3L7QA

Crystal structure of aldr from streptococcus mutans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
KKIHTDKAPAAIGPYVQGKIVGNLLFASGQVPLSPETGQVIGTTIEEQTQQVLKNISAILTEAGTDFDHVVKTTCFLSDIDDFVPFNEVYATAFKSDFPARSAVEVARLPKDVKIEIEVIAELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Putative translation initiation inhibitor, aldR regulator-li
publication title Crystal structure of AldR from streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 36
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3l7qA00
3ZOPA 3LMEA 2CW4A 1FNJA 2UYPA 3KJKA 3QUWA 3KJJA 1COMA 3GTZA 4NWOB 3R0PA 2CHTA 1J7HA 2UYKA 1XRGA 2UYNB 4ZK7A 1NQ3A 3M4SA 3I3FA 2OTMA 1QD9A 3LYBA 3M1XA 3ZP4A 2CVLA 1XHOA 2IG8A 3K12A 1DBFA 1FNKA 1UFYA 2UYNA 1JD1A 3D01A 3L7QA 1ONIA 3V4DA 3MQWA 3VCZA 1PF5A 3ZP7A 5HP7A 2CSLA 1ODEA 2EWCA 5HP8A 2DYYA 1QU9A 3I7TA 3K0TA 1QAHA 1UI9A 2B33A 2CWJA 2UYJA 3ZO8A 2CHSA 1X25A
chains in the Genus database with same CATH superfamily
1W5AA 2CW4A 3MBMA 4U3JB 4G4YA 5EO3A 1COMA 4YJ2A 3LWVC 2UYNB 1IV3A 4X1IB 3CXCF 1NQ3A 1W581 2LBXA 2ZF8A 2OTMA 1YGYA 5J2UA 1RQ7A 1VQ7F 2KTUA 4X3LA 4ERHA 1ONIA 3VCZA 4ZHVA 3VOBA 1S72F 5IJ0A 4WBNB 1ODEA 2EWCA 2R751 2QI2A 3RA6A 4ZI7B 4BVQA 5HY2A 3S0WA 3LWOC 5B8FA 5EZYB 3TD4A 2AIZP 3HKBB 4O4JA 2ZVYA 2OHWA 5KMGA 3FD5A 4TUYA 3CC2F 2H6LA 2ZODA 1IPAA 5JH7B 4I55A 3WGMA 2HX0A 4BT4A 3D01A 3L7QA 3WPXA 3G71F 1K73H 4C81A 1GO1A 3JARA 3WGNA 2I6RA 3HKEB 4O2BB 2ZOVA 2JNBA 4LCKA 5GIOC 5EWRA 3HKCB 5EB1B 3OW2F 5LXTB 1YI2F 1UI9A 4BVTA 2Z01A 5JQGA 3RE3A 1FFXA 5DCVA 5LA6A 2VXYA 5CA1A 5GAPK 5JCOC 4TV8B 3F0FA 3JALB 5KX5A 1KQSF 4X1KA 3J81M 3E22B 4I50B 3WGJA 1CLIA 3K2XA 1U43A 3PAFA 3V3TA 3C9SA 2QTPA 3IEWA 2RHLA 1T0AA 3G6EF 2ZVZA 2MQEA 4X1YA 4DRXA 1XHOA 3CCJF 1W5EA 2YYEA 4XCQA 4BT2A 1KNJA 3GHZA 5J2UB 3CMAF 3UT5A 4B45A 2RHJA 5FNVA 4ZI7A 2NMUA 4C8IA 2ZAUA 5IJ0B 3VO8A 5EZYA 1X7PA 4F6RB 2LBWA 4BVSA 4DXDA 2HRUA 1K8AH 3HKBA 2HP0B 1YJWF 2HP3A 1VHAA 2OZBA 1W55A 1YHQF 1H47A 4G4WA 1XBIA 3JAKB 3KE1A 2UZHA 3P4EA 5C8YA 1VQNF 5LYJA 4TUYB 4G4ZA 3I55F 3FBAA 1K9MH 4B5CA 3NVIB 1RA4A 2K1SA 1Q7YH 4I55B 2VAPA 2CHTA 1QVFF 3EORA 3MDOA 1W57A 2Z1EA 3WXMB 1U40A 4O4LA 3CCVF 3NMUC 4LNUA 1VH8A 3V7EA 2W8BC 3HAXD 3IEQA 3MCQA 3VYUC 3HWUA 2HQSC 4BT5A 3B6NA 3V7QA 2GZLA 4G4XA 3CC7F 5HXUA 5JQGB 5LP6A 4TV8A 4EI8A 1X52A 1FFXB 1R1MA 4U39A 5CA1B 1W59A 2VGNA 1VQKF 3E22A 5ITZA 5LOVB 5JCOA 4I50A 3RA5A 5GANK 5AVMA 1QVGF 1RQ2A 2H8CA 5KX5B 1TUBA 4X1KB 3GTZA 3JAWA 1JY8A 1N8RH 3CCQF 3LWRC 3LDTA 3S03A 1ZWZA 3N2KA 1H7MA 2IG8A 3CPWF 2IQQA 4X1YB 3HKDA 4DRXB 1W3EX 2YXZA 4F6RA 3UT5B 5FNVB 3G4SF 1QU9A 5IT9M 2HP0A 2PHNA 2UYJA 3GYQA 3VOAA 2BO1A 4IIJB 4FFBB 3Q8HA 4RHAA 3QUWA 5HY4A 3S02A 1KNKA 3JAKA 1J7HA 3NK7A 3OBWA 1SZQA 3CYQA 3C9TA 5G4VC 5G4UC 1JJ2F 2LBTA 3U0OA 1H48A 1M90H 3OBYA 2AIFA 5C8YB 5LYJB 1JD1A 1VQ8F 1VQ5F 5FJ4C 3CCSF 3CCMF 3TD5A 1RLUA 1YJ9F 1PXWA 2CWJA 3J80M 3F0GA 2V9YA 4O4LB 2CHSA 5BMVA 3C8LA 4IHJA 2KGWA 4LNUB 2RHOA 4BT6A 4PWTA 3S0HA 2HS0A 2HRYA 5LOVA 3CCRF 5LP6B 3CG6A 5J2TA 1GZ0A 5GONA 2BTUA 3P0ZA 5ITZB 4EB6B 1VQ9F 1FSZA 3AGKA 3F6MA 3C9UA 3VTIC 3WJQA 5HP7A 3WJRA 3I56F 1TUBB 3JAWB 2H8EA 3M84A 1W42A 1W5BA 3K0TA 4C4WC 4M8IA 1IV4A 4C8GA 3ZOPA 3N2KB 1FNJA 2DT4A 3KJKA 4O4HA 3IMPA 1Q8RA 3HTNA 2UYKA 3HKDB 4ZK7A 1YITF 2PMPA 2Z1FA 4IIJA 4FFBA 2N48A 5GIPC 4X20B 3SIVA 1FNKA 4ZHWA 1U3PA 3CMEF 3HJWC 2G9IA 1E7KA 4BVRA 1YIJF 1W41A 3IR9A 1XV2A 1X7OA 3RYCA 4O2AB 2GVIA 4O4IB 2AMTA 3LMEA 3KHNA 4C8EA 1XRGA 3T80A 5EIBD 4YJ3B 3NVKE 1VQVA 5EAZA 3VI6A 1YJNF 1TVKA 1JFFA 2KG4A 5MN5A 3D54A 3V4DA 3FPIA 3JVHA 2Z1TA 5BMVB 3RYHA 4IHJB 3WPWA 3VYTC 3FFMA 5CA0A 5HP8A 3I7TA 2Z1UA 4RQOA 1W2BF 3ELCA 4EB6A 1RLGA 3ESJA 5J2TB 2UYPA 5GONB 3OONA 3F0DA 3E1YA 2VAWA 4HNAA 4NQ3A 5JVDB 3S06A 1VQOF 3WJPA 2HVYD 2HS4A 3LYBA 3M1XA 2CVLA 2RHHA 5HY1A 4R40B 1UFYA 4B46A 4I4TA 3PLAC 3C9RA 4O4HB 3ERNA 3JASB 1Z5VA 4X20A 2Q1YA 2I6DA 4ZHQA 3NK6A 2KTVA 3CC4F 5IYZA 1VQPF 2P6YA 4O2AA 3M4SA 4O4IA 1VQ6F 2BTQB 3CD6F 1VQ4F 1QD9A 1VQLF 1NJIH 3RYCB 1SA0A 3VYSC 3P10A 1Q81H 4EI7A 5A2QM 3RYIA 4YJ3A 2VAMA 1GX1A 3WGKA 3MCAB 2QA4F 2B33A 4C82A 3VMFB 1YQNA 1TVKB 2F9ZC 3BYQA 1JFFB 3N4YA 3CCLF 2CZWA 4E6EA 5IJ9B 3RYHB 4ZOLB 3RYFA 1GO0A 1T0KB 5CA0B 5CB4B 2OTLF 2ALEA 1IV1A 3MQWA 3JATA 3D00A 5JVDA 2Q1XA 3S0YA 4B62A 3JAMM 2LCAA 3CCUF 3LWQC 1W5FA 2L26A 3LWPC 4HNAB 1QAHA 4BT7A 2HS3A 1CK2A 5LP6C 3K14A 4BT3A 3O85A 1CN7A 3CB2A 4TV9A 3R0PA 1DT9A 3JASA 4KWEA 3QHDA 4G4VA 4I4TB 5MN6A 1KC8H 3N2GA 5EYPB 3I3FA 3WGLA 1Z5WA 5HWEA 1Q86H 1W40A 4U3JA 1NMUB 1OAPA 1DBFA 2UYNA 2FC3A 4X1IA 5EIBC 3J7AR 4ZHQB 2RB9A 1M1KH 4YJ2B 2IAFA 3DC2A 5IYZB 3CCEF 5GINC 1JN1A 3DDNA 3ZO8A 1X25A 4WBNA 4NWOB 1SA0B 2BTOA 3RYIB 3KIZA 5HXZA 3CPQA 3E20B 1U3LA 1IV2A 4ZHYB 3ON1A 2R6R1 1KD1H 5HY0A 4G88A 3F0EA 5IJ9A 3TD3A 3IKEA 4O4JB 2CSLA 5JH7A 4NUTA 4ZOLA 5KMGB 1Q82H 3IKFA 5CB4A 1VQMF 3HKEA 4O2BA 3RYFB 3VIUA 3SIUA 2FGYA 3HKCA 3KJJA 3N4ZA 2VGMA 3JARB 2GLZA 5LXTA 1SDSA 1VK3A 3JATB 4TZZA 2QEXF 3ZP4A 3JCMM 5FLXM 3K12A 5EB0A 4BW0B 3CYPB 2WALA 4EI9A 3LFOA 1PF5A 4BY9D 5EYPA 4X3MA 3JALA 3ZP7A 1OFUA 3QTYA 5LA6B 4TV9B 2DYYA 5MN4A 3FD6A 2OTJF 3N2GB
chains in the Genus database with same CATH topology
3ZOPA 3LMEA 2CW4A 1FNJA 2UYPA 3KJKA 3QUWA 3KJJA 1COMA 3GTZA 4NWOB 3R0PA 2CHTA 1J7HA 2UYKA 1XRGA 2UYNB 4ZK7A 1NQ3A 3M4SA 3I3FA 2OTMA 1QD9A 3LYBA 3M1XA 3ZP4A 2CVLA 1XHOA 2IG8A 3K12A 1DBFA 1FNKA 1UFYA 2UYNA 1JD1A 3D01A 3L7QA 1ONIA 3V4DA 3MQWA 3VCZA 1PF5A 3ZP7A 5HP7A 2CSLA 1ODEA 2EWCA 5HP8A 2DYYA 1QU9A 3I7TA 3K0TA 1QAHA 1UI9A 2B33A 2CWJA 2UYJA 3ZO8A 2CHSA 1X25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOP A;  3LME A;  2CW4 A;  1FNJ A;  2UYP A;  3KJK A;  3QUW A;  3KJJ A;  1COM A;  3GTZ A;  4NWO B;  3R0P A;  2CHT A;  1J7H A;  2UYK A;  1XRG A;  2UYN B;  4ZK7 A;  1NQ3 A;  3M4S A;  3I3F A;  2OTM A;  1QD9 A;  3LYB A;  3M1X A;  3ZP4 A;  2CVL A;  1XHO A;  2IG8 A;  3K12 A;  1DBF A;  1FNK A;  1UFY A;  2UYN A;  1JD1 A;  3D01 A;  3L7Q A;  1ONI A;  3V4D A;  3MQW A;  3VCZ A;  1PF5 A;  3ZP7 A;  5HP7 A;  2CSL A;  1ODE A;  2EWC A;  5HP8 A;  2DYY A;  1QU9 A;  3I7T A;  3K0T A;  1QAH A;  1UI9 A;  2B33 A;  2CWJ A;  2UYJ A;  3ZO8 A;  2CHS A;  1X25 A; 
#chains in the Genus database with same CATH topology
 1W5A A;  2CW4 A;  3MBM A;  4U3J B;  4G4Y A;  5EO3 A;  1COM A;  4YJ2 A;  3LWV C;  2UYN B;  1IV3 A;  4X1I B;  3CXC F;  1NQ3 A;  1W58 1;  2LBX A;  2ZF8 A;  2OTM A;  1YGY A;  5J2U A;  1RQ7 A;  1VQ7 F;  2KTU A;  4X3L A;  4ERH A;  1ONI A;  3VCZ A;  4ZHV A;  3VOB A;  1S72 F;  5IJ0 A;  4WBN B;  1ODE A;  2EWC A;  2R75 1;  2QI2 A;  3RA6 A;  4ZI7 B;  4BVQ A;  5HY2 A;  3S0W A;  3LWO C;  5B8F A;  5EZY B;  3TD4 A;  2AIZ P;  3HKB B;  4O4J A;  2ZVY A;  2OHW A;  5KMG A;  3FD5 A;  4TUY A;  3CC2 F;  2H6L A;  2ZOD A;  1IPA A;  5JH7 B;  4I55 A;  3WGM A;  2HX0 A;  4BT4 A;  3D01 A;  3L7Q A;  3WPX A;  3G71 F;  1K73 H;  4C81 A;  1GO1 A;  3JAR A;  3WGN A;  2I6R A;  3HKE B;  4O2B B;  2ZOV A;  2JNB A;  4LCK A;  5GIO C;  5EWR A;  3HKC B;  5EB1 B;  3OW2 F;  5LXT B;  1YI2 F;  1UI9 A;  4BVT A;  2Z01 A;  5JQG A;  3RE3 A;  1FFX A;  5DCV A;  5LA6 A;  2VXY A;  5CA1 A;  5GAP K;  5JCO C;  4TV8 B;  3F0F A;  3JAL B;  5KX5 A;  1KQS F;  4X1K A;  3J81 M;  3E22 B;  4I50 B;  3WGJ A;  1CLI A;  3K2X A;  1U43 A;  3PAF A;  3V3T A;  3C9S A;  2QTP A;  3IEW A;  2RHL A;  1T0A A;  3G6E F;  2ZVZ A;  2MQE A;  4X1Y A;  4DRX A;  1XHO A;  3CCJ F;  1W5E A;  2YYE A;  4XCQ A;  4BT2 A;  1KNJ A;  3GHZ A;  5J2U B;  3CMA F;  3UT5 A;  4B45 A;  2RHJ A;  5FNV A;  4ZI7 A;  2NMU A;  4C8I A;  2ZAU A;  5IJ0 B;  3VO8 A;  5EZY A;  1X7P A;  4F6R B;  2LBW A;  4BVS A;  4DXD A;  2HRU A;  1K8A H;  3HKB A;  2HP0 B;  1YJW F;  2HP3 A;  1VHA A;  2OZB A;  1W55 A;  1YHQ F;  1H47 A;  4G4W A;  1XBI A;  3JAK B;  3KE1 A;  2UZH A;  3P4E A;  5C8Y A;  1VQN F;  5LYJ A;  4TUY B;  4G4Z A;  3I55 F;  3FBA A;  1K9M H;  4B5C A;  3NVI B;  1RA4 A;  2K1S A;  1Q7Y H;  4I55 B;  2VAP A;  2CHT A;  1QVF F;  3EOR A;  3MDO A;  1W57 A;  2Z1E A;  3WXM B;  1U40 A;  4O4L A;  3CCV F;  3NMU C;  4LNU A;  1VH8 A;  3V7E A;  2W8B C;  3HAX D;  3IEQ A;  3MCQ A;  3VYU C;  3HWU A;  2HQS C;  4BT5 A;  3B6N A;  3V7Q A;  2GZL A;  4G4X A;  3CC7 F;  5HXU A;  5JQG B;  5LP6 A;  4TV8 A;  4EI8 A;  1X52 A;  1FFX B;  1R1M A;  4U39 A;  5CA1 B;  1W59 A;  2VGN A;  1VQK F;  3E22 A;  5ITZ A;  5LOV B;  5JCO A;  4I50 A;  3RA5 A;  5GAN K;  5AVM A;  1QVG F;  1RQ2 A;  2H8C A;  5KX5 B;  1TUB A;  4X1K B;  3GTZ A;  3JAW A;  1JY8 A;  1N8R H;  3CCQ F;  3LWR C;  3LDT A;  3S03 A;  1ZWZ A;  3N2K A;  1H7M A;  2IG8 A;  3CPW F;  2IQQ A;  4X1Y B;  3HKD A;  4DRX B;  1W3E X;  2YXZ A;  4F6R A;  3UT5 B;  5FNV B;  3G4S F;  1QU9 A;  5IT9 M;  2HP0 A;  2PHN A;  2UYJ A;  3GYQ A;  3VOA A;  2BO1 A;  4IIJ B;  4FFB B;  3Q8H A;  4RHA A;  3QUW A;  5HY4 A;  3S02 A;  1KNK A;  3JAK A;  1J7H A;  3NK7 A;  3OBW A;  1SZQ A;  3CYQ A;  3C9T A;  5G4V C;  5G4U C;  1JJ2 F;  2LBT A;  3U0O A;  1H48 A;  1M90 H;  3OBY A;  2AIF A;  5C8Y B;  5LYJ B;  1JD1 A;  1VQ8 F;  1VQ5 F;  5FJ4 C;  3CCS F;  3CCM F;  3TD5 A;  1RLU A;  1YJ9 F;  1PXW A;  2CWJ A;  3J80 M;  3F0G A;  2V9Y A;  4O4L B;  2CHS A;  5BMV A;  3C8L A;  4IHJ A;  2KGW A;  4LNU B;  2RHO A;  4BT6 A;  4PWT A;  3S0H A;  2HS0 A;  2HRY A;  5LOV A;  3CCR F;  5LP6 B;  3CG6 A;  5J2T A;  1GZ0 A;  5GON A;  2BTU A;  3P0Z A;  5ITZ B;  4EB6 B;  1VQ9 F;  1FSZ A;  3AGK A;  3F6M A;  3C9U A;  3VTI C;  3WJQ A;  5HP7 A;  3WJR A;  3I56 F;  1TUB B;  3JAW B;  2H8E A;  3M84 A;  1W42 A;  1W5B A;  3K0T A;  4C4W C;  4M8I A;  1IV4 A;  4C8G A;  3ZOP A;  3N2K B;  1FNJ A;  2DT4 A;  3KJK A;  4O4H A;  3IMP A;  1Q8R A;  3HTN A;  2UYK A;  3HKD B;  4ZK7 A;  1YIT F;  2PMP A;  2Z1F A;  4IIJ A;  4FFB A;  2N48 A;  5GIP C;  4X20 B;  3SIV A;  1FNK A;  4ZHW A;  1U3P A;  3CME F;  3HJW C;  2G9I A;  1E7K A;  4BVR A;  1YIJ F;  1W41 A;  3IR9 A;  1XV2 A;  1X7O A;  3RYC A;  4O2A B;  2GVI A;  4O4I B;  2AMT A;  3LME A;  3KHN A;  4C8E A;  1XRG A;  3T80 A;  5EIB D;  4YJ3 B;  3NVK E;  1VQV A;  5EAZ A;  3VI6 A;  1YJN F;  1TVK A;  1JFF A;  2KG4 A;  5MN5 A;  3D54 A;  3V4D A;  3FPI A;  3JVH A;  2Z1T A;  5BMV B;  3RYH A;  4IHJ B;  3WPW A;  3VYT C;  3FFM A;  5CA0 A;  5HP8 A;  3I7T A;  2Z1U A;  4RQO A;  1W2B F;  3ELC A;  4EB6 A;  1RLG A;  3ESJ A;  5J2T B;  2UYP A;  5GON B;  3OON A;  3F0D A;  3E1Y A;  2VAW A;  4HNA A;  4NQ3 A;  5JVD B;  3S06 A;  1VQO F;  3WJP A;  2HVY D;  2HS4 A;  3LYB A;  3M1X A;  2CVL A;  2RHH A;  5HY1 A;  4R40 B;  1UFY A;  4B46 A;  4I4T A;  3PLA C;  3C9R A;  4O4H B;  3ERN A;  3JAS B;  1Z5V A;  4X20 A;  2Q1Y A;  2I6D A;  4ZHQ A;  3NK6 A;  2KTV A;  3CC4 F;  5IYZ A;  1VQP F;  2P6Y A;  4O2A A;  3M4S A;  4O4I A;  1VQ6 F;  2BTQ B;  3CD6 F;  1VQ4 F;  1QD9 A;  1VQL F;  1NJI H;  3RYC B;  1SA0 A;  3VYS C;  3P10 A;  1Q81 H;  4EI7 A;  5A2Q M;  3RYI A;  4YJ3 A;  2VAM A;  1GX1 A;  3WGK A;  3MCA B;  2QA4 F;  2B33 A;  4C82 A;  3VMF B;  1YQN A;  1TVK B;  2F9Z C;  3BYQ A;  1JFF B;  3N4Y A;  3CCL F;  2CZW A;  4E6E A;  5IJ9 B;  3RYH B;  4ZOL B;  3RYF A;  1GO0 A;  1T0K B;  5CA0 B;  5CB4 B;  2OTL F;  2ALE A;  1IV1 A;  3MQW A;  3JAT A;  3D00 A;  5JVD A;  2Q1X A;  3S0Y A;  4B62 A;  3JAM M;  2LCA A;  3CCU F;  3LWQ C;  1W5F A;  2L26 A;  3LWP C;  4HNA B;  1QAH A;  4BT7 A;  2HS3 A;  1CK2 A;  5LP6 C;  3K14 A;  4BT3 A;  3O85 A;  1CN7 A;  3CB2 A;  4TV9 A;  3R0P A;  1DT9 A;  3JAS A;  4KWE A;  3QHD A;  4G4V A;  4I4T B;  5MN6 A;  1KC8 H;  3N2G A;  5EYP B;  3I3F A;  3WGL A;  1Z5W A;  5HWE A;  1Q86 H;  1W40 A;  4U3J A;  1NMU B;  1OAP A;  1DBF A;  2UYN A;  2FC3 A;  4X1I A;  5EIB C;  3J7A R;  4ZHQ B;  2RB9 A;  1M1K H;  4YJ2 B;  2IAF A;  3DC2 A;  5IYZ B;  3CCE F;  5GIN C;  1JN1 A;  3DDN A;  3ZO8 A;  1X25 A;  4WBN A;  4NWO B;  1SA0 B;  2BTO A;  3RYI B;  3KIZ A;  5HXZ A;  3CPQ A;  3E20 B;  1U3L A;  1IV2 A;  4ZHY B;  3ON1 A;  2R6R 1;  1KD1 H;  5HY0 A;  4G88 A;  3F0E A;  5IJ9 A;  3TD3 A;  3IKE A;  4O4J B;  2CSL A;  5JH7 A;  4NUT A;  4ZOL A;  5KMG B;  1Q82 H;  3IKF A;  5CB4 A;  1VQM F;  3HKE A;  4O2B A;  3RYF B;  3VIU A;  3SIU A;  2FGY A;  3HKC A;  3KJJ A;  3N4Z A;  2VGM A;  3JAR B;  2GLZ A;  5LXT A;  1SDS A;  1VK3 A;  3JAT B;  4TZZ A;  2QEX F;  3ZP4 A;  3JCM M;  5FLX M;  3K12 A;  5EB0 A;  4BW0 B;  3CYP B;  2WAL A;  4EI9 A;  3LFO A;  1PF5 A;  4BY9 D;  5EYP A;  4X3M A;  3JAL A;  3ZP7 A;  1OFU A;  3QTY A;  5LA6 B;  4TV9 B;  2DYY A;  5MN4 A;  3FD6 A;  2OTJ F;  3N2G B; 
#chains in the Genus database with same CATH homology
 3ZOP A;  3LME A;  2CW4 A;  1FNJ A;  2UYP A;  3KJK A;  3QUW A;  3KJJ A;  1COM A;  3GTZ A;  4NWO B;  3R0P A;  2CHT A;  1J7H A;  2UYK A;  1XRG A;  2UYN B;  4ZK7 A;  1NQ3 A;  3M4S A;  3I3F A;  2OTM A;  1QD9 A;  3LYB A;  3M1X A;  3ZP4 A;  2CVL A;  1XHO A;  2IG8 A;  3K12 A;  1DBF A;  1FNK A;  1UFY A;  2UYN A;  1JD1 A;  3D01 A;  3L7Q A;  1ONI A;  3V4D A;  3MQW A;  3VCZ A;  1PF5 A;  3ZP7 A;  5HP7 A;  2CSL A;  1ODE A;  2EWC A;  5HP8 A;  2DYY A;  1QU9 A;  3I7T A;  3K0T A;  1QAH A;  1UI9 A;  2B33 A;  2CWJ A;  2UYJ A;  3ZO8 A;  2CHS A;  1X25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...