K A;  4O4H A;  2VGM A;  2UYP A;  1S72 F;  3JAT B;  5HWE A;  1JFF B;  1VQN F;  2KTU A;  2AIZ P;  4O2A A;  3ZO8 A;  5HY4 A;  4WBN A;  4B5C A;  1SA0 B;  4I4T A;  3C9S A;  3JAK A;  3OON A;  1Z5W A;  4G4Y A;  4U3J B;  4EB6 A;  1NJI H;  5A2Q M;  3JAS B;  4BVT A;  1DBF A;  1VQ6 F;  2EWC A;  4X1Y B;  5DCV A;  2ZVY A;  3RYH A;  2JNB A;  2UYJ A;  2OTM A;  3JAK B;  1VQP F;  3LWR C;  3CPQ A;  1YGY A;  3T80 A;  1W2B F;  4C4W C;  1W5B A;  3JAL B;  3VOA A;  4BY9 D;  3ZP4 A;  2FGY A;  1ZWZ A;  3N2K A;  4M8I A;  3F6M A;  2ZOV A;  3C8L A;  3K12 A;  1JJ2 F;  3WPX A;  5HY0 A;  4I50 A;  1W41 A;  3CCU F;  1K73 H;  2FC3 A;  5LP6 C;  3CD6 F;  2B33 A;  4ZHV A;  4O2B A;  5LP6 B;  3O85 A;  2LBX A;  1W5A A;  2L26 A; 
#chains in the Genus database with same CATH homology
 1GO1 A;  2AIF A;  3NVI B;  3WXM B;  3CCS F;  3NMU C;  1X7O A;  2QI2 A;  1XBI A;  2I6D A;  3RA5 A;  2CZW A;  3PLA C;  4X3M A;  3E20 B;  3SIV A;  4X3L A;  2QA4 F;  3NK7 A;  3OBW A;  1IPA A;  2QEX F;  3JCM M;  3OW2 F;  3E1Y A;  1YIJ F;  5HXZ A;  3I55 F;  2OHW A;  5GIO C;  5GAN K;  1W40 A;  1N8R H;  1SDS A;  3D00 A;  1GZ0 A;  4EI9 A;  5FLX M;  1K8A H;  3I56 F;  3HAX D;  1VQ7 F;  3NK6 A;  1GO0 A;  2HVY D;  3V7E A;  4BW0 B;  1Q81 H;  3MCA B;  3N4Z A;  2VGN A;  1QVG F;  4EI8 A;  2OZB A;  3CC2 F;  1W42 A;  3CME F;  1YJN F;  5EWR A;  1YI2 F;  3IR9 A;  1Q86 H;  5IT9 M;  3RA6 A;  3G4S F;  3CMA F;  1RLG A;  4NUT A;  1VQL F;  3J81 M;  3V7Q A;  2F9Z C;  3N4Y A;  3JAM M;  1KC8 H;  1PXW A;  1X7P A;  3LWO C;  3HJW C;  1KD1 H;  3SIU A;  4LCK A;  1VQ5 F;  4BVQ A;  4TZZ A;  3G6E F;  5HY2 A;  1Q7Y H;  2KG4 A;  1VQ9 F;  5HXU A;  1VQM F;  2ALE A;  4XCQ A;  2KTV A;  2WAL A;  5G4V C;  3CG6 A;  1E7K A;  1W3E X;  3J7A R;  2VGM A;  2OTL F;  3LFO A;  1S72 F;  5HWE A;  3VMF B;  1VQN F;  1CK2 A;  2OTJ F;  3CCQ F;  2KTU A;  3AGK A;  4BVS A;  1H7M A;  3VI6 A;  5FJ4 C;  5G4U C;  3CC4 F;  1M90 H;  5HY4 A;  5GAP K;  1Q82 H;  1YHQ F;  3CCE F;  3V3T A;  1X52 A;  1NMU B;  4BVR A;  1T0K B;  3CCM F;  5GIP C;  1NJI H;  5A2Q M;  4BVT A;  1VQ6 F;  3CCL F;  5DCV A;  3CCV F;  1M1K H;  3NVK E;  1DT9 A;  2JNB A;  3LWQ C;  3CXC F;  3OBY A;  3FFM A;  5EO3 A;  1VQP F;  3LWP C;  3LWR C;  3CPQ A;  3CCR F;  1RA4 A;  3J80 M;  3PAF A;  1VQ4 F;  1YJ9 F;  1W2B F;  3CPW F;  4C4W C;  1VQ8 F;  3ON1 A;  4BY9 D;  2FGY A;  1ZWZ A;  3GYQ A;  3G71 F;  1VQK F;  5GIN C;  3LWV C;  1YJW F;  1CN7 A;  1QVF F;  1JJ2 F;  2LBW A;  5HY0 A;  3CCJ F;  1YIT F;  1K9M H;  1W41 A;  3CCU F;  1VQO F;  1K73 H;  3CC7 F;  2FC3 A;  4NQ3 A;  3CD6 F;  2BO1 A;  2GLZ A;  5HY1 A;  3O85 A;  2LBX A;  1KQS F;  4EI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...