3L7QA

Crystal structure of aldr from streptococcus mutans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
b'KKIHTDKAPAAIGPYVQGKIVGNLLFASGQVPLSPETGQVIGTTIEEQTQQVLKNISAILTEAGTDFDHVVKTTCFLSDIDDFVPFNEVYATAFKSDFPARSAVEVARLPKDVKIEIEVIAELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation inhibitor, aldR regulator-li
molecule tags Translation
source organism Streptococcus mutans
publication title Crystal structure of AldR from streptococcus mutans
rcsb
total genus 36
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3l7qA00
3K12A 2CHSA 2UYPA 2OTMA 2CWJA 3M1XA 2UYNB 3GTZA 5HP8A 1FNJA 3MQWA 2CW4A 1ONIA 3QUWA 3I3FA 5HP7A 2CVLA 1JD1A 3ZP4A 1J7HA 1COMA 1QD9A 1UI9A 4NWOB 1UFYA 1FNKA 3K0TA 3KJJA 1ODEA 3I7TA 2UYKA 3M4SA 3R0PA 2UYJA 3V4DA 3L7QA 2UYNA 2B33A 4ZK7A 2EWCA 1XRGA 1QAHA 3ZP7A 1XHOA 2CSLA 3D01A 1PF5A 3ZOPA 3VCZA 1DBFA 1X25A 1NQ3A 3KJKA 2CHTA 2DYYA 3LMEA 3LYBA 2IG8A 1QU9A 3ZO8A
chains in the Genus database with same CATH superfamily
2GZLA 4DRXB 4WBNA 5EB1B 1VH8A 4BT4A 2FC3A 2KG4A 2GLZA 3O85A 1U3LA 1JD1A 3ESJA 3N2GA 1VQMF 3HKCA 3K2XA 4BT6A 2RHJA 1FNKA 3S02A 1W2BF 1ZWZA 5B8FA 4DRXA 1Q86H 1Q81H 1IV3A 2HP0B 4C82A 2QI2A 3NVKE 3CCVF 3HTNA 2PHNA 3G4SF 3CCMF 1VHAA 2RHLA 4C8IA 4ZI7B 5KMGB 5EO3A 5EWRA 2HP0A 5JH7A 3G71F 4O2BA 3GHZA 3LWPC 5GANK 3N2KA 3WJQA 5LP6C 4EI9A 4IIJB 2N48A 1SDSA 2OHWA 4NWOB 1W5FA 3S0WA 5JVDB 1OFUA 1T0KB 2HP3A 3M4SA 1PXWA 5JCOA 2ZOVA 4ZK7A 4C81A 3HWUA 2VGMA 5KX5A 5MN6A 4O4HA 2VGNA 4ZOLB 1VQPF 2RB9A 1CK2A 3IKEA 3Q8HA 1YQNA 3ELCA 2ZF8A 3V7QA 4BVRA 3S0YA 1H7MA 3HAXD 2Z1EA 3RYCA 2I6DA 3I55F 3VOAA 1QVFF 1XV2A 3K14A 3TD3A 1YI2F 4G88A 1Z5VA 2B33A 1YIJF 3JAKA 1X25A 5EAZA 3LMEA 3WJPA 3S03A 3UT5B 4G4YA 5C8YA 5FNVA 2LBTA 4U3JA 3IKFA 4NUTA 2JNBA 3I3FA 2CVLA 1QD9A 5HY0A 4IHJB 3PAFA 2HRUA 1W55A 2AMTA 2BTUA 4I4TA 3JAWB 5FNVB 2HQSC 2UZHA 3P4EA 1QVGF 5GAPK 4BT5A 1K9MH 3J81M 3T80A 3KJKA 1VQ5F 1RLGA 2DYYA 3IEWA 4F6RB 3ERNA 5HY2A 2LCAA 4EI8A 2K1SA 3VOBA 5EIBD 4BT3A 3CCUF 3WGJA 3EORA 1JJ2F 5IYZA 1GO0A 2WALA 2ALEA 3C9SA 1GX1A 4F6RA 3LWQC 5EIBC 1NJIH 2HRYA 1RQ2A 4WBNB 3TD5A 2OTLF 4C8EA 1RQ7A 1T0AA 3RYFA 2NMUA 3D01A 5LXTB 1PF5A 4TUYB 1IPAA 4O2AA 3IR9A 2CHTA 3JCMM 4DXDA 2KTVA 2R751 3PLAC 3E20B 1YITF 5HP8A 1FNJA 1W5EA 5KX5B 3F0DA 4I50B 3HKEA 2ZVYA 3S0HA 5HXUA 3OW2F 4O4LB 3HKBA 3VYUC 3MBMA 5CB4B 1FSZA 1KC8H 3B6NA 1VQKF 3HKDA 4B45A 1M90H 2Z01A 3AGKA 1SZQA 1TVKA 4TV8A 4BY9D 3N2KB 1VQNF 4IIJA 5EZYA 3FFMA 4G4XA 1H48A 1E7KA 5LYJB 2OTMA 4BVSA 1JY8A 3KE1A 5IJ0A 1H47A 3WGKA 4FFBB 1M1KH 4O4JA 1TVKB 3FD5A 3CCEF 2RHHA 5LA6A 3VTIC 1R1MA 3CD6F 5HP7A 3JATB 3J80M 3ZP4A 5FJ4C 4O4HB 1JN1A 4ZOLA 3QHDA 4I55B 2HX0A 4XCQA 3UT5A 3JVHA 5J2UB 1W42A 3R0PA 2HVYD 3F0FA 1XRGA 5LOVB 2LBXA 5LA6B 4M8IA 4R40B 3E22B 5DCVA 1S72F 1IV1A 3JATA 2BO1A 2VAPA 3JARA 1QU9A 1GO1A 3VI6A 3ZO8A 3RYCB 5GIOC 2CHSA 4I4TB 1GZ0A 5CA0A 3D54A 5BMVA 1ONIA 3E22A 3FD6A 4TV9A 3JARB 2VXYA 3RYHA 4B62A 3LDTA 3RA6A 1KNJA 5C8YB 5CA0B 4X1IA 3NMUC 3F0GA 3CC4F 3P0ZA 5IJ9A 2ZAUA 3LFOA 2CSLA 4G4ZA 5IYZB 4O4IA 1KNKA 1NQ3A 4KWEA 3RYIA 3N2GB 3CCLF 3HKCB 3JASA 3F0EA 3RYHB 5GIPC 3GYQA 1XBIA 3CCQF 2QA4F 5IJ9B 4X1YA 3CCJF 2UYNB 3N4YA 3RYFB 1IV2A 5IT9M 1VQ6F 2Q1XA 3NK6A 3V7EA 4O2AB 4C8GA 4B46A 1VQ9F 1UFYA 3K0TA 4ZI7A 2L26A 3C9RA 3IEQA 4X20B 3CXCF 4X1KA 4X1YB 4HNAA 2UYNA 3MDOA 3CPWF 1QAHA 3MCAB 5HWEA 4X3MA 1W5BA 3OBYA 1X52A 3TD4A 3HKBB 1VQLF 4E6EA 3F6MA 3L7QA 1JFFA 2V9YA 5JVDA 3HJWC 4X1KB 3CCRF 3GTZA 4YJ3B 1DT9A 1YJWF 3MQWA 4PWTA 3JALA 2H8CA 3OONA 1VK3A 1W57A 3CYQA 5LYJA 3SIVA 2FGYA 2HS0A 4ZHQB 4FFBA 5JH7B 1VQ4F 3WPWA 4LNUB 4O2BB 3VYTC 5FLXM 3CPQA 3CC7F 1DBFA 5AVMA 4I55A 4RQOA 3KHNA 3N4ZA 3RE3A 5CB4A 3HKDB 1TUBB 3P10A 2YYEA 3C9TA 1KD1H 5LOVA 3CCSF 2CW4A 4RHAA 5JCOC 1RLUA 5HY4A 4EB6A 3WPXA 1VQ7F 3G6EF 1CN7A 4ERHA 2OTJF 3DDNA 4BT7A 5HY1A 3ON1A 3CB2A 1TUBA 2IAFA 2BTOA 2CZWA 5EB0A 4O4JB 1U40A 5BMVB 4C4WC 4TV9B 1K73H 5G4UC 3IMPA 4G4WA 4IHJA 3C9UA 5GONA 1X7OA 2R6R1 1SA0B 3JAWA 2HS4A 3V3TA 5CA1A 4BVQA 3RYIB 3SIUA 1UI9A 1U3PA 3JAMM 3QTYA 1W5AA 3E1YA 1W41A 4X3LA 2UYJA 5ITZA 2HS3A 3VIUA 3ZP7A 3CC2F 5MN5A 4LCKA 1W59A 3VCZA 3LWRC 1Q82H 3VYSC 2W8BC 2QTPA 3WGMA 2UYPA 3M84A 4G4VA 2F9ZC 2CWJA 2QEXF 5JQGA 3I56F 1W581 2ZVZA 3FPIA 2RHOA 3JASB 5MN4A 1JFFB 2GVIA 4BT2A 2H8EA 2Z1UA 2UYKA 1W40A 2YXZA 4YJ3A 2EWCA 1K8AH 2BTQB 2H6LA 3JALB 1YGYA 3HKEB 2OZBA 1Q7YH 3LWOC 3LYBA 2IG8A 3K12A 3WXMB 5EYPA 3D00A 3RA5A 4ZHQA 4X20A 4HNAB 4YJ2A 4LNUA 1VQ8F 4TV8B 5LXTA 2AIZP 4TUYA 3VMFB 4EI7A 2DT4A 5EZYB 1Z5WA 1COMA 1VQOF 1J7HA 4ZHYB 5EYPB 5KMGA 2Z1TA 5A2QM 5LP6A 3CMEF 4BVTA 1W3EX 2MQEA 3KIZA 5J2TB 1VQVA 4YJ2B 1U43A 3DC2A 4I50A 2Z1FA 3ZOPA 2KTUA 4EB6B 3LWVC 2I6RA 4O4LA 4BW0B 2VAMA 2KGWA 4B5CA 5HXZA 5J2UA 5LP6B 1CLIA 1N8RH 2IQQA 5J2TA 1YJ9F 3JAKB 3QUWA 3WJRA 3CMAF 2Q1YA 3KJJA 5GONB 5IJ0B 3I7TA 2AIFA 1IV4A 4NQ3A 2P6YA 1XHOA 3CYPB 1OAPA 1RA4A 5G4VC 1YJNF 1FFXA 3MCQA 3VO8A 3FBAA 3U0OA 4X1IB 3M1XA 3WGLA 5ITZB 3J7AR 4U39A 4TZZA 3CG6A 4O4IB 1FFXB 5GINC 3S06A 4ZHVA 2G9IA 1NMUB 2VAWA 1ODEA 1SA0A 3C8LA 3NK7A 2LBWA 4ZHWA 3NVIB 3V4DA 3WGNA 5JQGB 3BYQA 1YHQF 5CA1B 4U3JB 2PMPA 3OBWA 1KQSF 2ZODA 1Q8RA 1X7PA
chains in the Genus database with same CATH topology
3K12A 2CHSA 2UYPA 2OTMA 2CWJA 3M1XA 2UYNB 3GTZA 5HP8A 1FNJA 3MQWA 2CW4A 1ONIA 3QUWA 3I3FA 5HP7A 2CVLA 1JD1A 3ZP4A 1J7HA 1COMA 1QD9A 1UI9A 4NWOB 1UFYA 1FNKA 3K0TA 3KJJA 1ODEA 3I7TA 2UYKA 3M4SA 3R0PA 2UYJA 3V4DA 3L7QA 2UYNA 2B33A 4ZK7A 2EWCA 1XRGA 1QAHA 3ZP7A 1XHOA 2CSLA 3D01A 1PF5A 3ZOPA 3VCZA 1DBFA 1X25A 1NQ3A 3KJKA 2CHTA 2DYYA 3LMEA 3LYBA 2IG8A 1QU9A 3ZO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K12 A;  2CHS A;  2UYP A;  2OTM A;  2CWJ A;  3M1X A;  2UYN B;  3GTZ A;  5HP8 A;  1FNJ A;  3MQW A;  2CW4 A;  1ONI A;  3QUW A;  3I3F A;  5HP7 A;  2CVL A;  1JD1 A;  3ZP4 A;  1J7H A;  1COM A;  1QD9 A;  1UI9 A;  4NWO B;  1UFY A;  1FNK A;  3K0T A;  3KJJ A;  1ODE A;  3I7T A;  2UYK A;  3M4S A;  3R0P A;  2UYJ A;  3V4D A;  3L7Q A;  2UYN A;  2B33 A;  4ZK7 A;  2EWC A;  1XRG A;  1QAH A;  3ZP7 A;  1XHO A;  2CSL A;  3D01 A;  1PF5 A;  3ZOP A;  3VCZ A;  1DBF A;  1X25 A;  1NQ3 A;  3KJK A;  2CHT A;  2DYY A;  3LME A;  3LYB A;  2IG8 A;  1QU9 A;  3ZO8 A; 
#chains in the Genus database with same CATH topology
 2GZL A;  4DRX B;  4WBN A;  5EB1 B;  1VH8 A;  4BT4 A;  2FC3 A;  2KG4 A;  2GLZ A;  3O85 A;  1U3L A;  1JD1 A;  3ESJ A;  3N2G A;  1VQM F;  3HKC A;  3K2X A;  4BT6 A;  2RHJ A;  1FNK A;  3S02 A;  1W2B F;  1ZWZ A;  5B8F A;  4DRX A;  1Q86 H;  1Q81 H;  1IV3 A;  2HP0 B;  4C82 A;  2QI2 A;  3NVK E;  3CCV F;  3HTN A;  2PHN A;  3G4S F;  3CCM F;  1VHA A;  2RHL A;  4C8I A;  4ZI7 B;  5KMG B;  5EO3 A;  5EWR A;  2HP0 A;  5JH7 A;  3G71 F;  4O2B A;  3GHZ A;  3LWP C;  5GAN K;  3N2K A;  3WJQ A;  5LP6 C;  4EI9 A;  4IIJ B;  2N48 A;  1SDS A;  2OHW A;  4NWO B;  1W5F A;  3S0W A;  5JVD B;  1OFU A;  1T0K B;  2HP3 A;  3M4S A;  1PXW A;  5JCO A;  2ZOV A;  4ZK7 A;  4C81 A;  3HWU A;  2VGM A;  5KX5 A;  5MN6 A;  4O4H A;  2VGN A;  4ZOL B;  1VQP F;  2RB9 A;  1CK2 A;  3IKE A;  3Q8H A;  1YQN A;  3ELC A;  2ZF8 A;  3V7Q A;  4BVR A;  3S0Y A;  1H7M A;  3HAX D;  2Z1E A;  3RYC A;  2I6D A;  3I55 F;  3VOA A;  1QVF F;  1XV2 A;  3K14 A;  3TD3 A;  1YI2 F;  4G88 A;  1Z5V A;  2B33 A;  1YIJ F;  3JAK A;  1X25 A;  5EAZ A;  3LME A;  3WJP A;  3S03 A;  3UT5 B;  4G4Y A;  5C8Y A;  5FNV A;  2LBT A;  4U3J A;  3IKF A;  4NUT A;  2JNB A;  3I3F A;  2CVL A;  1QD9 A;  5HY0 A;  4IHJ B;  3PAF A;  2HRU A;  1W55 A;  2AMT A;  2BTU A;  4I4T A;  3JAW B;  5FNV B;  2HQS C;  2UZH A;  3P4E A;  1QVG F;  5GAP K;  4BT5 A;  1K9M H;  3J81 M;  3T80 A;  3KJK A;  1VQ5 F;  1RLG A;  2DYY A;  3IEW A;  4F6R B;  3ERN A;  5HY2 A;  2LCA A;  4EI8 A;  2K1S A;  3VOB A;  5EIB D;  4BT3 A;  3CCU F;  3WGJ A;  3EOR A;  1JJ2 F;  5IYZ A;  1GO0 A;  2WAL A;  2ALE A;  3C9S A;  1GX1 A;  4F6R A;  3LWQ C;  5EIB C;  1NJI H;  2HRY A;  1RQ2 A;  4WBN B;  3TD5 A;  2OTL F;  4C8E A;  1RQ7 A;  1T0A A;  3RYF A;  2NMU A;  3D01 A;  5LXT B;  1PF5 A;  4TUY B;  1IPA A;  4O2A A;  3IR9 A;  2CHT A;  3JCM M;  4DXD A;  2KTV A;  2R75 1;  3PLA C;  3E20 B;  1YIT F;  5HP8 A;  1FNJ A;  1W5E A;  5KX5 B;  3F0D A;  4I50 B;  3HKE A;  2ZVY A;  3S0H A;  5HXU A;  3OW2 F;  4O4L B;  3HKB A;  3VYU C;  3MBM A;  5CB4 B;  1FSZ A;  1KC8 H;  3B6N A;  1VQK F;  3HKD A;  4B45 A;  1M90 H;  2Z01 A;  3AGK A;  1SZQ A;  1TVK A;  4TV8 A;  4BY9 D;  3N2K B;  1VQN F;  4IIJ A;  5EZY A;  3FFM A;  4G4X A;  1H48 A;  1E7K A;  5LYJ B;  2OTM A;  4BVS A;  1JY8 A;  3KE1 A;  5IJ0 A;  1H47 A;  3WGK A;  4FFB B;  1M1K H;  4O4J A;  1TVK B;  3FD5 A;  3CCE F;  2RHH A;  5LA6 A;  3VTI C;  1R1M A;  3CD6 F;  5HP7 A;  3JAT B;  3J80 M;  3ZP4 A;  5FJ4 C;  4O4H B;  1JN1 A;  4ZOL A;  3QHD A;  4I55 B;  2HX0 A;  4XCQ A;  3UT5 A;  3JVH A;  5J2U B;  1W42 A;  3R0P A;  2HVY D;  3F0F A;  1XRG A;  5LOV B;  2LBX A;  5LA6 B;  4M8I A;  4R40 B;  3E22 B;  5DCV A;  1S72 F;  1IV1 A;  3JAT A;  2BO1 A;  2VAP A;  3JAR A;  1QU9 A;  1GO1 A;  3VI6 A;  3ZO8 A;  3RYC B;  5GIO C;  2CHS A;  4I4T B;  1GZ0 A;  5CA0 A;  3D54 A;  5BMV A;  1ONI A;  3E22 A;  3FD6 A;  4TV9 A;  3JAR B;  2VXY A;  3RYH A;  4B62 A;  3LDT A;  3RA6 A;  1KNJ A;  5C8Y B;  5CA0 B;  4X1I A;  3NMU C;  3F0G A;  3CC4 F;  3P0Z A;  5IJ9 A;  2ZAU A;  3LFO A;  2CSL A;  4G4Z A;  5IYZ B;  4O4I A;  1KNK A;  1NQ3 A;  4KWE A;  3RYI A;  3N2G B;  3CCL F;  3HKC B;  3JAS A;  3F0E A;  3RYH B;  5GIP C;  3GYQ A;  1XBI A;  3CCQ F;  2QA4 F;  5IJ9 B;  4X1Y A;  3CCJ F;  2UYN B;  3N4Y A;  3RYF B;  1IV2 A;  5IT9 M;  1VQ6 F;  2Q1X A;  3NK6 A;  3V7E A;  4O2A B;  4C8G A;  4B46 A;  1VQ9 F;  1UFY A;  3K0T A;  4ZI7 A;  2L26 A;  3C9R A;  3IEQ A;  4X20 B;  3CXC F;  4X1K A;  4X1Y B;  4HNA A;  2UYN A;  3MDO A;  3CPW F;  1QAH A;  3MCA B;  5HWE A;  4X3M A;  1W5B A;  3OBY A;  1X52 A;  3TD4 A;  3HKB B;  1VQL F;  4E6E A;  3F6M A;  3L7Q A;  1JFF A;  2V9Y A;  5JVD A;  3HJW C;  4X1K B;  3CCR F;  3GTZ A;  4YJ3 B;  1DT9 A;  1YJW F;  3MQW A;  4PWT A;  3JAL A;  2H8C A;  3OON A;  1VK3 A;  1W57 A;  3CYQ A;  5LYJ A;  3SIV A;  2FGY A;  2HS0 A;  4ZHQ B;  4FFB A;  5JH7 B;  1VQ4 F;  3WPW A;  4LNU B;  4O2B B;  3VYT C;  5FLX M;  3CPQ A;  3CC7 F;  1DBF A;  5AVM A;  4I55 A;  4RQO A;  3KHN A;  3N4Z A;  3RE3 A;  5CB4 A;  3HKD B;  1TUB B;  3P10 A;  2YYE A;  3C9T A;  1KD1 H;  5LOV A;  3CCS F;  2CW4 A;  4RHA A;  5JCO C;  1RLU A;  5HY4 A;  4EB6 A;  3WPX A;  1VQ7 F;  3G6E F;  1CN7 A;  4ERH A;  2OTJ F;  3DDN A;  4BT7 A;  5HY1 A;  3ON1 A;  3CB2 A;  1TUB A;  2IAF A;  2BTO A;  2CZW A;  5EB0 A;  4O4J B;  1U40 A;  5BMV B;  4C4W C;  4TV9 B;  1K73 H;  5G4U C;  3IMP A;  4G4W A;  4IHJ A;  3C9U A;  5GON A;  1X7O A;  2R6R 1;  1SA0 B;  3JAW A;  2HS4 A;  3V3T A;  5CA1 A;  4BVQ A;  3RYI B;  3SIU A;  1UI9 A;  1U3P A;  3JAM M;  3QTY A;  1W5A A;  3E1Y A;  1W41 A;  4X3L A;  2UYJ A;  5ITZ A;  2HS3 A;  3VIU A;  3ZP7 A;  3CC2 F;  5MN5 A;  4LCK A;  1W59 A;  3VCZ A;  3LWR C;  1Q82 H;  3VYS C;  2W8B C;  2QTP A;  3WGM A;  2UYP A;  3M84 A;  4G4V A;  2F9Z C;  2CWJ A;  2QEX F;  5JQG A;  3I56 F;  1W58 1;  2ZVZ A;  3FPI A;  2RHO A;  3JAS B;  5MN4 A;  1JFF B;  2GVI A;  4BT2 A;  2H8E A;  2Z1U A;  2UYK A;  1W40 A;  2YXZ A;  4YJ3 A;  2EWC A;  1K8A H;  2BTQ B;  2H6L A;  3JAL B;  1YGY A;  3HKE B;  2OZB A;  1Q7Y H;  3LWO C;  3LYB A;  2IG8 A;  3K12 A;  3WXM B;  5EYP A;  3D00 A;  3RA5 A;  4ZHQ A;  4X20 A;  4HNA B;  4YJ2 A;  4LNU A;  1VQ8 F;  4TV8 B;  5LXT A;  2AIZ P;  4TUY A;  3VMF B;  4EI7 A;  2DT4 A;  5EZY B;  1Z5W A;  1COM A;  1VQO F;  1J7H A;  4ZHY B;  5EYP B;  5KMG A;  2Z1T A;  5A2Q M;  5LP6 A;  3CME F;  4BVT A;  1W3E X;  2MQE A;  3KIZ A;  5J2T B;  1VQV A;  4YJ2 B;  1U43 A;  3DC2 A;  4I50 A;  2Z1F A;  3ZOP A;  2KTU A;  4EB6 B;  3LWV C;  2I6R A;  4O4L A;  4BW0 B;  2VAM A;  2KGW A;  4B5C A;  5HXZ A;  5J2U A;  5LP6 B;  1CLI A;  1N8R H;  2IQQ A;  5J2T A;  1YJ9 F;  3JAK B;  3QUW A;  3WJR A;  3CMA F;  2Q1Y A;  3KJJ A;  5GON B;  5IJ0 B;  3I7T A;  2AIF A;  1IV4 A;  4NQ3 A;  2P6Y A;  1XHO A;  3CYP B;  1OAP A;  1RA4 A;  5G4V C;  1YJN F;  1FFX A;  3MCQ A;  3VO8 A;  3FBA A;  3U0O A;  4X1I B;  3M1X A;  3WGL A;  5ITZ B;  3J7A R;  4U39 A;  4TZZ A;  3CG6 A;  4O4I B;  1FFX B;  5GIN C;  3S06 A;  4ZHV A;  2G9I A;  1NMU B;  2VAW A;  1ODE A;  1SA0 A;  3C8L A;  3NK7 A;  2LBW A;  4ZHW A;  3NVI B;  3V4D A;  3WGN A;  5JQG B;  3BYQ A;  1YHQ F;  5CA1 B;  4U3J B;  2PMP A;  3OBW A;  1KQS F;  2ZOD A;  1Q8R A;  1X7P A; 
#chains in the Genus database with same CATH homology
 3K12 A;  2CHS A;  2UYP A;  2OTM A;  2CWJ A;  3M1X A;  2UYN B;  3GTZ A;  5HP8 A;  1FNJ A;  3MQW A;  2CW4 A;  1ONI A;  3QUW A;  3I3F A;  5HP7 A;  2CVL A;  1JD1 A;  3ZP4 A;  1J7H A;  1COM A;  1QD9 A;  1UI9 A;  4NWO B;  1UFY A;  1FNK A;  3K0T A;  3KJJ A;  1ODE A;  3I7T A;  2UYK A;  3M4S A;  3R0P A;  2UYJ A;  3V4D A;  3L7Q A;  2UYN A;  2B33 A;  4ZK7 A;  2EWC A;  1XRG A;  1QAH A;  3ZP7 A;  1XHO A;  2CSL A;  3D01 A;  1PF5 A;  3ZOP A;  3VCZ A;  1DBF A;  1X25 A;  1NQ3 A;  3KJK A;  2CHT A;  2DYY A;  3LME A;  3LYB A;  2IG8 A;  1QU9 A;  3ZO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...