3CCJF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccjF00
3N4YA 2QA4F 1RLGA 3CG6A 1VQKF 5DCVA 4C4WC 3NK6A 3O85A 3G4SF 1X7PA 5GIOC 3CD6F 3SIVA 2FC3A 3LWPC 5IT9M 2QI2A 1S72F 3CC4F 1QVFF 2VGNA 1NJIH 1W3EX 3OW2F 1K9MH 5GINC 1T0KB 1Q86H 3CCEF 1VQ4F 1PXWA 1Q7YH 3WXMB 1YJ9F 3V7QA 3J7AR 1VQNF 2OHWA 5A2QM 4X3LA 1X52A 1W41A 1YJNF 1NMUB 2VGMA 1W2BF 3MCAB 3CCLF 3CXCF 1Q82H 1GO1A 3VI6A 1VQ7F 1GZ0A 3N4ZA 2I6DA 3LWOC 3LWRC 1KD1H 1XBIA 3HAXD 1W42A 3RA5A 1VQPF 3CCRF 5GANK 1M90H 3G71F 3I55F 1YHQF 2AIFA 1VQ5F 4NUTA 5GIPC 3CCUF 3CCSF 3AGKA 2OTLF 3HJWC 1VQOF 3CPWF 3IR9A 2ALEA 4TZZA 5G4UC 2BO1A 3GYQA 1VQMF 1K8AH 2KTUA 1YIJF 5FJ4C 1GO0A 1DT9A 1YI2F 2KG4A 1KC8H 3NVKE 1SDSA 3J80M 3CMEF 2KTVA 3LWVC 3CCMF 3LFOA 1VQ9F 1QVGF 1Q81H 2JNBA 5EWRA 3VMFB 1CK2A 3FFMA 3J81M 3JCMM 2LBXA 1IPAA 3CCJF 1ZWZA 1YJWF 1M1KH 3NVIB 1X7OA 1CN7A 3CPQA 2OZBA 3CC7F 2HVYD 1KQSF 1H7MA 2LBWA 5FLXM 3CCVF 3OBYA 1VQ8F 4LCKA 1K73H 3JAMM 3NK7A 3LWQC 2QEXF 3PAFA 3SIUA 4BW0B 1RA4A 3CMAF 1N8RH 3PLAC 1JJ2F 1W40A 3CCQF 3CC2F 3E1YA 5GAPK 5G4VC 3NMUC 3V7EA 3ON1A 3OBWA 2CZWA 1VQ6F 1YITF 1VQLF 4X3MA 2WALA 4BY9D 2OTJF 3I56F 3E20B 1E7KA 3G6EF 3RA6A 5EO3A
chains in the Genus database with same CATH superfamily
2CW4A 5CA0A 2Z1FA 2KGWA 3M1XA 1X7PA 3BYQA 3WGJA 3JVHA 3DDNA 2QI2A 1VK3A 1S72F 1QVFF 2VGNA 1NJIH 1W3EX 5J2TB 3P10A 4O4LA 1K9MH 3C9SA 4O4HA 3UT5A 3HKEB 1T0KB 4HNAA 5EYPA 1PXWA 4G4ZA 1Q7YH 4ZOLA 5IJ0B 5ITZA 3V7QA 3J7AR 1IV2A 1VQNF 2IAFA 3HTNA 2OHWA 4X3LA 1W41A 1YJNF 2GVIA 1NQ3A 1Q82H 4ZHYB 5JQGA 1U40A 5HP7A 4ZHQA 4TUYA 1W42A 2ZF8A 3MCQA 3P0ZA 1VQPF 3K12A 5GANK 3F0GA 3I55F 1YHQF 3IMPA 2VXYA 5MN6A 4NUTA 4R40B 4WBNB 3CCUF 5JVDB 2L26A 2ZVYA 5LA6A 2BO1A 4X20B 4EI9A 2B33A 1K8AH 5FJ4C 1GO0A 1DT9A 2N48A 1KC8H 1SDSA 3MDOA 1XRGA 3CCMF 3QUWA 1XHOA 1KNKA 1Q81H 1H47A 3R0PA 3VMFB 3FFMA 4NWOB 1W5AA 2IG8A 2UYJA 5LXTB 3ZOPA 1GX1A 3CC7F 3N2GB 1TUBB 5CB4B 3WPWA 2LBWA 4IHJB 4TV8A 1T0AA 5C8YB 2VAWA 4B45A 3U0OA 3SIUA 3K2XA 3JATA 1JJ2F 3PLAC 2AIZP 5GONB 2HP0A 1JN1A 2HRUA 3MQWA 5G4VC 1U43A 2GLZA 1SA0A 3LMEA 3CYQA 1VQ6F 1XV2A 2WALA 1JFFA 2Z01A 4BY9D 2OTJF 3I56F 3E20B 1E7KA 1PF5A 3CG6A 1VQKF 3HKCB 4X1IA 2H6LA 5J2UB 5HY2A 5GIOC 3CD6F 3SIVA 4O2BA 1X25A 3CB2A 4IIJB 3LWPC 5IT9M 4LNUA 5IJ0A 4E6EA 4YJ3B 1OFUA 5GINC 1OAPA 4G4WA 3RYHB 4B5CA 3KIZA 1Q86H 3FD6A 5KX5B 2CVLA 1FFXA 3ERNA 3Q8HA 4O4IB 1JY8A 2RHOA 5FNVA 5A2QM 1X52A 2BTUA 5LYJB 5IJ9A 2CSLA 3WGMA 5JCOC 5EZYA 3CCLF 1VQVA 3CXCF 2EWCA 1VQ7F 3N4ZA 3LWOC 4DXDA 1W55A 2Z1TA 3HAXD 1RLUA 5MN5A 3RA5A 4X1KA 4ZK7A 4YJ2A 3CCRF 1M90H 3D54A 1JD1A 4FFBA 5KMGB 2RHJA 5LOVA 3C9RA 3AGKA 3C8LA 4G88A 2IQQA 1W581 1FNKA 1W57A 3LYBA 4I50A 5BMVB 3WJQA 5G4UC 2ZODA 3RYCA 3VYTC 1YIJF 3RE3A 4EB6A 1YI2F 3P4EA 4ZI7A 3S03A 5EIBC 3LDTA 3J80M 2KTVA 3JARA 3I3FA 5HXUA 2AMTA 5HP8A 1SZQA 2HS3A 3J81M 3N2GA 2LBXA 3B6NA 1TUBA 3WJPA 3FPIA 3NVIB 4O2AB 2FGYA 3CPQA 1TVKB 3WGNA 4EI7A 4KWEA 3D01A 1KQSF 1H7MA 3N2KB 3E22B 5FLXM 3CCVF 2CHSA 3F0FA 3JAWA 4LCKA 2HRYA 5HY0A 1K73H 2DYYA 3JAMM 3VYUC 2Q1YA 2QEXF 3HKDB 5LP6C 2H8CA 3M84A 1RA4A 3CMAF 4ERHA 5CA0B 3CC2F 3WGLA 2HS4A 3HKBA 2CWJA 5IYZA 3NMUC 4BT3A 5JH7A 4XCQA 4I55A 2HS0A 1UFYA 2YYEA 3QHDA 4X1YB 5LP6A 2CZWA 4RQOA 5EIBD 4O4LB 4B46A 1YITF 4O4HB 4U3JA 3UT5B 4BT2A 4HNAB 2UYKA 5EYPB 3TD5A 4ZOLB 3RA6A 3G6EF 5ITZB 3G71F 3IEQA 2UYNA 4PWTA 3RYIA 4C4WC 3F0DA 3G4SF 2FC3A 1Z5VA 5HY1A 3JAKA 3K14A 4O4JB 3CC4F 1IV4A 5JQGB 5CA1A 4RHAA 2I6RA 4BT7A 2Z1UA 4TUYB 4DRXB 3JALA 3RYFA 2UYPA 4I4TB 4C8EA 4F6RB 1VQ4F 2G9IA 3JASA 3WXMB 3C9TA 1YJ9F 4TV9B 4C81A 4BVTA 2K1SA 4G4VA 1RQ7A 5HY4A 3KE1A 2VGMA 2GZLA 1W2BF 3MCAB 3TD4A 3VO8A 1GO1A 5LA6B 1GZ0A 3LWRC 2I6DA 5J2TA 1XBIA 3FD5A 3HKEA 2R6R1 4U39A 1ODEA 1YQNA 2VAPA 2AIFA 5GIPC 3S0WA 3S06A 3ESJA 2OTLF 3HJWC 1VQOF 4M8IA 2ALEA 2P6YA 3GYQA 1VQMF 2UZHA 1UI9A 1Q8RA 2KTUA 4C8GA 3QTYA 3ZP7A 4TV8B 3CMEF 4WBNA 2F9ZC 5EWRA 5JVDA 5JCOA 2HP0B 3E22A 1W59A 4ZHVA 3CCJF 1ZWZA 1M1KH 4X20A 1CN7A 1X7OA 1W5FA 3TD3A 3OONA 3HKDA 1SA0B 1H48A 4C8IA 3K0TA 3KJJA 3NK7A 1JFFB 3V4DA 4C82A 3I7TA 5MN4A 1RQ2A 1W40A 4X1YA 4X1IB 3V3TA 4B62A 1FSZA 5GAPK 4O2BB 2Z1EA 5LXTA 3V7EA 3ON1A 4LNUB 1CLIA 4BT5A 3OBWA 5CB4A 2ZVZA 4IHJA 4G4XA 2YXZA 3S02A 5C8YA 2PHNA 5EB0A 2DT4A 1COMA 5HXZA 2HQSC 2KG4A 1FFXB 1QD9A 3N4YA 4O4JA 2QA4F 1RLGA 5DCVA 1U3PA 5GONA 3NK6A 2H8EA 3O85A 5FNVB 1W5EA 4DRXA 5IJ9B 2OTMA 4I4TA 3MBMA 3HWUA 4F6RA 3VCZA 5EZYB 5EAZA 4TV9A 1KNJA 3OW2F 4EI8A 3CCEF 4X1KB 4YJ2B 3D00A 1VH8A 1IV1A 3HKCA 4FFBB 3EORA 4NQ3A 1Z5WA 4G4YA 5J2UA 1NMUB 5LOVB 4IIJA 3VOAA 3S0YA 4BT4A 3DC2A 3VI6A 1IV3A 1VHAA 4BT6A 3IKFA 2RHLA 4I50B 1DBFA 4YJ3A 1KD1H 3F6MA 1W5BA 3RYHA 1U3LA 1J7HA 2HX0A 3RYCB 5KX5A 4EB6B 2ZAUA 4BVSA 3ZP4A 4ZI7B 2RHHA 3CYPB 3S0HA 2BTOA 4O4IA 4ZHQB 5B8FA 3GTZA 3JARB 1VQ5F 5LYJA 2R751 3CCSF 2MQEA 3ELCA 3CPWF 3IR9A 4TZZA 3C9UA 2Q1XA 3NVKE 1QU9A 5KMGA 3GHZA 3F0EA 3JAWB 3FBAA 3LWVC 3T80A 3IEWA 3LFOA 1VQ9F 3VYSC 2HP3A 1QVGF 1FNJA 2JNBA 3IKEA 3KJKA 1CK2A 3JCMM 5AVMA 3WJRA 1YGYA 5BMVA 1IPAA 3ZO8A 1YJWF 2NMUA 3HKBB 5IYZB 1QAHA 3VTIC 2CHTA 3WGKA 5JH7B 1ONIA 4I55B 3L7QA 2OZBA 2HVYD 2BTQB 2LCAA 5LP6B 3M4SA 3OBYA 2W8BC 1VQ8F 4U3JB 2V9YA 3LWQC 3PAFA 2QTPA 4BW0B 4BVQA 2RB9A 2UYNB 3RYIB 3CCQF 4BVRA 2PMPA 3E1YA 4O2AA 3VOBA 2VAMA 4ZHWA 1TVKA 3JAKB 3JATB 5EB1B 3N2KA 2LBTA 5CA1B 3KHNA 1R1MA 3JALB 3RYFB 1VQLF 4X3MA 3WPXA 2ZOVA 5HWEA 3JASB 3VIUA 1N8RH 5EO3A
chains in the Genus database with same CATH topology
3N4YA 2QA4F 1RLGA 3CG6A 1VQKF 5DCVA 4C4WC 3NK6A 3O85A 3G4SF 5HY2A 1X7PA 5GIOC 3CD6F 3SIVA 2FC3A 5HY1A 3LWPC 5IT9M 2QI2A 1S72F 3CC4F 1QVFF 2VGNA 1NJIH 1W3EX 3OW2F 1K9MH 5GINC 1T0KB 4EI8A 1Q86H 3CCEF 1VQ4F 1PXWA 1Q7YH 3WXMB 3D00A 1YJ9F 3V7QA 3J7AR 4BVTA 1VQNF 2OHWA 5HY4A 4NQ3A 5A2QM 4X3LA 1X52A 1W41A 1YJNF 1NMUB 2VGMA 1W2BF 3MCAB 3CCLF 3CXCF 1Q82H 1GO1A 3VI6A 1VQ7F 1GZ0A 3N4ZA 2I6DA 3LWOC 3LWRC 1KD1H 1XBIA 3HAXD 1W42A 3RA5A 1VQPF 4BVSA 3CCRF 5GANK 1M90H 3G71F 3I55F 1YHQF 2AIFA 1VQ5F 4NUTA 5GIPC 3CCUF 3CCSF 3AGKA 2OTLF 3HJWC 1VQOF 3CPWF 3IR9A 2ALEA 4TZZA 5G4UC 2BO1A 4EI9A 3GYQA 1VQMF 1K8AH 2KTUA 1YIJF 5FJ4C 1GO0A 1DT9A 1YI2F 2KG4A 1KC8H 3NVKE 1SDSA 3J80M 3CMEF 2KTVA 3LWVC 3CCMF 1E7KA 3LFOA 1VQ9F 5HXUA 1QVGF 1Q81H 2F9ZC 2JNBA 5EWRA 3VMFB 1CK2A 3FFMA 3J81M 3JCMM 2LBXA 1IPAA 3CCJF 1ZWZA 1YJWF 1M1KH 3NVIB 1X7OA 1CN7A 2FGYA 3CPQA 4EI7A 2OZBA 3CC7F 2HVYD 1KQSF 1H7MA 2LBWA 5FLXM 3CCVF 3OBYA 1VQ8F 4LCKA 5HY0A 1K73H 3JAMM 3NK7A 3LWQC 2QEXF 3PAFA 3SIUA 4BW0B 1RA4A 3CMAF 1N8RH 4BVQA 3PLAC 1JJ2F 3V3TA 1W40A 3CCQF 4BVRA 3CC2F 3E1YA 5GAPK 5G4VC 3NMUC 3V7EA 4XCQA 3ON1A 2GLZA 3OBWA 2CZWA 1VQ6F 1YITF 1VQLF 4X3MA 2WALA 4BY9D 2OTJF 5HWEA 3I56F 3E20B 5HXZA 3G6EF 3RA6A 5EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Y A;  2QA4 F;  1RLG A;  3CG6 A;  1VQK F;  5DCV A;  4C4W C;  3NK6 A;  3O85 A;  3G4S F;  1X7P A;  5GIO C;  3CD6 F;  3SIV A;  2FC3 A;  3LWP C;  5IT9 M;  2QI2 A;  1S72 F;  3CC4 F;  1QVF F;  2VGN A;  1NJI H;  1W3E X;  3OW2 F;  1K9M H;  5GIN C;  1T0K B;  1Q86 H;  3CCE F;  1VQ4 F;  1PXW A;  1Q7Y H;  3WXM B;  1YJ9 F;  3V7Q A;  3J7A R;  1VQN F;  2OHW A;  5A2Q M;  4X3L A;  1X52 A;  1W41 A;  1YJN F;  1NMU B;  2VGM A;  1W2B F;  3MCA B;  3CCL F;  3CXC F;  1Q82 H;  1GO1 A;  3VI6 A;  1VQ7 F;  1GZ0 A;  3N4Z A;  2I6D A;  3LWO C;  3LWR C;  1KD1 H;  1XBI A;  3HAX D;  1W42 A;  3RA5 A;  1VQP F;  3CCR F;  5GAN K;  1M90 H;  3G71 F;  3I55 F;  1YHQ F;  2AIF A;  1VQ5 F;  4NUT A;  5GIP C;  3CCU F;  3CCS F;  3AGK A;  2OTL F;  3HJW C;  1VQO F;  3CPW F;  3IR9 A;  2ALE A;  4TZZ A;  5G4U C;  2BO1 A;  3GYQ A;  1VQM F;  1K8A H;  2KTU A;  1YIJ F;  5FJ4 C;  1GO0 A;  1DT9 A;  1YI2 F;  2KG4 A;  1KC8 H;  3NVK E;  1SDS A;  3J80 M;  3CME F;  2KTV A;  3LWV C;  3CCM F;  3LFO A;  1VQ9 F;  1QVG F;  1Q81 H;  2JNB A;  5EWR A;  3VMF B;  1CK2 A;  3FFM A;  3J81 M;  3JCM M;  2LBX A;  1IPA A;  3CCJ F;  1ZWZ A;  1YJW F;  1M1K H;  3NVI B;  1X7O A;  1CN7 A;  3CPQ A;  2OZB A;  3CC7 F;  2HVY D;  1KQS F;  1H7M A;  2LBW A;  5FLX M;  3CCV F;  3OBY A;  1VQ8 F;  4LCK A;  1K73 H;  3JAM M;  3NK7 A;  3LWQ C;  2QEX F;  3PAF A;  3SIU A;  4BW0 B;  1RA4 A;  3CMA F;  1N8R H;  3PLA C;  1JJ2 F;  1W40 A;  3CCQ F;  3CC2 F;  3E1Y A;  5GAP K;  5G4V C;  3NMU C;  3V7E A;  3ON1 A;  3OBW A;  2CZW A;  1VQ6 F;  1YIT F;  1VQL F;  4X3M A;  2WAL A;  4BY9 D;  2OTJ F;  3I56 F;  3E20 B;  1E7K A;  3G6E F;  3RA6 A;  5EO3 A; 
#chains in the Genus database with same CATH topology
 2CW4 A;  5CA0 A;  2Z1F A;  2KGW A;  3M1X A;  1X7P A;  3BYQ A;  3WGJ A;  3JVH A;  3DDN A;  2QI2 A;  1VK3 A;  1S72 F;  1QVF F;  2VGN A;  1NJI H;  1W3E X;  5J2T B;  3P10 A;  4O4L A;  1K9M H;  3C9S A;  4O4H A;  3UT5 A;  3HKE B;  1T0K B;  4HNA A;  5EYP A;  1PXW A;  4G4Z A;  1Q7Y H;  4ZOL A;  5IJ0 B;  5ITZ A;  3V7Q A;  3J7A R;  1IV2 A;  1VQN F;  2IAF A;  3HTN A;  2OHW A;  4X3L A;  1W41 A;  1YJN F;  2GVI A;  1NQ3 A;  1Q82 H;  4ZHY B;  5JQG A;  1U40 A;  5HP7 A;  4ZHQ A;  4TUY A;  1W42 A;  2ZF8 A;  3MCQ A;  3P0Z A;  1VQP F;  3K12 A;  5GAN K;  3F0G A;  3I55 F;  1YHQ F;  3IMP A;  2VXY A;  5MN6 A;  4NUT A;  4R40 B;  4WBN B;  3CCU F;  5JVD B;  2L26 A;  2ZVY A;  5LA6 A;  2BO1 A;  4X20 B;  4EI9 A;  2B33 A;  1K8A H;  5FJ4 C;  1GO0 A;  1DT9 A;  2N48 A;  1KC8 H;  1SDS A;  3MDO A;  1XRG A;  3CCM F;  3QUW A;  1XHO A;  1KNK A;  1Q81 H;  1H47 A;  3R0P A;  3VMF B;  3FFM A;  4NWO B;  1W5A A;  2IG8 A;  2UYJ A;  5LXT B;  3ZOP A;  1GX1 A;  3CC7 F;  3N2G B;  1TUB B;  5CB4 B;  3WPW A;  2LBW A;  4IHJ B;  4TV8 A;  1T0A A;  5C8Y B;  2VAW A;  4B45 A;  3U0O A;  3SIU A;  3K2X A;  3JAT A;  1JJ2 F;  3PLA C;  2AIZ P;  5GON B;  2HP0 A;  1JN1 A;  2HRU A;  3MQW A;  5G4V C;  1U43 A;  2GLZ A;  1SA0 A;  3LME A;  3CYQ A;  1VQ6 F;  1XV2 A;  2WAL A;  1JFF A;  2Z01 A;  4BY9 D;  2OTJ F;  3I56 F;  3E20 B;  1E7K A;  1PF5 A;  3CG6 A;  1VQK F;  3HKC B;  4X1I A;  2H6L A;  5J2U B;  5HY2 A;  5GIO C;  3CD6 F;  3SIV A;  4O2B A;  1X25 A;  3CB2 A;  4IIJ B;  3LWP C;  5IT9 M;  4LNU A;  5IJ0 A;  4E6E A;  4YJ3 B;  1OFU A;  5GIN C;  1OAP A;  4G4W A;  3RYH B;  4B5C A;  3KIZ A;  1Q86 H;  3FD6 A;  5KX5 B;  2CVL A;  1FFX A;  3ERN A;  3Q8H A;  4O4I B;  1JY8 A;  2RHO A;  5FNV A;  5A2Q M;  1X52 A;  2BTU A;  5LYJ B;  5IJ9 A;  2CSL A;  3WGM A;  5JCO C;  5EZY A;  3CCL F;  1VQV A;  3CXC F;  2EWC A;  1VQ7 F;  3N4Z A;  3LWO C;  4DXD A;  1W55 A;  2Z1T A;  3HAX D;  1RLU A;  5MN5 A;  3RA5 A;  4X1K A;  4ZK7 A;  4YJ2 A;  3CCR F;  1M90 H;  3D54 A;  1JD1 A;  4FFB A;  5KMG B;  2RHJ A;  5LOV A;  3C9R A;  3AGK A;  3C8L A;  4G88 A;  2IQQ A;  1W58 1;  1FNK A;  1W57 A;  3LYB A;  4I50 A;  5BMV B;  3WJQ A;  5G4U C;  2ZOD A;  3RYC A;  3VYT C;  1YIJ F;  3RE3 A;  4EB6 A;  1YI2 F;  3P4E A;  4ZI7 A;  3S03 A;  5EIB C;  3LDT A;  3J80 M;  2KTV A;  3JAR A;  3I3F A;  5HXU A;  2AMT A;  5HP8 A;  1SZQ A;  2HS3 A;  3J81 M;  3N2G A;  2LBX A;  3B6N A;  1TUB A;  3WJP A;  3FPI A;  3NVI B;  4O2A B;  2FGY A;  3CPQ A;  1TVK B;  3WGN A;  4EI7 A;  4KWE A;  3D01 A;  1KQS F;  1H7M A;  3N2K B;  3E22 B;  5FLX M;  3CCV F;  2CHS A;  3F0F A;  3JAW A;  4LCK A;  2HRY A;  5HY0 A;  1K73 H;  2DYY A;  3JAM M;  3VYU C;  2Q1Y A;  2QEX F;  3HKD B;  5LP6 C;  2H8C A;  3M84 A;  1RA4 A;  3CMA F;  4ERH A;  5CA0 B;  3CC2 F;  3WGL A;  2HS4 A;  3HKB A;  2CWJ A;  5IYZ A;  3NMU C;  4BT3 A;  5JH7 A;  4XCQ A;  4I55 A;  2HS0 A;  1UFY A;  2YYE A;  3QHD A;  4X1Y B;  5LP6 A;  2CZW A;  4RQO A;  5EIB D;  4O4L B;  4B46 A;  1YIT F;  4O4H B;  4U3J A;  3UT5 B;  4BT2 A;  4HNA B;  2UYK A;  5EYP B;  3TD5 A;  4ZOL B;  3RA6 A;  3G6E F;  5ITZ B;  3G71 F;  3IEQ A;  2UYN A;  4PWT A;  3RYI A;  4C4W C;  3F0D A;  3G4S F;  2FC3 A;  1Z5V A;  5HY1 A;  3JAK A;  3K14 A;  4O4J B;  3CC4 F;  1IV4 A;  5JQG B;  5CA1 A;  4RHA A;  2I6R A;  4BT7 A;  2Z1U A;  4TUY B;  4DRX B;  3JAL A;  3RYF A;  2UYP A;  4I4T B;  4C8E A;  4F6R B;  1VQ4 F;  2G9I A;  3JAS A;  3WXM B;  3C9T A;  1YJ9 F;  4TV9 B;  4C81 A;  4BVT A;  2K1S A;  4G4V A;  1RQ7 A;  5HY4 A;  3KE1 A;  2VGM A;  2GZL A;  1W2B F;  3MCA B;  3TD4 A;  3VO8 A;  1GO1 A;  5LA6 B;  1GZ0 A;  3LWR C;  2I6D A;  5J2T A;  1XBI A;  3FD5 A;  3HKE A;  2R6R 1;  4U39 A;  1ODE A;  1YQN A;  2VAP A;  2AIF A;  5GIP C;  3S0W A;  3S06 A;  3ESJ A;  2OTL F;  3HJW C;  1VQO F;  4M8I A;  2ALE A;  2P6Y A;  3GYQ A;  1VQM F;  2UZH A;  1UI9 A;  1Q8R A;  2KTU A;  4C8G A;  3QTY A;  3ZP7 A;  4TV8 B;  3CME F;  4WBN A;  2F9Z C;  5EWR A;  5JVD A;  5JCO A;  2HP0 B;  3E22 A;  1W59 A;  4ZHV A;  3CCJ F;  1ZWZ A;  1M1K H;  4X20 A;  1CN7 A;  1X7O A;  1W5F A;  3TD3 A;  3OON A;  3HKD A;  1SA0 B;  1H48 A;  4C8I A;  3K0T A;  3KJJ A;  3NK7 A;  1JFF B;  3V4D A;  4C82 A;  3I7T A;  5MN4 A;  1RQ2 A;  1W40 A;  4X1Y A;  4X1I B;  3V3T A;  4B62 A;  1FSZ A;  5GAP K;  4O2B B;  2Z1E A;  5LXT A;  3V7E A;  3ON1 A;  4LNU B;  1CLI A;  4BT5 A;  3OBW A;  5CB4 A;  2ZVZ A;  4IHJ A;  4G4X A;  2YXZ A;  3S02 A;  5C8Y A;  2PHN A;  5EB0 A;  2DT4 A;  1COM A;  5HXZ A;  2HQS C;  2KG4 A;  1FFX B;  1QD9 A;  3N4Y A;  4O4J A;  2QA4 F;  1RLG A;  5DCV A;  1U3P A;  5GON A;  3NK6 A;  2H8E A;  3O85 A;  5FNV B;  1W5E A;  4DRX A;  5IJ9 B;  2OTM A;  4I4T A;  3MBM A;  3HWU A;  4F6R A;  3VCZ A;  5EZY B;  5EAZ A;  4TV9 A;  1KNJ A;  3OW2 F;  4EI8 A;  3CCE F;  4X1K B;  4YJ2 B;  3D00 A;  1VH8 A;  1IV1 A;  3HKC A;  4FFB B;  3EOR A;  4NQ3 A;  1Z5W A;  4G4Y A;  5J2U A;  1NMU B;  5LOV B;  4IIJ A;  3VOA A;  3S0Y A;  4BT4 A;  3DC2 A;  3VI6 A;  1IV3 A;  1VHA A;  4BT6 A;  3IKF A;  2RHL A;  4I50 B;  1DBF A;  4YJ3 A;  1KD1 H;  3F6M A;  1W5B A;  3RYH A;  1U3L A;  1J7H A;  2HX0 A;  3RYC B;  5KX5 A;  4EB6 B;  2ZAU A;  4BVS A;  3ZP4 A;  4ZI7 B;  2RHH A;  3CYP B;  3S0H A;  2BTO A;  4O4I A;  4ZHQ B;  5B8F A;  3GTZ A;  3JAR B;  1VQ5 F;  5LYJ A;  2R75 1;  3CCS F;  2MQE A;  3ELC A;  3CPW F;  3IR9 A;  4TZZ A;  3C9U A;  2Q1X A;  3NVK E;  1QU9 A;  5KMG A;  3GHZ A;  3F0E A;  3JAW B;  3FBA A;  3LWV C;  3T80 A;  3IEW A;  3LFO A;  1VQ9 F;  3VYS C;  2HP3 A;  1QVG F;  1FNJ A;  2JNB A;  3IKE A;  3KJK A;  1CK2 A;  3JCM M;  5AVM A;  3WJR A;  1YGY A;  5BMV A;  1IPA A;  3ZO8 A;  1YJW F;  2NMU A;  3HKB B;  5IYZ B;  1QAH A;  3VTI C;  2CHT A;  3WGK A;  5JH7 B;  1ONI A;  4I55 B;  3L7Q A;  2OZB A;  2HVY D;  2BTQ B;  2LCA A;  5LP6 B;  3M4S A;  3OBY A;  2W8B C;  1VQ8 F;  4U3J B;  2V9Y A;  3LWQ C;  3PAF A;  2QTP A;  4BW0 B;  4BVQ A;  2RB9 A;  2UYN B;  3RYI B;  3CCQ F;  4BVR A;  2PMP A;  3E1Y A;  4O2A A;  3VOB A;  2VAM A;  4ZHW A;  1TVK A;  3JAK B;  3JAT B;  5EB1 B;  3N2K A;  2LBT A;  5CA1 B;  3KHN A;  1R1M A;  3JAL B;  3RYF B;  1VQL F;  4X3M A;  3WPX A;  2ZOV A;  5HWE A;  3JAS B;  3VIU A;  1N8R H;  5EO3 A; 
#chains in the Genus database with same CATH homology
 3N4Y A;  2QA4 F;  1RLG A;  3CG6 A;  1VQK F;  5DCV A;  4C4W C;  3NK6 A;  3O85 A;  3G4S F;  5HY2 A;  1X7P A;  5GIO C;  3CD6 F;  3SIV A;  2FC3 A;  5HY1 A;  3LWP C;  5IT9 M;  2QI2 A;  1S72 F;  3CC4 F;  1QVF F;  2VGN A;  1NJI H;  1W3E X;  3OW2 F;  1K9M H;  5GIN C;  1T0K B;  4EI8 A;  1Q86 H;  3CCE F;  1VQ4 F;  1PXW A;  1Q7Y H;  3WXM B;  3D00 A;  1YJ9 F;  3V7Q A;  3J7A R;  4BVT A;  1VQN F;  2OHW A;  5HY4 A;  4NQ3 A;  5A2Q M;  4X3L A;  1X52 A;  1W41 A;  1YJN F;  1NMU B;  2VGM A;  1W2B F;  3MCA B;  3CCL F;  3CXC F;  1Q82 H;  1GO1 A;  3VI6 A;  1VQ7 F;  1GZ0 A;  3N4Z A;  2I6D A;  3LWO C;  3LWR C;  1KD1 H;  1XBI A;  3HAX D;  1W42 A;  3RA5 A;  1VQP F;  4BVS A;  3CCR F;  5GAN K;  1M90 H;  3G71 F;  3I55 F;  1YHQ F;  2AIF A;  1VQ5 F;  4NUT A;  5GIP C;  3CCU F;  3CCS F;  3AGK A;  2OTL F;  3HJW C;  1VQO F;  3CPW F;  3IR9 A;  2ALE A;  4TZZ A;  5G4U C;  2BO1 A;  4EI9 A;  3GYQ A;  1VQM F;  1K8A H;  2KTU A;  1YIJ F;  5FJ4 C;  1GO0 A;  1DT9 A;  1YI2 F;  2KG4 A;  1KC8 H;  3NVK E;  1SDS A;  3J80 M;  3CME F;  2KTV A;  3LWV C;  3CCM F;  1E7K A;  3LFO A;  1VQ9 F;  5HXU A;  1QVG F;  1Q81 H;  2F9Z C;  2JNB A;  5EWR A;  3VMF B;  1CK2 A;  3FFM A;  3J81 M;  3JCM M;  2LBX A;  1IPA A;  3CCJ F;  1ZWZ A;  1YJW F;  1M1K H;  3NVI B;  1X7O A;  1CN7 A;  2FGY A;  3CPQ A;  4EI7 A;  2OZB A;  3CC7 F;  2HVY D;  1KQS F;  1H7M A;  2LBW A;  5FLX M;  3CCV F;  3OBY A;  1VQ8 F;  4LCK A;  5HY0 A;  1K73 H;  3JAM M;  3NK7 A;  3LWQ C;  2QEX F;  3PAF A;  3SIU A;  4BW0 B;  1RA4 A;  3CMA F;  1N8R H;  4BVQ A;  3PLA C;  1JJ2 F;  3V3T A;  1W40 A;  3CCQ F;  4BVR A;  3CC2 F;  3E1Y A;  5GAP K;  5G4V C;  3NMU C;  3V7E A;  4XCQ A;  3ON1 A;  2GLZ A;  3OBW A;  2CZW A;  1VQ6 F;  1YIT F;  1VQL F;  4X3M A;  2WAL A;  4BY9 D;  2OTJ F;  5HWE A;  3I56 F;  3E20 B;  5HXZ A;  3G6E F;  3RA6 A;  5EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...