3CCJF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccjF00
5GANK 2VGMA 1K8AH 3NMUC 1YHQF 1GZ0A 1K9MH 5GIPC 1XBIA 1M90H 3HJWC 2KTUA 1KC8H 3J7AR 3NVKE 3SIUA 1T0KB 2ALEA 1KD1H 1W40A 2CZWA 1YJNF 4BW0B 3PAFA 1Q86H 1H7MA 3CCLF 3NVIB 3NK7A 2LBWA 5GINC 3G71F 1YI2F 3RA5A 1X7PA 3RA6A 2QA4F 3IR9A 4NUTA 1VQOF 5FJ4C 1Q81H 3OBYA 5A2QM 3N4ZA 1VQMF 3OBWA 1KQSF 3SIVA 3CCJF 3CCSF 3LWVC 3CC2F 1X52A 3MCAB 2KTVA 4BY9D 1ZWZA 2WALA 5IT9M 3LWRC 2OTLF 3JCMM 3CD6F 3VI6A 1VQ8F 1W3EX 1IPAA 2LBXA 4X3LA 2FC3A 5G4UC 2OTJF 1CN7A 1Q82H 3N4YA 1YITF 1SDSA 1RLGA 3G6EF 1VQ4F 1X7OA 3NK6A 1YJ9F 3PLAC 3CPQA 1K73H 2QEXF 3CC7F 1W42A 3OW2F 3O85A 2VGNA 1VQPF 1VQNF 3LWQC 1VQ9F 1YJWF 3CC4F 3CXCF 2OZBA 1RA4A 2HVYD 1GO1A 1CK2A 3V7EA 5GIOC 5DCVA 1PXWA 1GO0A 3CCQF 2OHWA 3FFMA 4TZZA 2AIFA 3LWPC 3ON1A 1VQ5F 1VQ6F 2QI2A 1VQKF 3V7QA 1W2BF 3G4SF 5GAPK 4X3MA 1QVGF 5FLXM 2BO1A 3CCEF 1QVFF 3J80M 1S72F 3CPWF 3I55F 1VQLF 2JNBA 3AGKA 1DT9A 1VQ7F 3CCRF 2KG4A 3CG6A 5EWRA 3JAMM 3CMEF 1YIJF 1NMUB 3GYQA 2I6DA 3J81M 1W41A 3VMFB 3I56F 3CCMF 5G4VC 3CCVF 4C4WC 4LCKA 3E20B 3CCUF 3LWOC 1NJIH 3WXMB 1JJ2F 1M1KH 1E7KA 5EO3A 3HAXD 1Q7YH 3CMAF 3LFOA 3E1YA 1N8RH
chains in the Genus database with same CATH superfamily
2CVLA 2GVIA 4EB6A 1YHQF 1GZ0A 1K9MH 5J2UB 1VHAA 2KTUA 1U43A 3E22A 4C82A 1W40A 4KWEA 3S06A 3PAFA 2VAWA 3NVIB 2OTMA 3NK7A 3F0DA 4X1YA 3MCQA 4G88A 2HX0A 1YI2F 5IJ9A 2QA4F 4ERHA 4ZHVA 3VTIC 2HS0A 3Q8HA 2UYNA 1IV1A 3KHNA 4BT7A 3RYIB 1VQMF 4XCQA 5BMVA 1KQSF 1JN1A 3IKEA 4G4WA 3CC2F 4FFBA 1JFFA 2HP0B 1ZWZA 5EYPB 1SA0B 5LP6B 5JH7A 2HRYA 5LYJB 2UYNB 1W3EX 1QAHA 3ESJA 3WGKA 3WGMA 1CN7A 1Q82H 1YITF 1RLGA 3G6EF 5LYJA 3M1XA 5LP6A 1SA0A 3HWUA 1X25A 4E6EA 2W8BC 3B6NA 2Z1EA 4X20B 3OW2F 2VAMA 4O2BA 5FNVA 3R0PA 5BMVB 3V3TA 4U3JA 3CC4F 2R6R1 1TVKB 3WGJA 2YYEA 1QU9A 3N2KB 3DC2A 5IJ9B 5KMGA 2IQQA 4ZHQA 3D54A 5DCVA 4X1YB 3HKEA 3CCQF 2K1SA 2B33A 2AIFA 5ITZB 1VQ5F 3M4SA 2QI2A 2UYPA 3G4SF 4X3MA 1GX1A 3WGLA 5FLXM 2BO1A 3J80M 3CPWF 2RHJA 4EB6B 2HQSC 2RB9A 1FFXB 3V4DA 3CCRF 4X1IB 2UYJA 3HKBA 5EWRA 2AIZP 3CMEF 1NMUB 3ZOPA 3K12A 3J81M 3HKCA 3I56F 4C4WC 2BTOA 5G4VC 3ELCA 4X1KA 5HP8A 3CCUF 3CYPB 3WXMB 5HY2A 5HXZA 3VCZA 1M1KH 3JASB 4F6RB 3S0WA 3CMAF 3LFOA 3E1YA 1VK3A 2BTUA 5GANK 3F6MA 5LA6B 3HJWC 2GZLA 1XBIA 2LCAA 2QTPA 3HKDA 1T0KB 2ALEA 1W5FA 5JQGB 1KNJA 4BW0B 2RHOA 4IIJA 1Q86H 3RYHB 5GINC 3WJRA 4B46A 1OFUA 3N2KA 4O4HA 4YJ3A 4NQ3A 3C9RA 4NUTA 1VQOF 1TVKA 2N48A 1Q81H 5A2QM 5CA1B 4U3JB 3JAKB 3JAWB 3T80A 5JCOC 3SIVA 3CCJF 3CCSF 4O2BB 4BT5A 3VYSC 1RQ7A 3LWVC 4X20A 3ZP7A 3VYTC 3IEWA 2L26A 5C8YB 5IT9M 4ZHYB 3WJQA 4ZOLB 4BT6A 1VQ8F 4ZI7B 1IPAA 2LBXA 2OTJF 5MN5A 3KE1A 5LOVA 1YJ9F 4EI8A 4TV9B 4I4TA 1FSZA 5EAZA 3CC7F 2HP0A 2ZODA 1W42A 3VOAA 3O85A 2VGNA 5JVDA 5J2TA 3JARB 1VQ9F 2LBTA 3RYFB 2ZF8A 2BTQB 2FGYA 2VAPA 3IKFA 5GIOC 3P10A 1QD9A 3VYUC 4BT3A 1W59A 4O4JB 1W5AA 2OHWA 3S02A 3FD5A 3ON1A 5MN6A 1VQ6F 3I3FA 4I55B 2GLZA 3LYBA 5JCOA 5GAPK 1XHOA 2Z1FA 4TV8B 4C8IA 5J2UA 4BVSA 3F0GA 1FNKA 3LDTA 3AGKA 4O4LA 1IV4A 4C81A 2I6RA 3CG6A 3KIZA 3CCVF 4C8EA 3K14A 4IHJA 4O2AB 4BT4A 4LCKA 5EB1B 1TUBB 2RHHA 2H8EA 4DXDA 3IMPA 2V9YA 4BVRA 1NJIH 2DYYA 4YJ2B 1E7KA 3MDOA 1Q7YH 3QTYA 5B8FA 5HY1A 5CB4B 3NMUC 2YXZA 4EI7A 1M90H 1ODEA 2EWCA 5GIPC 1Z5WA 3UT5B 1KC8H 1NQ3A 2Z1TA 3D00A 1KD1H 2CZWA 1YJNF 4RQOA 3RYCB 4I4TB 1H7MA 3CCLF 4BVTA 2LBWA 5LOVB 3G71F 3S0HA 4TUYB 1IV3A 3RA5A 1X7PA 1IV2A 5EB0A 3IR9A 3C8LA 5FJ4C 2NMUA 2UZHA 4LNUA 3P4EA 2Q1YA 3OBYA 5KX5B 4ZOLA 3C9UA 3N2GB 1U3LA 3N4ZA 2UYKA 3OBWA 3CYQA 2DT4A 4R40B 5C8YA 5IJ0B 2Z01A 1X52A 4B45A 3MCAB 1Z5VA 2KTVA 4BY9D 1DBFA 3K0TA 4M8IA 3JAWA 3JCMM 5HXUA 3CD6F 3N2GA 3VI6A 5CA1A 3F0FA 3JALA 2FC3A 1OAPA 3JALB 3N4YA 4TUYA 1VQ4F 2ZVZA 1X7OA 3RYHA 3NK6A 5EZYB 3WJPA 3RYCA 3CPQA 1K73H 5JQGA 2QEXF 3K2XA 3U0OA 1H47A 2MQEA 3JVHA 3HKDB 2CHSA 3UT5A 2F9ZC 2HRUA 1VQPF 1VQNF 3LWQC 4O4IB 5CB4A 3FPIA 3ZP4A 5KX5A 3CXCF 1UI9A 3JASA 4G4YA 2HVYD 1W57A 1T0AA 1GO1A 3V7EA 2P6YA 1PXWA 1GO0A 4O2AA 1R1MA 4IHJB 1COMA 5IYZB 4TZZA 3VO8A 1VQKF 4U39A 3V7QA 1W2BF 4G4VA 4X1IA 2RHLA 1FFXA 3HTNA 1W5EA 5LP6C 3WGNA 1QVFF 1S72F 2IAFA 3I55F 5GONA 2JNBA 5MN4A 1DT9A 1VQ7F 5CA0B 1PF5A 2HS4A 3JATA 1ONIA 4TV8A 4YJ2A 3JAMM 3TD4A 2CW4A 3GYQA 5LXTA 2VXYA 3EORA 4G4XA 5LXTB 4ZHQB 3FBAA 1JJ2F 3MBMA 5EIBD 3RYFA 3JATB 3OONA 2AMTA 5CA0A 3HAXD 1CLIA 3JARA 1K8AH 2VGMA 3C9SA 5GONB 5FNVB 1KNKA 3SIUA 3J7AR 3NVKE 3VIUA 4I55A 3ERNA 5IYZA 3LMEA 4O4JA 3S03A 4B5CA 2H6LA 2H8CA 3RA6A 1U40A 1RLUA 3RE3A 4ZI7A 4PWTA 1VQVA 5JH7B 4O4IA 5AVMA 1SZQA 5JVDB 5EYPA 3TD3A 5J2TB 1JFFB 3I7TA 4FFBB 4BT2A 3MQWA 2WALA 2CWJA 1YGYA 3JAKA 4TV9A 5HWEA 3RYIA 3LWRC 5EZYA 2OTLF 3CB2A 2IG8A 4G4ZA 4X3LA 1XRGA 2Q1XA 4RHAA 5G4UC 1JY8A 4O4HB 4YJ3B 4ZK7A 2ZAUA 1SDSA 2ZOVA 1W55A 3FD6A 3PLAC 2CHTA 3C9TA 3KJJA 1J7HA 3KJKA 3M84A 4B62A 2Z1UA 3E22B 3GTZA 5IJ0A 3QUWA 4ZHWA 3QHDA 1FNJA 4HNAB 2G9IA 3IEQA 1VH8A 1YQNA 1YJWF 2HP3A 4LNUB 2OZBA 1RA4A 4F6RA 2HS3A 2PMPA 5HY0A 5HP7A 2PHNA 3P0ZA 1CK2A 4BVQA 3VOBA 1XV2A 3FFMA 4IIJB 3LWPC 2ZVYA 3WPWA 3HKBB 4I50A 4DRXA 3DDNA 1Q8RA 4EI9A 3TD5A 3S0YA 4WBNA 1QVGF 3CCEF 5LA6A 4NWOB 1W581 1VQLF 1UFYA 2CSLA 1U3PA 5HY4A 3L7QA 5EIBC 4WBNB 2KG4A 3F0EA 4I50B 4DRXB 1YIJF 2I6DA 3WPXA 5ITZA 3CCMF 1JD1A 1W41A 3VMFB 1TUBA 3D01A 4X1KB 3HKEB 1H48A 1W5BA 3E20B 3ZO8A 3HKCB 5KMGB 3LWOC 1RQ2A 2KGWA 3GHZA 2R751 4O4LB 5EO3A 4C8GA 1N8RH 3BYQA 4HNAA
chains in the Genus database with same CATH topology
5GANK 2VGMA 1K8AH 3NMUC 4EI7A 1YHQF 1GZ0A 1K9MH 5GIPC 1XBIA 1M90H 3HJWC 2KTUA 1KC8H 3J7AR 3NVKE 3SIUA 1T0KB 2ALEA 3D00A 1KD1H 1W40A 2CZWA 1YJNF 4BW0B 3PAFA 1Q86H 1H7MA 3CCLF 3NVIB 3NK7A 4BVTA 2LBWA 5GINC 3G71F 1YI2F 3RA5A 1X7PA 4NQ3A 3RA6A 2QA4F 3IR9A 4NUTA 1VQOF 5FJ4C 1Q81H 3OBYA 5A2QM 3N4ZA 1VQMF 4XCQA 3OBWA 1KQSF 3SIVA 3CCJF 3CCSF 3LWVC 3CC2F 1X52A 3MCAB 2KTVA 4BY9D 1ZWZA 2WALA 5IT9M 3LWRC 5HWEA 2OTLF 3JCMM 5HXUA 3CD6F 3VI6A 1VQ8F 1W3EX 1IPAA 2LBXA 4X3LA 2FC3A 5G4UC 2OTJF 1CN7A 1Q82H 3N4YA 1YITF 1SDSA 1RLGA 3G6EF 1VQ4F 1X7OA 3NK6A 4EI8A 1YJ9F 3PLAC 3CPQA 1K73H 2QEXF 3CC7F 1W42A 3OW2F 3O85A 2VGNA 2F9ZC 1VQPF 1VQNF 3LWQC 1VQ9F 3V3TA 1YJWF 3CC4F 3CXCF 2OZBA 1RA4A 2HVYD 5HY0A 2FGYA 1GO1A 1CK2A 3V7EA 5GIOC 5DCVA 1PXWA 1GO0A 4BVQA 3CCQF 2OHWA 3FFMA 4TZZA 2AIFA 3LWPC 3ON1A 1VQ5F 1VQ6F 2QI2A 1VQKF 3V7QA 1W2BF 2GLZA 3G4SF 4EI9A 4X3MA 5GAPK 1QVGF 5FLXM 2BO1A 3CCEF 4BVSA 3J80M 1S72F 1QVFF 3CPWF 3I55F 1VQLF 2JNBA 3AGKA 5HY4A 1DT9A 1VQ7F 3CCRF 2KG4A 3CG6A 5EWRA 3JAMM 3CMEF 1YIJF 1NMUB 3GYQA 2I6DA 3J81M 1W41A 3VMFB 3I56F 3CCMF 5G4VC 3CCVF 4C4WC 4LCKA 3E20B 3CCUF 4BVRA 3LWOC 1NJIH 3WXMB 5HY2A 5HXZA 1JJ2F 1M1KH 1E7KA 5EO3A 3HAXD 1Q7YH 3CMAF 5HY1A 3LFOA 3E1YA 1N8RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN K;  2VGM A;  1K8A H;  3NMU C;  1YHQ F;  1GZ0 A;  1K9M H;  5GIP C;  1XBI A;  1M90 H;  3HJW C;  2KTU A;  1KC8 H;  3J7A R;  3NVK E;  3SIU A;  1T0K B;  2ALE A;  1KD1 H;  1W40 A;  2CZW A;  1YJN F;  4BW0 B;  3PAF A;  1Q86 H;  1H7M A;  3CCL F;  3NVI B;  3NK7 A;  2LBW A;  5GIN C;  3G71 F;  1YI2 F;  3RA5 A;  1X7P A;  3RA6 A;  2QA4 F;  3IR9 A;  4NUT A;  1VQO F;  5FJ4 C;  1Q81 H;  3OBY A;  5A2Q M;  3N4Z A;  1VQM F;  3OBW A;  1KQS F;  3SIV A;  3CCJ F;  3CCS F;  3LWV C;  3CC2 F;  1X52 A;  3MCA B;  2KTV A;  4BY9 D;  1ZWZ A;  2WAL A;  5IT9 M;  3LWR C;  2OTL F;  3JCM M;  3CD6 F;  3VI6 A;  1VQ8 F;  1W3E X;  1IPA A;  2LBX A;  4X3L A;  2FC3 A;  5G4U C;  2OTJ F;  1CN7 A;  1Q82 H;  3N4Y A;  1YIT F;  1SDS A;  1RLG A;  3G6E F;  1VQ4 F;  1X7O A;  3NK6 A;  1YJ9 F;  3PLA C;  3CPQ A;  1K73 H;  2QEX F;  3CC7 F;  1W42 A;  3OW2 F;  3O85 A;  2VGN A;  1VQP F;  1VQN F;  3LWQ C;  1VQ9 F;  1YJW F;  3CC4 F;  3CXC F;  2OZB A;  1RA4 A;  2HVY D;  1GO1 A;  1CK2 A;  3V7E A;  5GIO C;  5DCV A;  1PXW A;  1GO0 A;  3CCQ F;  2OHW A;  3FFM A;  4TZZ A;  2AIF A;  3LWP C;  3ON1 A;  1VQ5 F;  1VQ6 F;  2QI2 A;  1VQK F;  3V7Q A;  1W2B F;  3G4S F;  5GAP K;  4X3M A;  1QVG F;  5FLX M;  2BO1 A;  3CCE F;  1QVF F;  3J80 M;  1S72 F;  3CPW F;  3I55 F;  1VQL F;  2JNB A;  3AGK A;  1DT9 A;  1VQ7 F;  3CCR F;  2KG4 A;  3CG6 A;  5EWR A;  3JAM M;  3CME F;  1YIJ F;  1NMU B;  3GYQ A;  2I6D A;  3J81 M;  1W41 A;  3VMF B;  3I56 F;  3CCM F;  5G4V C;  3CCV F;  4C4W C;  4LCK A;  3E20 B;  3CCU F;  3LWO C;  1NJI H;  3WXM B;  1JJ2 F;  1M1K H;  1E7K A;  5EO3 A;  3HAX D;  1Q7Y H;  3CMA F;  3LFO A;  3E1Y A;  1N8R H; 
#chains in the Genus database with same CATH topology
 2CVL A;  2GVI A;  4EB6 A;  1YHQ F;  1GZ0 A;  1K9M H;  5J2U B;  1VHA A;  2KTU A;  1U43 A;  3E22 A;  4C82 A;  1W40 A;  4KWE A;  3S06 A;  3PAF A;  2VAW A;  3NVI B;  2OTM A;  3NK7 A;  3F0D A;  4X1Y A;  3MCQ A;  4G88 A;  2HX0 A;  1YI2 F;  5IJ9 A;  2QA4 F;  4ERH A;  4ZHV A;  3VTI C;  2HS0 A;  3Q8H A;  2UYN A;  1IV1 A;  3KHN A;  4BT7 A;  3RYI B;  1VQM F;  4XCQ A;  5BMV A;  1KQS F;  1JN1 A;  3IKE A;  4G4W A;  3CC2 F;  4FFB A;  1JFF A;  2HP0 B;  1ZWZ A;  5EYP B;  1SA0 B;  5LP6 B;  5JH7 A;  2HRY A;  5LYJ B;  2UYN B;  1W3E X;  1QAH A;  3ESJ A;  3WGK A;  3WGM A;  1CN7 A;  1Q82 H;  1YIT F;  1RLG A;  3G6E F;  5LYJ A;  3M1X A;  5LP6 A;  1SA0 A;  3HWU A;  1X25 A;  4E6E A;  2W8B C;  3B6N A;  2Z1E A;  4X20 B;  3OW2 F;  2VAM A;  4O2B A;  5FNV A;  3R0P A;  5BMV B;  3V3T A;  4U3J A;  3CC4 F;  2R6R 1;  1TVK B;  3WGJ A;  2YYE A;  1QU9 A;  3N2K B;  3DC2 A;  5IJ9 B;  5KMG A;  2IQQ A;  4ZHQ A;  3D54 A;  5DCV A;  4X1Y B;  3HKE A;  3CCQ F;  2K1S A;  2B33 A;  2AIF A;  5ITZ B;  1VQ5 F;  3M4S A;  2QI2 A;  2UYP A;  3G4S F;  4X3M A;  1GX1 A;  3WGL A;  5FLX M;  2BO1 A;  3J80 M;  3CPW F;  2RHJ A;  4EB6 B;  2HQS C;  2RB9 A;  1FFX B;  3V4D A;  3CCR F;  4X1I B;  2UYJ A;  3HKB A;  5EWR A;  2AIZ P;  3CME F;  1NMU B;  3ZOP A;  3K12 A;  3J81 M;  3HKC A;  3I56 F;  4C4W C;  2BTO A;  5G4V C;  3ELC A;  4X1K A;  5HP8 A;  3CCU F;  3CYP B;  3WXM B;  5HY2 A;  5HXZ A;  3VCZ A;  1M1K H;  3JAS B;  4F6R B;  3S0W A;  3CMA F;  3LFO A;  3E1Y A;  1VK3 A;  2BTU A;  5GAN K;  3F6M A;  5LA6 B;  3HJW C;  2GZL A;  1XBI A;  2LCA A;  2QTP A;  3HKD A;  1T0K B;  2ALE A;  1W5F A;  5JQG B;  1KNJ A;  4BW0 B;  2RHO A;  4IIJ A;  1Q86 H;  3RYH B;  5GIN C;  3WJR A;  4B46 A;  1OFU A;  3N2K A;  4O4H A;  4YJ3 A;  4NQ3 A;  3C9R A;  4NUT A;  1VQO F;  1TVK A;  2N48 A;  1Q81 H;  5A2Q M;  5CA1 B;  4U3J B;  3JAK B;  3JAW B;  3T80 A;  5JCO C;  3SIV A;  3CCJ F;  3CCS F;  4O2B B;  4BT5 A;  3VYS C;  1RQ7 A;  3LWV C;  4X20 A;  3ZP7 A;  3VYT C;  3IEW A;  2L26 A;  5C8Y B;  5IT9 M;  4ZHY B;  3WJQ A;  4ZOL B;  4BT6 A;  1VQ8 F;  4ZI7 B;  1IPA A;  2LBX A;  2OTJ F;  5MN5 A;  3KE1 A;  5LOV A;  1YJ9 F;  4EI8 A;  4TV9 B;  4I4T A;  1FSZ A;  5EAZ A;  3CC7 F;  2HP0 A;  2ZOD A;  1W42 A;  3VOA A;  3O85 A;  2VGN A;  5JVD A;  5J2T A;  3JAR B;  1VQ9 F;  2LBT A;  3RYF B;  2ZF8 A;  2BTQ B;  2FGY A;  2VAP A;  3IKF A;  5GIO C;  3P10 A;  1QD9 A;  3VYU C;  4BT3 A;  1W59 A;  4O4J B;  1W5A A;  2OHW A;  3S02 A;  3FD5 A;  3ON1 A;  5MN6 A;  1VQ6 F;  3I3F A;  4I55 B;  2GLZ A;  3LYB A;  5JCO A;  5GAP K;  1XHO A;  2Z1F A;  4TV8 B;  4C8I A;  5J2U A;  4BVS A;  3F0G A;  1FNK A;  3LDT A;  3AGK A;  4O4L A;  1IV4 A;  4C81 A;  2I6R A;  3CG6 A;  3KIZ A;  3CCV F;  4C8E A;  3K14 A;  4IHJ A;  4O2A B;  4BT4 A;  4LCK A;  5EB1 B;  1TUB B;  2RHH A;  2H8E A;  4DXD A;  3IMP A;  2V9Y A;  4BVR A;  1NJI H;  2DYY A;  4YJ2 B;  1E7K A;  3MDO A;  1Q7Y H;  3QTY A;  5B8F A;  5HY1 A;  5CB4 B;  3NMU C;  2YXZ A;  4EI7 A;  1M90 H;  1ODE A;  2EWC A;  5GIP C;  1Z5W A;  3UT5 B;  1KC8 H;  1NQ3 A;  2Z1T A;  3D00 A;  1KD1 H;  2CZW A;  1YJN F;  4RQO A;  3RYC B;  4I4T B;  1H7M A;  3CCL F;  4BVT A;  2LBW A;  5LOV B;  3G71 F;  3S0H A;  4TUY B;  1IV3 A;  3RA5 A;  1X7P A;  1IV2 A;  5EB0 A;  3IR9 A;  3C8L A;  5FJ4 C;  2NMU A;  2UZH A;  4LNU A;  3P4E A;  2Q1Y A;  3OBY A;  5KX5 B;  4ZOL A;  3C9U A;  3N2G B;  1U3L A;  3N4Z A;  2UYK A;  3OBW A;  3CYQ A;  2DT4 A;  4R40 B;  5C8Y A;  5IJ0 B;  2Z01 A;  1X52 A;  4B45 A;  3MCA B;  1Z5V A;  2KTV A;  4BY9 D;  1DBF A;  3K0T A;  4M8I A;  3JAW A;  3JCM M;  5HXU A;  3CD6 F;  3N2G A;  3VI6 A;  5CA1 A;  3F0F A;  3JAL A;  2FC3 A;  1OAP A;  3JAL B;  3N4Y A;  4TUY A;  1VQ4 F;  2ZVZ A;  1X7O A;  3RYH A;  3NK6 A;  5EZY B;  3WJP A;  3RYC A;  3CPQ A;  1K73 H;  5JQG A;  2QEX F;  3K2X A;  3U0O A;  1H47 A;  2MQE A;  3JVH A;  3HKD B;  2CHS A;  3UT5 A;  2F9Z C;  2HRU A;  1VQP F;  1VQN F;  3LWQ C;  4O4I B;  5CB4 A;  3FPI A;  3ZP4 A;  5KX5 A;  3CXC F;  1UI9 A;  3JAS A;  4G4Y A;  2HVY D;  1W57 A;  1T0A A;  1GO1 A;  3V7E A;  2P6Y A;  1PXW A;  1GO0 A;  4O2A A;  1R1M A;  4IHJ B;  1COM A;  5IYZ B;  4TZZ A;  3VO8 A;  1VQK F;  4U39 A;  3V7Q A;  1W2B F;  4G4V A;  4X1I A;  2RHL A;  1FFX A;  3HTN A;  1W5E A;  5LP6 C;  3WGN A;  1QVF F;  1S72 F;  2IAF A;  3I55 F;  5GON A;  2JNB A;  5MN4 A;  1DT9 A;  1VQ7 F;  5CA0 B;  1PF5 A;  2HS4 A;  3JAT A;  1ONI A;  4TV8 A;  4YJ2 A;  3JAM M;  3TD4 A;  2CW4 A;  3GYQ A;  5LXT A;  2VXY A;  3EOR A;  4G4X A;  5LXT B;  4ZHQ B;  3FBA A;  1JJ2 F;  3MBM A;  5EIB D;  3RYF A;  3JAT B;  3OON A;  2AMT A;  5CA0 A;  3HAX D;  1CLI A;  3JAR A;  1K8A H;  2VGM A;  3C9S A;  5GON B;  5FNV B;  1KNK A;  3SIU A;  3J7A R;  3NVK E;  3VIU A;  4I55 A;  3ERN A;  5IYZ A;  3LME A;  4O4J A;  3S03 A;  4B5C A;  2H6L A;  2H8C A;  3RA6 A;  1U40 A;  1RLU A;  3RE3 A;  4ZI7 A;  4PWT A;  1VQV A;  5JH7 B;  4O4I A;  5AVM A;  1SZQ A;  5JVD B;  5EYP A;  3TD3 A;  5J2T B;  1JFF B;  3I7T A;  4FFB B;  4BT2 A;  3MQW A;  2WAL A;  2CWJ A;  1YGY A;  3JAK A;  4TV9 A;  5HWE A;  3RYI A;  3LWR C;  5EZY A;  2OTL F;  3CB2 A;  2IG8 A;  4G4Z A;  4X3L A;  1XRG A;  2Q1X A;  4RHA A;  5G4U C;  1JY8 A;  4O4H B;  4YJ3 B;  4ZK7 A;  2ZAU A;  1SDS A;  2ZOV A;  1W55 A;  3FD6 A;  3PLA C;  2CHT A;  3C9T A;  3KJJ A;  1J7H A;  3KJK A;  3M84 A;  4B62 A;  2Z1U A;  3E22 B;  3GTZ A;  5IJ0 A;  3QUW A;  4ZHW A;  3QHD A;  1FNJ A;  4HNA B;  2G9I A;  3IEQ A;  1VH8 A;  1YQN A;  1YJW F;  2HP3 A;  4LNU B;  2OZB A;  1RA4 A;  4F6R A;  2HS3 A;  2PMP A;  5HY0 A;  5HP7 A;  2PHN A;  3P0Z A;  1CK2 A;  4BVQ A;  3VOB A;  1XV2 A;  3FFM A;  4IIJ B;  3LWP C;  2ZVY A;  3WPW A;  3HKB B;  4I50 A;  4DRX A;  3DDN A;  1Q8R A;  4EI9 A;  3TD5 A;  3S0Y A;  4WBN A;  1QVG F;  3CCE F;  5LA6 A;  4NWO B;  1W58 1;  1VQL F;  1UFY A;  2CSL A;  1U3P A;  5HY4 A;  3L7Q A;  5EIB C;  4WBN B;  2KG4 A;  3F0E A;  4I50 B;  4DRX B;  1YIJ F;  2I6D A;  3WPX A;  5ITZ A;  3CCM F;  1JD1 A;  1W41 A;  3VMF B;  1TUB A;  3D01 A;  4X1K B;  3HKE B;  1H48 A;  1W5B A;  3E20 B;  3ZO8 A;  3HKC B;  5KMG B;  3LWO C;  1RQ2 A;  2KGW A;  3GHZ A;  2R75 1;  4O4L B;  5EO3 A;  4C8G A;  1N8R H;  3BYQ A;  4HNA A; 
#chains in the Genus database with same CATH homology
 5GAN K;  2VGM A;  1K8A H;  3NMU C;  4EI7 A;  1YHQ F;  1GZ0 A;  1K9M H;  5GIP C;  1XBI A;  1M90 H;  3HJW C;  2KTU A;  1KC8 H;  3J7A R;  3NVK E;  3SIU A;  1T0K B;  2ALE A;  3D00 A;  1KD1 H;  1W40 A;  2CZW A;  1YJN F;  4BW0 B;  3PAF A;  1Q86 H;  1H7M A;  3CCL F;  3NVI B;  3NK7 A;  4BVT A;  2LBW A;  5GIN C;  3G71 F;  1YI2 F;  3RA5 A;  1X7P A;  4NQ3 A;  3RA6 A;  2QA4 F;  3IR9 A;  4NUT A;  1VQO F;  5FJ4 C;  1Q81 H;  3OBY A;  5A2Q M;  3N4Z A;  1VQM F;  4XCQ A;  3OBW A;  1KQS F;  3SIV A;  3CCJ F;  3CCS F;  3LWV C;  3CC2 F;  1X52 A;  3MCA B;  2KTV A;  4BY9 D;  1ZWZ A;  2WAL A;  5IT9 M;  3LWR C;  5HWE A;  2OTL F;  3JCM M;  5HXU A;  3CD6 F;  3VI6 A;  1VQ8 F;  1W3E X;  1IPA A;  2LBX A;  4X3L A;  2FC3 A;  5G4U C;  2OTJ F;  1CN7 A;  1Q82 H;  3N4Y A;  1YIT F;  1SDS A;  1RLG A;  3G6E F;  1VQ4 F;  1X7O A;  3NK6 A;  4EI8 A;  1YJ9 F;  3PLA C;  3CPQ A;  1K73 H;  2QEX F;  3CC7 F;  1W42 A;  3OW2 F;  3O85 A;  2VGN A;  2F9Z C;  1VQP F;  1VQN F;  3LWQ C;  1VQ9 F;  3V3T A;  1YJW F;  3CC4 F;  3CXC F;  2OZB A;  1RA4 A;  2HVY D;  5HY0 A;  2FGY A;  1GO1 A;  1CK2 A;  3V7E A;  5GIO C;  5DCV A;  1PXW A;  1GO0 A;  4BVQ A;  3CCQ F;  2OHW A;  3FFM A;  4TZZ A;  2AIF A;  3LWP C;  3ON1 A;  1VQ5 F;  1VQ6 F;  2QI2 A;  1VQK F;  3V7Q A;  1W2B F;  2GLZ A;  3G4S F;  4EI9 A;  4X3M A;  5GAP K;  1QVG F;  5FLX M;  2BO1 A;  3CCE F;  4BVS A;  3J80 M;  1S72 F;  1QVF F;  3CPW F;  3I55 F;  1VQL F;  2JNB A;  3AGK A;  5HY4 A;  1DT9 A;  1VQ7 F;  3CCR F;  2KG4 A;  3CG6 A;  5EWR A;  3JAM M;  3CME F;  1YIJ F;  1NMU B;  3GYQ A;  2I6D A;  3J81 M;  1W41 A;  3VMF B;  3I56 F;  3CCM F;  5G4V C;  3CCV F;  4C4W C;  4LCK A;  3E20 B;  3CCU F;  4BVR A;  3LWO C;  1NJI H;  3WXM B;  5HY2 A;  5HXZ A;  1JJ2 F;  1M1K H;  1E7K A;  5EO3 A;  3HAX D;  1Q7Y H;  3CMA F;  5HY1 A;  3LFO A;  3E1Y A;  1N8R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...