3L7QA

Crystal structure of aldr from streptococcus mutans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
KKIHTDKAPAAIGPYVQGKIVGNLLFASGQVPLSPETGQVIGTTIEEQTQQVLKNISAILTEAGTDFDHVVKTTCFLSDIDDFVPFNEVYATAFKSDFPARSAVEVARLPKDVKIEIEVIAELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AldR from streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Translation
molecule keywords Putative translation initiation inhibitor, aldR regulator-li
total genus 36
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3l7qA00
1XHOA 1QAHA 2UYJA 3KJJA 5HP8A 1QU9A 1XRGA 2UYNB 2UYKA 3LMEA 4NWOB 1QD9A 1FNKA 2UYNA 3I3FA 3D01A 1COMA 3ZO8A 1PF5A 4ZK7A 2DYYA 3ZP4A 3KJKA 2UYPA 1J7HA 1ONIA 2EWCA 1DBFA 2B33A 5HP7A 1UFYA 3L7QA 2CWJA 2CVLA 1X25A 3ZP7A 3M4SA 2CHTA 2IG8A 3M1XA 3V4DA 2CW4A 3GTZA 3K0TA 3K12A 3QUWA 3R0PA 1ODEA 3I7TA 3ZOPA 2OTMA 1FNJA 3LYBA 1NQ3A 1JD1A 1UI9A 2CHSA 2CSLA 3VCZA 3MQWA
chains in the Genus database with same CATH superfamily
5JH7A 3KJJA 3I56F 1JJ2F 4F6RB 2R751 4B5CA 3CPWF 3RA6A 1Q86H 4FFBB 5HXZA 3CCVF 1T0KB 4BT6A 3VYSC 4TV9B 1VQMF 2R6R1 4X1KA 3PLAC 3JARA 3LWPC 4YJ3A 3RA5A 5IJ0A 1OAPA 1W42A 2LBWA 1GO0A 4R40B 3JASA 3HKCA 3JCMM 4X1YA 5CA0B 2HS0A 3LWOC 3CCSF 3LYBA 2Q1XA 3LFOA 3O85A 3RE3A 2MQEA 1YIJF 2Z1UA 4HNAA 3RYHB 1XHOA 3F6MA 1GO1A 2BTUA 3AGKA 3CMEF 3D00A 4TV8B 5EO3A 3FD6A 3FBAA 3WXMB 1ONIA 1YJ9F 2EWCA 1W581 5GIOC 2VXYA 3TD5A 5EB0A 5EB1B 5J2TA 3WGLA 3OW2F 5EZYA 3CCQF 4O4IA 4ZHQB 3MCQA 3ON1A 5LA6A 2CSLA 4TUYB 4O2BB 5IJ9A 5FNVB 3C9SA 3HKCB 1IV3A 4YJ3B 3N4YA 1H7MA 4PWTA 3N2KA 3TD4A 2PMPA 3C9TA 2H8CA 1COMA 2HRUA 4LNUB 5CA0A 4I55B 2Z1EA 4O4JA 3JAWA 5EWRA 2OTJF 4TV9A 4I4TA 1YITF 3CG6A 5JQGB 3CCMF 1W5FA 3M4SA 3IEQA 2QA4F 2CHTA 1KNJA 1SA0A 4TV8A 1W5EA 2KG4A 4NUTA 1H48A 5LYJB 3B6NA 3F0EA 1SZQA 3MQWA 4RHAA 3SIUA 3CYPB 1W59A 4EB6A 2VAPA 2VAWA 2H8EA 1QD9A 1FNKA 3WGNA 5J2TB 5LP6C 5MN6A 1KNKA 5DCVA 2ZODA 1DT9A 3CD6F 4U3JA 1DBFA 3C9UA 3K14A 4C4WC 5HY1A 1RQ2A 5B8FA 2HQSC 3V4DA 3M1XA 3S0WA 2I6RA 4I55A 5LP6A 4O4LB 1FNJA 3KE1A 4O2AA 3RYFA 1IV2A 2RHHA 1VQLF 3GHZA 4BT3A 3LMEA 1VH8A 3CCUF 3ERNA 1JY8A 1SA0B 5J2UB 1CK2A 4IIJA 3J7AR 2ZOVA 2QTPA 3N2KB 1K9MH 3C8LA 3OBWA 1VQPF 2BTQB 2RHLA 3L7QA 1TUBA 1JFFB 5IYZB 4YJ2A 3WJPA 4DRXB 3CXCF 2RHOA 3LWRC 5HY4A 2YXZA 1X7PA 2UYNA 2KGWA 3IEWA 1Q8RA 5EYPB 2DYYA 3ZP4A 2Z01A 2GLZA 1J7HA 5CA1B 5ITZA 3G4SF 2AIFA 3NMUC 2V9YA 3F0DA 5CB4B 1U3PA 3RYCB 2HP0A 2ZVZA 1OFUA 3RYIA 3OBYA 2JNBA 1W2BF 3ZOPA 5IJ0B 3HKBB 3WJQA 5KMGA 3I7TA 3HAXD 1GZ0A 1VK3A 2HP3A 5EIBC 3M84A 2YYEA 2BTOA 4I4TB 1K73H 4WBNA 5JQGA 4NWOB 4X3MA 2UZHA 2VGMA 3JALB 3LWVC 3JARB 3SIVA 3KJKA 2UYPA 2LCAA 4ZHYB 4BVRA 5J2UA 2VGNA 1RA4A 4M8IA 3S03A 3UT5A 1CLIA 2Z1FA 2N48A 5GIPC 4ZHWA 2HX0A 4G4VA 1VQVA 2ALEA 3WJRA 1W5AA 4O4HB 5LOVB 2W8BC 2HP0B 4O4IB 5MN4A 1E7KA 5ITZB 3NVKE 5LA6B 1VQ8F 5GONA 1IV1A 1TVKB 3D54A 3P0ZA 4U39A 2L26A 3CCJF 4C8EA 2FC3A 2RHJA 3VMFB 3VYUC 3JAMM 4IHJA 3G6EF 1XV2A 4G4WA 2PHNA 2CW4A 1W41A 1JN1A 1W3EX 3JALA 3OONA 3JAKA 1VQ7F 5C8YA 3VYTC 2GZLA 3NK6A 3E22B 3VI6A 3J81M 3ZO8A 4ZHQA 1PF5A 1KC8H 1X52A 4I50B 3LDTA 3S06A 4X20B 3J80M 1VQ6F 3HJWC 3HKDA 2KTVA 1VQNF 2F9ZC 3ZP7A 4ZI7A 5HWEA 3PAFA 1YHQF 4X3LA 5BMVB 4KWEA 3DC2A 1TVKA 5EZYB 1H47A 4O4JB 1UI9A 3ELCA 1T0AA 4BT7A 5LP6B 1QAHA 5HP8A 5CB4A 1QU9A 2HRYA 3RYCA 1XBIA 3I55F 3V3TA 4O2AB 3RYIB 1RQ7A 3I3FA 5IJ9B 4X1IB 1NJIH 3RYFB 3HKBA 3HKEB 1VQOF 5KX5A 3WGKA 5GINC 2Z1TA 3P10A 4ZOLA 2ZF8A 4EB6B 4X1YB 1YJWF 4G88A 1X25A 4EI9A 5LXTA 2IG8A 1GX1A 1W57A 2BO1A 2HS4A 1Q81H 4HNAB 1KD1H 4BY9D 2IQQA 5EAZA 3VOBA 2UYJA 2LBTA 4ZI7B 4X20A 3V7QA 4NQ3A 2ZVYA 3UT5B 3JASB 4DRXA 4RQOA 3CCLF 1N8RH 3S02A 4BVQA 4C81A 3WGJA 1Q7YH 4FFBA 3E22A 3S0HA 2NMUA 1VHAA 3MCAB 2CVLA 4C8GA 5A2QM 3HKDB 5KX5B 4TUYA 1YQNA 2OTMA 4TZZA 5HP7A 3HKEA 4O4LA 1YGYA 1R1MA 5KMGB 5LXTB 3KIZA 3RYHA 4BVTA 5GANK 3KHNA 1M90H 4EI8A 1Z5WA 1FFXA 1JFFA 3Q8HA 5CA1A 5AVMA 2KTUA 2VAMA 3VO8A 4BT4A 4ERHA 3CPQA 5JVDA 3V7EA 3T80A 4G4XA 4BW0B 3VTIC 4B45A 1YI2F 2P6YA 2RB9A 4BT5A 2CWJA 4EI7A 4B62A 2OZBA 3WGMA 4ZOLB 3K0TA 3N4ZA 5GAPK 3CCEF 3FFMA 4I50A 3JATB 4YJ2B 5IYZA 3VCZA 5EIBD 1VQ5F 1X7OA 3F0FA 1XRGA 3FD5A 3NK7A 3VOAA 1QVGF 3IR9A 2UYKA 3IKEA 3QHDA 1S72F 1U43A 2LBXA 3D01A 1NMUB 1KQSF 2AMTA 4LNUA 3BYQA 1U3LA 3E20B 3C9RA 1W55A 1UFYA 3LWQC 1FSZA 4G4YA 3GTZA 4O2BA 4IHJB 2GVIA 2QEXF 1ZWZA 3K2XA 2CHSA 3CC2F 3QTYA 1W40A 3F0GA 3IMPA 2QI2A 2CZWA 3FPIA 5GONB 1IV4A 2FGYA 1PXWA 1SDSA 4DXDA 3CC7F 5G4VC 2G9IA 4XCQA 3N2GA 1TUBB 1FFXB 5HXUA 3HTNA 2OTLF 4U3JB 1RLGA 5JVDB 3E1YA 5LYJA 3HWUA 2K1SA 2HVYD 1Z5VA 5JCOC 4BVSA 2HS3A 4IIJB 2IAFA 3U0OA 1JD1A 5BMVA 1QVFF 1RLUA 2UYNB 3G71F 1VQ4F 2OHWA 3JVHA 3JATA 4ZHVA 4X1KB 1VQ9F 5JCOA 3VIUA 5G4UC 3IKFA 3WPXA 4ZK7A 2Q1YA 3WPWA 3TD3A 3S0YA 4F6RA 5IT9M 5FNVA 3NVIB 1Q82H 5JH7B 1K8AH 4B46A 1VQKF 5HY2A 3GYQA 3QUWA 3MDOA 4C82A 1ODEA 3N2GB 3JAWB 1NQ3A 4BT2A 5FJ4C 4WBNB 5HY0A 1W5BA 3CMAF 3CC4F 4X1IA 3JAKB 2ZAUA 3CCRF 5C8YB 3MBMA 4E6EA 1M1KH 5MN5A 4LCKA 2WALA 5EYPA 2B33A 3DDNA 1U40A 3P4EA 2I6DA 4C8IA 3EORA 3CB2A 3K12A 3R0PA 4O4HA 5LOVA 1IPAA 2DT4A 4G4ZA 3CYQA 3ESJA 1YJNF 2AIZP 2H6LA 1CN7A 5FLXM
chains in the Genus database with same CATH topology
1XHOA 1QAHA 2UYJA 3KJJA 5HP8A 1QU9A 1XRGA 2UYNB 2UYKA 3LMEA 4NWOB 1QD9A 1FNKA 2UYNA 3I3FA 3D01A 1COMA 3ZO8A 1PF5A 4ZK7A 2DYYA 3ZP4A 3KJKA 2UYPA 1J7HA 1ONIA 2EWCA 1DBFA 2B33A 5HP7A 1UFYA 3L7QA 2CWJA 2CVLA 1X25A 3ZP7A 3M4SA 2CHTA 2IG8A 3M1XA 3V4DA 2CW4A 3GTZA 3K0TA 3K12A 3QUWA 3R0PA 1ODEA 3I7TA 3ZOPA 2OTMA 1FNJA 3LYBA 1NQ3A 1JD1A 1UI9A 2CHSA 2CSLA 3VCZA 3MQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHO A;  1QAH A;  2UYJ A;  3KJJ A;  5HP8 A;  1QU9 A;  1XRG A;  2UYN B;  2UYK A;  3LME A;  4NWO B;  1QD9 A;  1FNK A;  2UYN A;  3I3F A;  3D01 A;  1COM A;  3ZO8 A;  1PF5 A;  4ZK7 A;  2DYY A;  3ZP4 A;  3KJK A;  2UYP A;  1J7H A;  1ONI A;  2EWC A;  1DBF A;  2B33 A;  5HP7 A;  1UFY A;  3L7Q A;  2CWJ A;  2CVL A;  1X25 A;  3ZP7 A;  3M4S A;  2CHT A;  2IG8 A;  3M1X A;  3V4D A;  2CW4 A;  3GTZ A;  3K0T A;  3K12 A;  3QUW A;  3R0P A;  1ODE A;  3I7T A;  3ZOP A;  2OTM A;  1FNJ A;  3LYB A;  1NQ3 A;  1JD1 A;  1UI9 A;  2CHS A;  2CSL A;  3VCZ A;  3MQW A; 
#chains in the Genus database with same CATH topology
 5JH7 A;  3KJJ A;  3I56 F;  1JJ2 F;  4F6R B;  2R75 1;  4B5C A;  3CPW F;  3RA6 A;  1Q86 H;  4FFB B;  5HXZ A;  3CCV F;  1T0K B;  4BT6 A;  3VYS C;  4TV9 B;  1VQM F;  2R6R 1;  4X1K A;  3PLA C;  3JAR A;  3LWP C;  4YJ3 A;  3RA5 A;  5IJ0 A;  1OAP A;  1W42 A;  2LBW A;  1GO0 A;  4R40 B;  3JAS A;  3HKC A;  3JCM M;  4X1Y A;  5CA0 B;  2HS0 A;  3LWO C;  3CCS F;  3LYB A;  2Q1X A;  3LFO A;  3O85 A;  3RE3 A;  2MQE A;  1YIJ F;  2Z1U A;  4HNA A;  3RYH B;  1XHO A;  3F6M A;  1GO1 A;  2BTU A;  3AGK A;  3CME F;  3D00 A;  4TV8 B;  5EO3 A;  3FD6 A;  3FBA A;  3WXM B;  1ONI A;  1YJ9 F;  2EWC A;  1W58 1;  5GIO C;  2VXY A;  3TD5 A;  5EB0 A;  5EB1 B;  5J2T A;  3WGL A;  3OW2 F;  5EZY A;  3CCQ F;  4O4I A;  4ZHQ B;  3MCQ A;  3ON1 A;  5LA6 A;  2CSL A;  4TUY B;  4O2B B;  5IJ9 A;  5FNV B;  3C9S A;  3HKC B;  1IV3 A;  4YJ3 B;  3N4Y A;  1H7M A;  4PWT A;  3N2K A;  3TD4 A;  2PMP A;  3C9T A;  2H8C A;  1COM A;  2HRU A;  4LNU B;  5CA0 A;  4I55 B;  2Z1E A;  4O4J A;  3JAW A;  5EWR A;  2OTJ F;  4TV9 A;  4I4T A;  1YIT F;  3CG6 A;  5JQG B;  3CCM F;  1W5F A;  3M4S A;  3IEQ A;  2QA4 F;  2CHT A;  1KNJ A;  1SA0 A;  4TV8 A;  1W5E A;  2KG4 A;  4NUT A;  1H48 A;  5LYJ B;  3B6N A;  3F0E A;  1SZQ A;  3MQW A;  4RHA A;  3SIU A;  3CYP B;  1W59 A;  4EB6 A;  2VAP A;  2VAW A;  2H8E A;  1QD9 A;  1FNK A;  3WGN A;  5J2T B;  5LP6 C;  5MN6 A;  1KNK A;  5DCV A;  2ZOD A;  1DT9 A;  3CD6 F;  4U3J A;  1DBF A;  3C9U A;  3K14 A;  4C4W C;  5HY1 A;  1RQ2 A;  5B8F A;  2HQS C;  3V4D A;  3M1X A;  3S0W A;  2I6R A;  4I55 A;  5LP6 A;  4O4L B;  1FNJ A;  3KE1 A;  4O2A A;  3RYF A;  1IV2 A;  2RHH A;  1VQL F;  3GHZ A;  4BT3 A;  3LME A;  1VH8 A;  3CCU F;  3ERN A;  1JY8 A;  1SA0 B;  5J2U B;  1CK2 A;  4IIJ A;  3J7A R;  2ZOV A;  2QTP A;  3N2K B;  1K9M H;  3C8L A;  3OBW A;  1VQP F;  2BTQ B;  2RHL A;  3L7Q A;  1TUB A;  1JFF B;  5IYZ B;  4YJ2 A;  3WJP A;  4DRX B;  3CXC F;  2RHO A;  3LWR C;  5HY4 A;  2YXZ A;  1X7P A;  2UYN A;  2KGW A;  3IEW A;  1Q8R A;  5EYP B;  2DYY A;  3ZP4 A;  2Z01 A;  2GLZ A;  1J7H A;  5CA1 B;  5ITZ A;  3G4S F;  2AIF A;  3NMU C;  2V9Y A;  3F0D A;  5CB4 B;  1U3P A;  3RYC B;  2HP0 A;  2ZVZ A;  1OFU A;  3RYI A;  3OBY A;  2JNB A;  1W2B F;  3ZOP A;  5IJ0 B;  3HKB B;  3WJQ A;  5KMG A;  3I7T A;  3HAX D;  1GZ0 A;  1VK3 A;  2HP3 A;  5EIB C;  3M84 A;  2YYE A;  2BTO A;  4I4T B;  1K73 H;  4WBN A;  5JQG A;  4NWO B;  4X3M A;  2UZH A;  2VGM A;  3JAL B;  3LWV C;  3JAR B;  3SIV A;  3KJK A;  2UYP A;  2LCA A;  4ZHY B;  4BVR A;  5J2U A;  2VGN A;  1RA4 A;  4M8I A;  3S03 A;  3UT5 A;  1CLI A;  2Z1F A;  2N48 A;  5GIP C;  4ZHW A;  2HX0 A;  4G4V A;  1VQV A;  2ALE A;  3WJR A;  1W5A A;  4O4H B;  5LOV B;  2W8B C;  2HP0 B;  4O4I B;  5MN4 A;  1E7K A;  5ITZ B;  3NVK E;  5LA6 B;  1VQ8 F;  5GON A;  1IV1 A;  1TVK B;  3D54 A;  3P0Z A;  4U39 A;  2L26 A;  3CCJ F;  4C8E A;  2FC3 A;  2RHJ A;  3VMF B;  3VYU C;  3JAM M;  4IHJ A;  3G6E F;  1XV2 A;  4G4W A;  2PHN A;  2CW4 A;  1W41 A;  1JN1 A;  1W3E X;  3JAL A;  3OON A;  3JAK A;  1VQ7 F;  5C8Y A;  3VYT C;  2GZL A;  3NK6 A;  3E22 B;  3VI6 A;  3J81 M;  3ZO8 A;  4ZHQ A;  1PF5 A;  1KC8 H;  1X52 A;  4I50 B;  3LDT A;  3S06 A;  4X20 B;  3J80 M;  1VQ6 F;  3HJW C;  3HKD A;  2KTV A;  1VQN F;  2F9Z C;  3ZP7 A;  4ZI7 A;  5HWE A;  3PAF A;  1YHQ F;  4X3L A;  5BMV B;  4KWE A;  3DC2 A;  1TVK A;  5EZY B;  1H47 A;  4O4J B;  1UI9 A;  3ELC A;  1T0A A;  4BT7 A;  5LP6 B;  1QAH A;  5HP8 A;  5CB4 A;  1QU9 A;  2HRY A;  3RYC A;  1XBI A;  3I55 F;  3V3T A;  4O2A B;  3RYI B;  1RQ7 A;  3I3F A;  5IJ9 B;  4X1I B;  1NJI H;  3RYF B;  3HKB A;  3HKE B;  1VQO F;  5KX5 A;  3WGK A;  5GIN C;  2Z1T A;  3P10 A;  4ZOL A;  2ZF8 A;  4EB6 B;  4X1Y B;  1YJW F;  4G88 A;  1X25 A;  4EI9 A;  5LXT A;  2IG8 A;  1GX1 A;  1W57 A;  2BO1 A;  2HS4 A;  1Q81 H;  4HNA B;  1KD1 H;  4BY9 D;  2IQQ A;  5EAZ A;  3VOB A;  2UYJ A;  2LBT A;  4ZI7 B;  4X20 A;  3V7Q A;  4NQ3 A;  2ZVY A;  3UT5 B;  3JAS B;  4DRX A;  4RQO A;  3CCL F;  1N8R H;  3S02 A;  4BVQ A;  4C81 A;  3WGJ A;  1Q7Y H;  4FFB A;  3E22 A;  3S0H A;  2NMU A;  1VHA A;  3MCA B;  2CVL A;  4C8G A;  5A2Q M;  3HKD B;  5KX5 B;  4TUY A;  1YQN A;  2OTM A;  4TZZ A;  5HP7 A;  3HKE A;  4O4L A;  1YGY A;  1R1M A;  5KMG B;  5LXT B;  3KIZ A;  3RYH A;  4BVT A;  5GAN K;  3KHN A;  1M90 H;  4EI8 A;  1Z5W A;  1FFX A;  1JFF A;  3Q8H A;  5CA1 A;  5AVM A;  2KTU A;  2VAM A;  3VO8 A;  4BT4 A;  4ERH A;  3CPQ A;  5JVD A;  3V7E A;  3T80 A;  4G4X A;  4BW0 B;  3VTI C;  4B45 A;  1YI2 F;  2P6Y A;  2RB9 A;  4BT5 A;  2CWJ A;  4EI7 A;  4B62 A;  2OZB A;  3WGM A;  4ZOL B;  3K0T A;  3N4Z A;  5GAP K;  3CCE F;  3FFM A;  4I50 A;  3JAT B;  4YJ2 B;  5IYZ A;  3VCZ A;  5EIB D;  1VQ5 F;  1X7O A;  3F0F A;  1XRG A;  3FD5 A;  3NK7 A;  3VOA A;  1QVG F;  3IR9 A;  2UYK A;  3IKE A;  3QHD A;  1S72 F;  1U43 A;  2LBX A;  3D01 A;  1NMU B;  1KQS F;  2AMT A;  4LNU A;  3BYQ A;  1U3L A;  3E20 B;  3C9R A;  1W55 A;  1UFY A;  3LWQ C;  1FSZ A;  4G4Y A;  3GTZ A;  4O2B A;  4IHJ B;  2GVI A;  2QEX F;  1ZWZ A;  3K2X A;  2CHS A;  3CC2 F;  3QTY A;  1W40 A;  3F0G A;  3IMP A;  2QI2 A;  2CZW A;  3FPI A;  5GON B;  1IV4 A;  2FGY A;  1PXW A;  1SDS A;  4DXD A;  3CC7 F;  5G4V C;  2G9I A;  4XCQ A;  3N2G A;  1TUB B;  1FFX B;  5HXU A;  3HTN A;  2OTL F;  4U3J B;  1RLG A;  5JVD B;  3E1Y A;  5LYJ A;  3HWU A;  2K1S A;  2HVY D;  1Z5V A;  5JCO C;  4BVS A;  2HS3 A;  4IIJ B;  2IAF A;  3U0O A;  1JD1 A;  5BMV A;  1QVF F;  1RLU A;  2UYN B;  3G71 F;  1VQ4 F;  2OHW A;  3JVH A;  3JAT A;  4ZHV A;  4X1K B;  1VQ9 F;  5JCO A;  3VIU A;  5G4U C;  3IKF A;  3WPX A;  4ZK7 A;  2Q1Y A;  3WPW A;  3TD3 A;  3S0Y A;  4F6R A;  5IT9 M;  5FNV A;  3NVI B;  1Q82 H;  5JH7 B;  1K8A H;  4B46 A;  1VQK F;  5HY2 A;  3GYQ A;  3QUW A;  3MDO A;  4C82 A;  1ODE A;  3N2G B;  3JAW B;  1NQ3 A;  4BT2 A;  5FJ4 C;  4WBN B;  5HY0 A;  1W5B A;  3CMA F;  3CC4 F;  4X1I A;  3JAK B;  2ZAU A;  3CCR F;  5C8Y B;  3MBM A;  4E6E A;  1M1K H;  5MN5 A;  4LCK A;  2WAL A;  5EYP A;  2B33 A;  3DDN A;  1U40 A;  3P4E A;  2I6D A;  4C8I A;  3EOR A;  3CB2 A;  3K12 A;  3R0P A;  4O4H A;  5LOV A;  1IPA A;  2DT4 A;  4G4Z A;  3CYQ A;  3ESJ A;  1YJN F;  2AIZ P;  2H6L A;  1CN7 A;  5FLX M; 
#chains in the Genus database with same CATH homology
 1XHO A;  1QAH A;  2UYJ A;  3KJJ A;  5HP8 A;  1QU9 A;  1XRG A;  2UYN B;  2UYK A;  3LME A;  4NWO B;  1QD9 A;  1FNK A;  2UYN A;  3I3F A;  3D01 A;  1COM A;  3ZO8 A;  1PF5 A;  4ZK7 A;  2DYY A;  3ZP4 A;  3KJK A;  2UYP A;  1J7H A;  1ONI A;  2EWC A;  1DBF A;  2B33 A;  5HP7 A;  1UFY A;  3L7Q A;  2CWJ A;  2CVL A;  1X25 A;  3ZP7 A;  3M4S A;  2CHT A;  2IG8 A;  3M1X A;  3V4D A;  2CW4 A;  3GTZ A;  3K0T A;  3K12 A;  3QUW A;  3R0P A;  1ODE A;  3I7T A;  3ZOP A;  2OTM A;  1FNJ A;  3LYB A;  1NQ3 A;  1JD1 A;  1UI9 A;  2CHS A;  2CSL A;  3VCZ A;  3MQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...