3CCJF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccjF00
3WXMB 1YIJF 1JJ2F 3CCVF 1VQOF 1PXWA 3CG6A 3CMEF 1YJWF 1K8AH 3NK6A 3CPQA 3JCMM 4X3MA 1IPAA 1YJNF 2AIFA 3J80M 3VMFB 1GZ0A 4LCKA 3GYQA 1XBIA 2QA4F 2OTJF 3LFOA 3LWOC 2LBXA 1YJ9F 5EO3A 3LWQC 3CD6F 1NMUB 3E1YA 3CCRF 1X52A 3CCJF 3LWPC 5GIOC 2OHWA 2KTUA 3AGKA 1VQ5F 1W3EX 1K9MH 4C4WC 1M1KH 1H7MA 3J81M 2QI2A 3NVKE 3O85A 1N8RH 5GINC 2LBWA 3CC7F 1X7PA 3J7AR 1KQSF 2WALA 3CXCF 1VQLF 1ZWZA 5DCVA 4NUTA 1E7KA 3CPWF 1T0KB 3LWRC 1YI2F 1Q81H 1NJIH 4TZZA 1GO1A 3JAMM 2QEXF 1QVFF 1VQ6F 5GIPC 1YHQF 5G4UC 1VQPF 1VQ7F 4BW0B 2OTLF 2BO1A 3HAXD 3RA5A 2KTVA 3NVIB 1X7OA 2ALEA 3V7QA 1S72F 1QVGF 2JNBA 1Q86H 5GANK 3CCMF 3VI6A 3LWVC 1CK2A 5G4VC 4X3LA 2FC3A 3IR9A 3CCLF 1VQ4F 3G71F 3CC4F 3MCAB 3OBWA 3HJWC 5IT9M 2KG4A 1Q7YH 3CCEF 2I6DA 1GO0A 2VGNA 2VGMA 1VQNF 2HVYD 3SIVA 1W40A 1VQ8F 3NK7A 3I56F 5GAPK 3CCSF 3OBYA 3NMUC 1DT9A 1W2BF 1VQKF 5FJ4C 1W42A 4BY9D 1KC8H 3CCQF 1VQ9F 3PAFA 3G4SF 1Q82H 1RLGA 5A2QM 1M90H 1VQMF 1K73H 3CMAF 3N4ZA 3PLAC 3CC2F 1YITF 3RA6A 2CZWA 3SIUA 5FLXM 3I55F 3E20B 1CN7A 1KD1H 1RA4A 3G6EF 3ON1A 5EWRA 3N4YA 3OW2F 1SDSA 2OZBA 3V7EA 3FFMA 3CCUF 1W41A
chains in the Genus database with same CATH superfamily
3WXMB 4U39A 3CCVF 3VOAA 4C82A 2MQEA 3RYHA 4FFBA 3VMFB 4I4TB 4LCKA 3S0WA 3JAWA 4RHAA 5EO3A 5HY4A 4IHJB 2ZF8A 2I6RA 5J2TB 4O2BA 1X52A 3QUWA 2VAWA 1UI9A 5AVMA 3EORA 1U3PA 1TUBB 5MN6A 5IYZB 3AGKA 5MN5A 3J81M 4U3JB 2QI2A 2DYYA 5GINC 3CC7F 1W5BA 3HKCB 3JAKB 2ZAUA 4LNUA 1X7PA 5JCOC 1OAPA 3J7AR 2WALA 3ZOPA 2N48A 3CXCF 5KX5A 1ZWZA 3E22B 2ZVZA 2UYJA 1YI2F 2CVLA 1NJIH 3N2KA 3QHDA 3JARA 1GO1A 4I50A 4I55B 2UYKA 5JH7A 1SA0A 3VYSC 4ZHQB 2ZOVA 1VQPF 2W8BC 3RA5A 4BT6A 5EAZA 1S72F 3F6MA 2JNBA 3RYFB 1QVGF 4EI7A 3VI6A 5FNVA 4YJ2A 5HXZA 4O2AA 5HY0A 3DDNA 3TD5A 2RHJA 4ERHA 5IJ9A 3JALB 3OBWA 2QTPA 3VOBA 2HS0A 2F9ZC 3VTIC 1GO0A 5CA0B 4ZK7A 2CSLA 3MBMA 3HKDB 3OBYA 5HWEA 3CCSF 1W2BF 1VQKF 3I3FA 2H6LA 4PWTA 5ITZB 4EI8A 5CB4A 1R1MA 2BTUA 3PAFA 2UYPA 5JVDA 3C9SA 1Q82H 1M90H 3I7TA 4YJ3A 3WPXA 1VQMF 4ZOLA 3N4ZA 3RYCB 3R0PA 3JATA 3CC2F 3U0OA 3SIUA 1W5FA 3F0EA 2EWCA 3ELCA 5EYPA 3G6EF 5EWRA 3N4YA 3OW2F 3CB2A 3CCJF 4G4ZA 3IKFA 1JJ2F 4G4VA 3CG6A 2Q1XA 2HP3A 5KMGA 3C9TA 4O4LB 3JCMM 1RQ7A 1IPAA 3K0TA 1JD1A 1W57A 3J80M 3BYQA 1FSZA 3V3TA 2GLZA 2QA4F 3MQWA 3GHZA 2OTJF 1YJ9F 2LBXA 3ERNA 4G4YA 3LWQC 4TV8A 1W5EA 5IJ0A 3CCRF 3JASA 2L26A 4BVTA 4BT2A 3M1XA 2OHWA 2KTUA 5EZYB 1VK3A 4C4WC 1K9MH 1W581 4WBNA 2HS3A 1H7MA 3C9UA 5LXTA 3O85A 1N8RH 4BT7A 1VH8A 2HRYA 3S03A 5EIBD 2IQQA 3KE1A 1JN1A 4B46A 1VQLF 4DXDA 4O4JB 1U43A 1W5AA 3S0HA 2FGYA 4DRXB 3QTYA 1OFUA 1Z5VA 4BVQA 4M8IA 3JAMM 3F0FA 3P10A 5GIPC 4ZHQA 4BW0B 5LOVB 5LYJA 3RYIB 2AIZP 3WJQA 3UT5A 3CCMF 4O4HB 3ZP4A 1JFFB 2BTQB 4RQOA 3IR9A 3CCLF 3CC4F 3JALA 4ZHYB 1CLIA 5EB1B 3HWUA 2ZVYA 4HNAA 4TV9B 5IT9M 2KG4A 3CCEF 3N2GA 5C8YB 2VGNA 2VGMA 2HVYD 5CA0A 2OTMA 2PMPA 3SIVA 1W40A 4IIJB 4X1KA 3I56F 3KJKA 5GAPK 2H8EA 5FJ4C 3WGNA 1IV3A 5ITZA 1KC8H 3WJRA 5CA1B 1VQ9F 4FFBB 2GZLA 3ESJA 3MDOA 4F6RA 5A2QM 3HKBB 1K73H 3CMAF 3JAWB 1YITF 2CZWA 3E20B 4X1IA 4O2BB 1KNJA 1FFXA 3ON1A 1NQ3A 3KJJA 5EIBC 3FFMA 3WPWA 1TVKA 1JY8A 3CCUF 1RLUA 1YIJF 1PXWA 2HP0A 3S0YA 3CMEF 1YJWF 1K8AH 3NK6A 4ZI7A 3CPQA 5JQGA 4E6EA 4ZHWA 3VYTC 5GONB 5LP6A 3FBAA 1H47A 5KX5B 3Q8HA 1XBIA 4X1YB 3LFOA 1X25A 1IV2A 2B33A 3WGKA 4B5CA 4KWEA 1FNJA 1NMUB 2ZODA 2HX0A 4C8GA 3HKEA 4I50B 5LA6B 1DBFA 4EB6A 1UFYA 1H48A 5JH7B 3DC2A 1SA0B 2UYNB 2R751 5BMVA 1U3LA 1W3EX 4XCQA 1M1KH 1Q8RA 3RE3A 2CW4A 1QD9A 2G9IA 3NVKE 3GTZA 4B62A 5FNVB 4YJ2B 2V9YA 4O2AB 5JCOA 3VCZA 1KQSF 5IJ9B 4I4TA 5DCVA 1ODEA 4ZHVA 1IV1A 2PHNA 5B8FA 1E7KA 3ZP7A 3CPWF 3LWRC 1Q81H 4EI9A 4DRXA 4IHJA 3IKEA 4O4IB 3VO8A 5J2TA 2QEXF 1QVFF 3D54A 1VQ6F 1YGYA 1IV4A 1VQ7F 1TUBA 3WGMA 4G88A 3JVHA 2BO1A 3K2XA 5IYZA 5LOVA 4BVSA 2YYEA 2BTOA 3RYIA 2RB9A 1VHAA 5CB4B 3VIUA 1X7OA 2ALEA 4U3JA 5JVDB 1Q86H 3K12A 5GANK 3LWVC 2RHLA 3HKCA 1CK2A 3JAKA 5G4VC 4YJ3B 4ZOLB 2FC3A 3LYBA 1COMA 3MCAB 3G71F 3IEWA 3E22A 3JATB 4TUYB 3WGJA 5EYPB 2RHHA 2I6DA 3P0ZA 3LMEA 4IIJA 2KGWA 2HQSC 3NK7A 1VQ8F 4I55A 3OONA 2UZHA 3T80A 1DT9A 5J2UB 5KMGB 3FD6A 1W42A 4B45A 3VYUC 3C8LA 4X20B 5CA1A 3KHNA 1XHOA 1VQVA 3RYFA 3G4SF 3TD3A 5LP6C 3HKBA 3KIZA 3L7QA 1RQ2A 3S02A 4TV8B 3RA6A 2AMTA 5FLXM 3CYQA 4C8EA 4BVRA 4G4WA 1ONIA 5IJ0B 1CN7A 3JASB 1RA4A 4BT5A 1SDSA 3V7EA 1QAHA 5EB0A 3S06A 3HTNA 4WBNB 3HKDA 3MCQA 1VQOF 2K1SA 3D01A 5LXTB 2CWJA 2RHOA 4X3MA 3RYHB 1YJNF 2AIFA 1W59A 2CHTA 5GONA 5HY1A 1GZ0A 3GYQA 5HXUA 2HRUA 4X1YA 3ZO8A 1YQNA 2HS4A 3RYCA 3LWOC 2DT4A 3CD6F 3WJPA 3E1YA 5LA6A 2UYNA 3LWPC 5GIOC 3CYPB 3FPIA 1VQ5F 5LYJB 1J7HA 4O4LA 2Z1TA 2CHSA 3F0GA 2LBWA 3UT5B 2IAFA 3D00A 4LNUB 3LDTA 2NMUA 1QU9A 2VXYA 2LBTA 4NUTA 4BT3A 3P4EA 1W55A 1T0KB 4HNAB 4TZZA 3N2KB 3N2GB 3JARB 4O4IA 2Z01A 4X1KB 4NWOB 2Z1UA 3FD5A 3IMPA 1Z5WA 3K14A 1YHQF 5G4UC 3C9RA 2OTLF 4R40B 5EZYA 3HAXD 2YXZA 4NQ3A 2KTVA 3NVIB 3V7QA 2LCAA 1SZQA 1T0AA 1XRGA 4F6RB 2VAPA 1PF5A 4X3LA 1VQ4F 1FNKA 4BT4A 4TUYA 3B6NA 3HJWC 4O4JA 4X1IB 4C81A 1Q7YH 1FFXB 3TD4A 1GX1A 3M84A 1TVKB 2Z1FA 1VQNF 2R6R1 2H8CA 3NMUC 3IEQA 2HP0B 5J2UA 2Z1EA 4ZI7B 4BY9D 5MN4A 4G4XA 4X20A 3CCQF 2Q1YA 5JQGB 2VAMA 2IG8A 5LP6B 4O4HA 1RLGA 1KNKA 1JFFA 3F0DA 5HP7A 2P6YA 1U40A 3V4DA 3PLAC 4C8IA 3I55F 4TV9A 3HKEB 3WGLA 4EB6B 3M4SA 1KD1H 2GVIA 5C8YA 5HY2A 2OZBA 1XV2A 5BMVB 1W41A 5HP8A
chains in the Genus database with same CATH topology
3WXMB 1YIJF 1JJ2F 3CCVF 1VQOF 1PXWA 3CG6A 3CMEF 1YJWF 1K8AH 3NK6A 3CPQA 3JCMM 4X3MA 1IPAA 1YJNF 2AIFA 3J80M 3VMFB 3V3TA 5HY1A 1GZ0A 4LCKA 3GYQA 1XBIA 2GLZA 5HXUA 2QA4F 2OTJF 3LFOA 3LWOC 2LBXA 1YJ9F 5EO3A 3LWQC 3CD6F 5HY4A 1NMUB 3E1YA 3CCRF 4BVTA 1X52A 3CCJF 3LWPC 5GIOC 2OHWA 2KTUA 3AGKA 1VQ5F 1W3EX 1K9MH 4C4WC 4XCQA 1M1KH 1H7MA 3J81M 2QI2A 3NVKE 3O85A 1N8RH 5GINC 2LBWA 3CC7F 3D00A 1X7PA 3J7AR 1KQSF 2WALA 3CXCF 1VQLF 1ZWZA 5DCVA 4NUTA 1E7KA 3CPWF 1T0KB 3LWRC 1YI2F 1Q81H 1NJIH 4TZZA 4EI9A 2FGYA 1GO1A 4BVQA 3JAMM 2QEXF 1QVFF 1VQ6F 5GIPC 1YHQF 5G4UC 1VQPF 1VQ7F 4BW0B 2OTLF 2BO1A 4BVSA 3HAXD 3RA5A 4NQ3A 2KTVA 3NVIB 1X7OA 2ALEA 3V7QA 1S72F 1QVGF 2JNBA 1Q86H 4EI7A 5GANK 3VI6A 3LWVC 3CCMF 1CK2A 5HXZA 5G4VC 5HY0A 4X3LA 2FC3A 3IR9A 3CCLF 1VQ4F 3G71F 3CC4F 3MCAB 3OBWA 3HJWC 5IT9M 2KG4A 1Q7YH 3CCEF 2F9ZC 2I6DA 1GO0A 2VGNA 2VGMA 1VQNF 2HVYD 3SIVA 1W40A 1VQ8F 3NK7A 3I56F 5GAPK 3CCSF 3OBYA 5HWEA 1DT9A 1W2BF 1VQKF 3NMUC 5FJ4C 1W42A 4BY9D 4EI8A 1KC8H 3CCQF 1VQ9F 3PAFA 3G4SF 1Q82H 1RLGA 5A2QM 1M90H 1VQMF 1K73H 3CMAF 3N4ZA 3PLAC 3CC2F 1YITF 3RA6A 2CZWA 3SIUA 5FLXM 3I55F 3E20B 4BVRA 1CN7A 1KD1H 1RA4A 3G6EF 3ON1A 5EWRA 3N4YA 5HY2A 3OW2F 1SDSA 2OZBA 3FFMA 3V7EA 3CCUF 1W41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXM B;  1YIJ F;  1JJ2 F;  3CCV F;  1VQO F;  1PXW A;  3CG6 A;  3CME F;  1YJW F;  1K8A H;  3NK6 A;  3CPQ A;  3JCM M;  4X3M A;  1IPA A;  1YJN F;  2AIF A;  3J80 M;  3VMF B;  1GZ0 A;  4LCK A;  3GYQ A;  1XBI A;  2QA4 F;  2OTJ F;  3LFO A;  3LWO C;  2LBX A;  1YJ9 F;  5EO3 A;  3LWQ C;  3CD6 F;  1NMU B;  3E1Y A;  3CCR F;  1X52 A;  3CCJ F;  3LWP C;  5GIO C;  2OHW A;  2KTU A;  3AGK A;  1VQ5 F;  1W3E X;  1K9M H;  4C4W C;  1M1K H;  1H7M A;  3J81 M;  2QI2 A;  3NVK E;  3O85 A;  1N8R H;  5GIN C;  2LBW A;  3CC7 F;  1X7P A;  3J7A R;  1KQS F;  2WAL A;  3CXC F;  1VQL F;  1ZWZ A;  5DCV A;  4NUT A;  1E7K A;  3CPW F;  1T0K B;  3LWR C;  1YI2 F;  1Q81 H;  1NJI H;  4TZZ A;  1GO1 A;  3JAM M;  2QEX F;  1QVF F;  1VQ6 F;  5GIP C;  1YHQ F;  5G4U C;  1VQP F;  1VQ7 F;  4BW0 B;  2OTL F;  2BO1 A;  3HAX D;  3RA5 A;  2KTV A;  3NVI B;  1X7O A;  2ALE A;  3V7Q A;  1S72 F;  1QVG F;  2JNB A;  1Q86 H;  5GAN K;  3CCM F;  3VI6 A;  3LWV C;  1CK2 A;  5G4V C;  4X3L A;  2FC3 A;  3IR9 A;  3CCL F;  1VQ4 F;  3G71 F;  3CC4 F;  3MCA B;  3OBW A;  3HJW C;  5IT9 M;  2KG4 A;  1Q7Y H;  3CCE F;  2I6D A;  1GO0 A;  2VGN A;  2VGM A;  1VQN F;  2HVY D;  3SIV A;  1W40 A;  1VQ8 F;  3NK7 A;  3I56 F;  5GAP K;  3CCS F;  3OBY A;  3NMU C;  1DT9 A;  1W2B F;  1VQK F;  5FJ4 C;  1W42 A;  4BY9 D;  1KC8 H;  3CCQ F;  1VQ9 F;  3PAF A;  3G4S F;  1Q82 H;  1RLG A;  5A2Q M;  1M90 H;  1VQM F;  1K73 H;  3CMA F;  3N4Z A;  3PLA C;  3CC2 F;  1YIT F;  3RA6 A;  2CZW A;  3SIU A;  5FLX M;  3I55 F;  3E20 B;  1CN7 A;  1KD1 H;  1RA4 A;  3G6E F;  3ON1 A;  5EWR A;  3N4Y A;  3OW2 F;  1SDS A;  2OZB A;  3V7E A;  3FFM A;  3CCU F;  1W41 A; 
#chains in the Genus database with same CATH topology
 3WXM B;  4U39 A;  3CCV F;  3VOA A;  4C82 A;  2MQE A;  3RYH A;  4FFB A;  3VMF B;  4I4T B;  4LCK A;  3S0W A;  3JAW A;  4RHA A;  5EO3 A;  5HY4 A;  4IHJ B;  2ZF8 A;  2I6R A;  5J2T B;  4O2B A;  1X52 A;  3QUW A;  2VAW A;  1UI9 A;  5AVM A;  3EOR A;  1U3P A;  1TUB B;  5MN6 A;  5IYZ B;  3AGK A;  5MN5 A;  3J81 M;  4U3J B;  2QI2 A;  2DYY A;  5GIN C;  3CC7 F;  1W5B A;  3HKC B;  3JAK B;  2ZAU A;  4LNU A;  1X7P A;  5JCO C;  1OAP A;  3J7A R;  2WAL A;  3ZOP A;  2N48 A;  3CXC F;  5KX5 A;  1ZWZ A;  3E22 B;  2ZVZ A;  2UYJ A;  1YI2 F;  2CVL A;  1NJI H;  3N2K A;  3QHD A;  3JAR A;  1GO1 A;  4I50 A;  4I55 B;  2UYK A;  5JH7 A;  1SA0 A;  3VYS C;  4ZHQ B;  2ZOV A;  1VQP F;  2W8B C;  3RA5 A;  4BT6 A;  5EAZ A;  1S72 F;  3F6M A;  2JNB A;  3RYF B;  1QVG F;  4EI7 A;  3VI6 A;  5FNV A;  4YJ2 A;  5HXZ A;  4O2A A;  5HY0 A;  3DDN A;  3TD5 A;  2RHJ A;  4ERH A;  5IJ9 A;  3JAL B;  3OBW A;  2QTP A;  3VOB A;  2HS0 A;  2F9Z C;  3VTI C;  1GO0 A;  5CA0 B;  4ZK7 A;  2CSL A;  3MBM A;  3HKD B;  3OBY A;  5HWE A;  3CCS F;  1W2B F;  1VQK F;  3I3F A;  2H6L A;  4PWT A;  5ITZ B;  4EI8 A;  5CB4 A;  1R1M A;  2BTU A;  3PAF A;  2UYP A;  5JVD A;  3C9S A;  1Q82 H;  1M90 H;  3I7T A;  4YJ3 A;  3WPX A;  1VQM F;  4ZOL A;  3N4Z A;  3RYC B;  3R0P A;  3JAT A;  3CC2 F;  3U0O A;  3SIU A;  1W5F A;  3F0E A;  2EWC A;  3ELC A;  5EYP A;  3G6E F;  5EWR A;  3N4Y A;  3OW2 F;  3CB2 A;  3CCJ F;  4G4Z A;  3IKF A;  1JJ2 F;  4G4V A;  3CG6 A;  2Q1X A;  2HP3 A;  5KMG A;  3C9T A;  4O4L B;  3JCM M;  1RQ7 A;  1IPA A;  3K0T A;  1JD1 A;  1W57 A;  3J80 M;  3BYQ A;  1FSZ A;  3V3T A;  2GLZ A;  2QA4 F;  3MQW A;  3GHZ A;  2OTJ F;  1YJ9 F;  2LBX A;  3ERN A;  4G4Y A;  3LWQ C;  4TV8 A;  1W5E A;  5IJ0 A;  3CCR F;  3JAS A;  2L26 A;  4BVT A;  4BT2 A;  3M1X A;  2OHW A;  2KTU A;  5EZY B;  1VK3 A;  4C4W C;  1K9M H;  1W58 1;  4WBN A;  2HS3 A;  1H7M A;  3C9U A;  5LXT A;  3O85 A;  1N8R H;  4BT7 A;  1VH8 A;  2HRY A;  3S03 A;  5EIB D;  2IQQ A;  3KE1 A;  1JN1 A;  4B46 A;  1VQL F;  4DXD A;  4O4J B;  1U43 A;  1W5A A;  3S0H A;  2FGY A;  4DRX B;  3QTY A;  1OFU A;  1Z5V A;  4BVQ A;  4M8I A;  3JAM M;  3F0F A;  3P10 A;  5GIP C;  4ZHQ A;  4BW0 B;  5LOV B;  5LYJ A;  3RYI B;  2AIZ P;  3WJQ A;  3UT5 A;  3CCM F;  4O4H B;  3ZP4 A;  1JFF B;  2BTQ B;  4RQO A;  3IR9 A;  3CCL F;  3CC4 F;  3JAL A;  4ZHY B;  1CLI A;  5EB1 B;  3HWU A;  2ZVY A;  4HNA A;  4TV9 B;  5IT9 M;  2KG4 A;  3CCE F;  3N2G A;  5C8Y B;  2VGN A;  2VGM A;  2HVY D;  5CA0 A;  2OTM A;  2PMP A;  3SIV A;  1W40 A;  4IIJ B;  4X1K A;  3I56 F;  3KJK A;  5GAP K;  2H8E A;  5FJ4 C;  3WGN A;  1IV3 A;  5ITZ A;  1KC8 H;  3WJR A;  5CA1 B;  1VQ9 F;  4FFB B;  2GZL A;  3ESJ A;  3MDO A;  4F6R A;  5A2Q M;  3HKB B;  1K73 H;  3CMA F;  3JAW B;  1YIT F;  2CZW A;  3E20 B;  4X1I A;  4O2B B;  1KNJ A;  1FFX A;  3ON1 A;  1NQ3 A;  3KJJ A;  5EIB C;  3FFM A;  3WPW A;  1TVK A;  1JY8 A;  3CCU F;  1RLU A;  1YIJ F;  1PXW A;  2HP0 A;  3S0Y A;  3CME F;  1YJW F;  1K8A H;  3NK6 A;  4ZI7 A;  3CPQ A;  5JQG A;  4E6E A;  4ZHW A;  3VYT C;  5GON B;  5LP6 A;  3FBA A;  1H47 A;  5KX5 B;  3Q8H A;  1XBI A;  4X1Y B;  3LFO A;  1X25 A;  1IV2 A;  2B33 A;  3WGK A;  4B5C A;  4KWE A;  1FNJ A;  1NMU B;  2ZOD A;  2HX0 A;  4C8G A;  3HKE A;  4I50 B;  5LA6 B;  1DBF A;  4EB6 A;  1UFY A;  1H48 A;  5JH7 B;  3DC2 A;  1SA0 B;  2UYN B;  2R75 1;  5BMV A;  1U3L A;  1W3E X;  4XCQ A;  1M1K H;  1Q8R A;  3RE3 A;  2CW4 A;  1QD9 A;  2G9I A;  3NVK E;  3GTZ A;  4B62 A;  5FNV B;  4YJ2 B;  2V9Y A;  4O2A B;  5JCO A;  3VCZ A;  1KQS F;  5IJ9 B;  4I4T A;  5DCV A;  1ODE A;  4ZHV A;  1IV1 A;  2PHN A;  5B8F A;  1E7K A;  3ZP7 A;  3CPW F;  3LWR C;  1Q81 H;  4EI9 A;  4DRX A;  4IHJ A;  3IKE A;  4O4I B;  3VO8 A;  5J2T A;  2QEX F;  1QVF F;  3D54 A;  1VQ6 F;  1YGY A;  1IV4 A;  1VQ7 F;  1TUB A;  3WGM A;  4G88 A;  3JVH A;  2BO1 A;  3K2X A;  5IYZ A;  5LOV A;  4BVS A;  2YYE A;  2BTO A;  3RYI A;  2RB9 A;  1VHA A;  5CB4 B;  3VIU A;  1X7O A;  2ALE A;  4U3J A;  5JVD B;  1Q86 H;  3K12 A;  5GAN K;  3LWV C;  2RHL A;  3HKC A;  1CK2 A;  3JAK A;  5G4V C;  4YJ3 B;  4ZOL B;  2FC3 A;  3LYB A;  1COM A;  3MCA B;  3G71 F;  3IEW A;  3E22 A;  3JAT B;  4TUY B;  3WGJ A;  5EYP B;  2RHH A;  2I6D A;  3P0Z A;  3LME A;  4IIJ A;  2KGW A;  2HQS C;  3NK7 A;  1VQ8 F;  4I55 A;  3OON A;  2UZH A;  3T80 A;  1DT9 A;  5J2U B;  5KMG B;  3FD6 A;  1W42 A;  4B45 A;  3VYU C;  3C8L A;  4X20 B;  5CA1 A;  3KHN A;  1XHO A;  1VQV A;  3RYF A;  3G4S F;  3TD3 A;  5LP6 C;  3HKB A;  3KIZ A;  3L7Q A;  1RQ2 A;  3S02 A;  4TV8 B;  3RA6 A;  2AMT A;  5FLX M;  3CYQ A;  4C8E A;  4BVR A;  4G4W A;  1ONI A;  5IJ0 B;  1CN7 A;  3JAS B;  1RA4 A;  4BT5 A;  1SDS A;  3V7E A;  1QAH A;  5EB0 A;  3S06 A;  3HTN A;  4WBN B;  3HKD A;  3MCQ A;  1VQO F;  2K1S A;  3D01 A;  5LXT B;  2CWJ A;  2RHO A;  4X3M A;  3RYH B;  1YJN F;  2AIF A;  1W59 A;  2CHT A;  5GON A;  5HY1 A;  1GZ0 A;  3GYQ A;  5HXU A;  2HRU A;  4X1Y A;  3ZO8 A;  1YQN A;  2HS4 A;  3RYC A;  3LWO C;  2DT4 A;  3CD6 F;  3WJP A;  3E1Y A;  5LA6 A;  2UYN A;  3LWP C;  5GIO C;  3CYP B;  3FPI A;  1VQ5 F;  5LYJ B;  1J7H A;  4O4L A;  2Z1T A;  2CHS A;  3F0G A;  2LBW A;  3UT5 B;  2IAF A;  3D00 A;  4LNU B;  3LDT A;  2NMU A;  1QU9 A;  2VXY A;  2LBT A;  4NUT A;  4BT3 A;  3P4E A;  1W55 A;  1T0K B;  4HNA B;  4TZZ A;  3N2K B;  3N2G B;  3JAR B;  4O4I A;  2Z01 A;  4X1K B;  4NWO B;  2Z1U A;  3FD5 A;  3IMP A;  1Z5W A;  3K14 A;  1YHQ F;  5G4U C;  3C9R A;  2OTL F;  4R40 B;  5EZY A;  3HAX D;  2YXZ A;  4NQ3 A;  2KTV A;  3NVI B;  3V7Q A;  2LCA A;  1SZQ A;  1T0A A;  1XRG A;  4F6R B;  2VAP A;  1PF5 A;  4X3L A;  1VQ4 F;  1FNK A;  4BT4 A;  4TUY A;  3B6N A;  3HJW C;  4O4J A;  4X1I B;  4C81 A;  1Q7Y H;  1FFX B;  3TD4 A;  1GX1 A;  3M84 A;  1TVK B;  2Z1F A;  1VQN F;  2R6R 1;  2H8C A;  3NMU C;  3IEQ A;  2HP0 B;  5J2U A;  2Z1E A;  4ZI7 B;  4BY9 D;  5MN4 A;  4G4X A;  4X20 A;  3CCQ F;  2Q1Y A;  5JQG B;  2VAM A;  2IG8 A;  5LP6 B;  4O4H A;  1RLG A;  1KNK A;  1JFF A;  3F0D A;  5HP7 A;  2P6Y A;  1U40 A;  3V4D A;  3PLA C;  4C8I A;  3I55 F;  4TV9 A;  3HKE B;  3WGL A;  4EB6 B;  3M4S A;  1KD1 H;  2GVI A;  5C8Y A;  5HY2 A;  2OZB A;  1XV2 A;  5BMV B;  1W41 A;  5HP8 A; 
#chains in the Genus database with same CATH homology
 3WXM B;  1YIJ F;  1JJ2 F;  3CCV F;  1VQO F;  1PXW A;  3CG6 A;  3CME F;  1YJW F;  1K8A H;  3NK6 A;  3CPQ A;  3JCM M;  4X3M A;  1IPA A;  1YJN F;  2AIF A;  3J80 M;  3VMF B;  3V3T A;  5HY1 A;  1GZ0 A;  4LCK A;  3GYQ A;  1XBI A;  2GLZ A;  5HXU A;  2QA4 F;  2OTJ F;  3LFO A;  3LWO C;  2LBX A;  1YJ9 F;  5EO3 A;  3LWQ C;  3CD6 F;  5HY4 A;  1NMU B;  3E1Y A;  3CCR F;  4BVT A;  1X52 A;  3CCJ F;  3LWP C;  5GIO C;  2OHW A;  2KTU A;  3AGK A;  1VQ5 F;  1W3E X;  1K9M H;  4C4W C;  4XCQ A;  1M1K H;  1H7M A;  3J81 M;  2QI2 A;  3NVK E;  3O85 A;  1N8R H;  5GIN C;  2LBW A;  3CC7 F;  3D00 A;  1X7P A;  3J7A R;  1KQS F;  2WAL A;  3CXC F;  1VQL F;  1ZWZ A;  5DCV A;  4NUT A;  1E7K A;  3CPW F;  1T0K B;  3LWR C;  1YI2 F;  1Q81 H;  1NJI H;  4TZZ A;  4EI9 A;  2FGY A;  1GO1 A;  4BVQ A;  3JAM M;  2QEX F;  1QVF F;  1VQ6 F;  5GIP C;  1YHQ F;  5G4U C;  1VQP F;  1VQ7 F;  4BW0 B;  2OTL F;  2BO1 A;  4BVS A;  3HAX D;  3RA5 A;  4NQ3 A;  2KTV A;  3NVI B;  1X7O A;  2ALE A;  3V7Q A;  1S72 F;  1QVG F;  2JNB A;  1Q86 H;  4EI7 A;  5GAN K;  3VI6 A;  3LWV C;  3CCM F;  1CK2 A;  5HXZ A;  5G4V C;  5HY0 A;  4X3L A;  2FC3 A;  3IR9 A;  3CCL F;  1VQ4 F;  3G71 F;  3CC4 F;  3MCA B;  3OBW A;  3HJW C;  5IT9 M;  2KG4 A;  1Q7Y H;  3CCE F;  2F9Z C;  2I6D A;  1GO0 A;  2VGN A;  2VGM A;  1VQN F;  2HVY D;  3SIV A;  1W40 A;  1VQ8 F;  3NK7 A;  3I56 F;  5GAP K;  3CCS F;  3OBY A;  5HWE A;  1DT9 A;  1W2B F;  1VQK F;  3NMU C;  5FJ4 C;  1W42 A;  4BY9 D;  4EI8 A;  1KC8 H;  3CCQ F;  1VQ9 F;  3PAF A;  3G4S F;  1Q82 H;  1RLG A;  5A2Q M;  1M90 H;  1VQM F;  1K73 H;  3CMA F;  3N4Z A;  3PLA C;  3CC2 F;  1YIT F;  3RA6 A;  2CZW A;  3SIU A;  5FLX M;  3I55 F;  3E20 B;  4BVR A;  1CN7 A;  1KD1 H;  1RA4 A;  3G6E F;  3ON1 A;  5EWR A;  3N4Y A;  5HY2 A;  3OW2 F;  1SDS A;  2OZB A;  3FFM A;  3V7E A;  3CCU F;  1W41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...