3CYPB

The crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256).
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
129
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 44
structure length 129
sequence length 133
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cypB00
4G4ZA 4G4XA 4ERHA 3S0YA 2AIZP 3OONA 3S0HA 4RHAA 3IMPA 3LDTA 2ZF8A 5EB0A 2N48A 4G4YA 3WPWA 3S03A 4ZHYB 4R40B 3S06A 2LCAA 2HQSC 3TD5A 4G4WA 2KGWA 2W8BC 3KHNA 3TD3A 3S0WA 3CYQA 4B62A 4ZHVA 3TD4A 3CYPB 4B5CA 2LBTA 2MQEA 2ZOVA 2L26A 1OAPA 1R1MA 4G88A 5EAZA 4G4VA 5EB1B 2K1SA 2ZVZA 4PWTA 4ZHWA 3WPXA 3S02A 2ZVYA
chains in the Genus database with same CATH superfamily
5JVDA 3VOBA 2BTQB 3EORA 5CA1A 2ZF8A 3RYHB 1ZWZA 2OTLF 3F6MA 3QTYA 1W5BA 3ZP7A 3CCLF 2FGYA 4I4TA 5HWEA 4ZHQA 5JQGB 4YJ2B 5G4UC 2MQEA 2YXZA 2HS3A 2Q1YA 5KX5B 1ONIA 5CA0B 3HJWC 2KTUA 1QU9A 4X3MA 4BVRA 2Q1XA 4O4HB 2ZVZA 5EIBC 3WPXA 1JN1A 3L7QA 3ESJA 3S0YA 4TV8A 4C4WC 4X1KB 4X1IA 5EB0A 3GTZA 3Q8HA 4X20A 4I50A 2BTUA 4ZI7B 3HKEB 1FNKA 1TUBA 3QHDA 3CB2A 4C81A 3VTIC 3I7TA 3MQWA 2HX0A 5CB4B 4E6EA 2DT4A 2CHTA 5GONB 1VH8A 2I6RA 4BT6A 3RYCA 2ALEA 1YHQF 1FNJA 1YGYA 1K9MH 2RHLA 5LYJA 1Q86H 4IIJA 5C8YB 2HP0B 2N48A 5LP6A 3HKBB 1IV1A 2NMUA 2W8BC 4BVTA 3JAWA 3WXMB 1UFYA 3RYFB 3FFMA 4DRXB 2G9IA 3HWUA 4TV9A 4X1YB 2Z1EA 5J2UB 4ZHWA 3VIUA 1CLIA 4LNUA 1H48A 3RA6A 1GO1A 3S0HA 5LOVB 4EI7A 3JARB 5GAPK 2VAMA 2CHSA 4B45A 1Q82H 4ZOLB 5IJ9A 3LFOA 3VMFB 4U3JA 4DXDA 3CCVF 1QAHA 5IYZB 3J7AR 1W55A 2AIFA 3B6NA 3CG6A 4O2BA 3CYPB 5HP7A 1T0KB 3VYSC 3FD6A 2HS4A 2GLZA 2Z1TA 3JASB 2H8EA 4EB6B 4G88A 4F6RB 1SA0B 3RE3A 3UT5B 5JVDB 5EZYB 2ZVYA 2JNBA 3JALB 4G4XA 4ERHA 1JD1A 2AIZP 4C8GA 1XBIA 5CA1B 4I4TB 3V7QA 3VYTC 5LXTA 4G4WA 1YQNA 2QI2A 2EWCA 1GZ0A 3JATA 1RLGA 4B5CA 4C82A 2QEXF 3JAMM 2Z01A 5J2TB 1RQ7A 1Q81H 4HNAA 3KE1A 3NMUC 1YI2F 2LBWA 5GANK 1W57A 5BMVA 3LWPC 5EWRA 3CCQF 1W3EX 2HS0A 4O2AB 2FC3A 4BT4A 4X1IB 5JCOA 2LBXA 3DC2A 3KJKA 3WPWA 4BVSA 2QTPA 4BY9D 2PMPA 4R40B 3F0GA 4X20B 3WGKA 3LWVC 4I50B 1YJNF 3CYQA 3C9RA 1NJIH 2HVYD 1TUBB 3IKFA 3CC7F 3CCEF 1KQSF 3OBWA 2IQQA 3N2GA 5FJ4C 1M90H 4NWOB 4WBNA 4O4LA 3K14A 4X3LA 5LYJB 3J81M 4IHJB 2KG4A 3OW2F 4IIJB 2IAFA 2VGMA 3VYUC 1VQVA 1YITF 3ZP4A 3K0TA 2KGWA 3K12A 5ITZA 1CN7A 3AGKA 3NK6A 3NK7A 4NQ3A 5HY4A 5A2QM 3GHZA 3CCJF 2I6DA 3FPIA 2CSLA 1UI9A 1SZQA 1RQ2A 4YJ3B 3UT5A 3SIVA 4LNUB 2RHOA 3G6EF 3N2KA 2CZWA 5G4VC 4RHAA 4TUYA 4KWEA 3JCMM 5HY0A 3RYHA 2RB9A 5IJ9B 4U3JB 3CD6F 5KMGA 4EI9A 1VQKF 3HKCA 5HXZA 4O2BB 1KNJA 1H47A 3ZOPA 1VQ4F 2UYKA 3CMAF 1W581 1OAPA 4RQOA 4C8IA 3F0DA 1PXWA 3CXCF 3F0FA 1RLUA 2GZLA 2UYNA 3I56F 1KC8H 1X52A 1JJ2F 4X1KA 3LWRC 3LDTA 1N8RH 2VXYA 1VQ9F 1S72F 5LXTB 1U43A 4BT7A 1W59A 1VQMF 2HP3A 2Z1UA 1DBFA 1JFFA 3C9SA 1U40A 1PF5A 3JATB 5JCOC 1VQ6F 3I55F 3C9TA 1NQ3A 1IPAA 1JY8A 4TZZA 3IKEA 2B33A 4HNAB 3MBMA 4XCQA 3FD5A 5IJ0B 5EIBD 4BT2A 5BMVB 5GONA 1YJWF 2CVLA 4BT3A 1W5AA 2ZODA 2VAPA 3RYIA 3S06A 4BT5A 2HQSC 3TD5A 2GVIA 3ZO8A 4ZHQB 3KHNA 1M1KH 1X7OA 5LA6A 3D01A 5MN6A 3IR9A 2QA4F 3R0PA 4O4IA 4BW0B 3E20B 3VI6A 1KD1H 3KJJA 2ZOVA 3N2GB 5HP8A 4O4LB 1W5FA 3CMEF 4PWTA 2YYEA 4U39A 3JVHA 4TV8B 3K2XA 3OONA 1J7HA 1TVKA 1XV2A 5JH7A 3IMPA 3E22A 3WJRA 4NUTA 4ZOLA 2UZHA 3P0ZA 3MDOA 5ITZB 2OTMA 2RHJA 1CK2A 5AVMA 3FBAA 4B62A 3CC4F 4FFBA 1Z5VA 1K73H 1X25A 1K8AH 1FFXA 5LP6C 1W2BF 3HTNA 3WJQA 1XRGA 3JAKA 2K1SA 1QVFF 2PHNA 5FNVA 3N2KB 1YJ9F 3S02A 1OFUA 3RYCB 3CC2F 2V9YA 5EZYA 4G4ZA 4TUYB 3JALA 1QD9A 3IEQA 3M84A 3PLAC 3CCUF 3NVIB 5LP6B 4I55A 2UYPA 4G4YA 5KMGB 3CPWF 1Q7YH 3HKCB 2OZBA 1QVGF 3TD3A 3S0WA 3CCRF 4ZHVA 3TD4A 2BTOA 3JAWB 3N4ZA 5FLXM 3C9UA 2UYJA 4C8EA 2OHWA 3VOAA 3F0EA 5J2TA 2VGNA 4TV9B 3N4YA 2CW4A 5HY2A 5EYPA 1SDSA 3O85A 2UYNB 1IV2A 3P10A 4O2AA 4O4JA 3HKDA 2WALA 3D54A 3M4SA 5B8FA 1U3PA 4ZHYB 3J80M 3QUWA 1W41A 1JFFB 2LCAA 3ERNA 5JQGA 2VAWA 4YJ2A 2KTVA 1VQNF 3LWQC 5MN4A 1VHAA 5KX5A 1X7PA 1R1MA 3WGJA 1U3LA 5GIPC 5CA0A 2R751 3WGMA 4O4HA 3M1XA 1VQ8F 5HY1A 2P6YA 5EO3A 5HXUA 3KIZA 3BYQA 3CCSF 2H6LA 5GIOC 4IHJA 1ODEA 3PAFA 3RYIB 3NVKE 1IV4A 5LA6B 3T80A 2RHHA 5DCVA 3P4EA 3LYBA 1XHOA 4O4IB 2HRYA 2OTJF 2HRUA 1RA4A 2IG8A 3G71F 4ZI7A 1GX1A 3HKEA 5GINC 3CCMF 2CWJA 5EAZA 4G4VA 4YJ3A 1E7KA 3E1YA 5CB4A 3I3FA 1VK3A 3LMEA 2ZAUA 1TVKB 5JH7B 3D00A 4B46A 3E22B 4LCKA 2F9ZC 1W40A 5C8YA 2HP0A 1Z5WA 3WGNA 4ZK7A 4M8IA 3HKBA 1GO0A 1VQLF 3RA5A 4FFBB 3DDNA 2DYYA 1COMA 1FFXB 1W42A 3RYFA 3VO8A 1VQ5F 5MN5A 3MCQA 3JAKB 3IEWA 3U0OA 3WGLA 1FSZA 1VQPF 1KNKA 3GYQA 4DRXA 5FNVB 4WBNB 1T0AA 4X1YA 2Z1FA 5J2UA 3HAXD 3V3TA 1Q8RA 1VQ7F 5LOVA 4I55B 1NMUB 3SIUA 3JARA 3G4SF 3S03A 4BVQA 4EI8A 2R6R1 3ELCA 3ON1A 3V4DA 3CPQA 5IYZA 2LBTA 1IV3A 3VCZA 3WJPA 2H8CA 2L26A 1VQOF 3OBYA 1YIJF 3C8LA 1DT9A 3JASA 5EYPB 2BO1A 2AMTA 5EB1B 4EB6A 5IJ0A 4F6RA 1SA0A 1W5EA 3LWOC 1H7MA 4O4JB 5IT9M 3HKDB 3MCAB 3V7EA
chains in the Genus database with same CATH topology
4G4ZA 4G4XA 4ERHA 3S0YA 2AIZP 3OONA 3S0HA 4RHAA 3IMPA 3LDTA 2ZF8A 5EB0A 2N48A 4G4YA 3WPWA 3S03A 4ZHYB 4R40B 3S06A 2LCAA 2HQSC 3TD5A 4G4WA 2KGWA 2W8BC 3KHNA 3TD3A 3S0WA 3CYQA 4B62A 4ZHVA 3TD4A 3CYPB 4B5CA 2LBTA 2MQEA 2ZOVA 2L26A 1OAPA 1R1MA 4G88A 5EAZA 4G4VA 5EB1B 2K1SA 2ZVZA 4PWTA 4ZHWA 3WPXA 3S02A 2ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4Z A;  4G4X A;  4ERH A;  3S0Y A;  2AIZ P;  3OON A;  3S0H A;  4RHA A;  3IMP A;  3LDT A;  2ZF8 A;  5EB0 A;  2N48 A;  4G4Y A;  3WPW A;  3S03 A;  4ZHY B;  4R40 B;  3S06 A;  2LCA A;  2HQS C;  3TD5 A;  4G4W A;  2KGW A;  2W8B C;  3KHN A;  3TD3 A;  3S0W A;  3CYQ A;  4B62 A;  4ZHV A;  3TD4 A;  3CYP B;  4B5C A;  2LBT A;  2MQE A;  2ZOV A;  2L26 A;  1OAP A;  1R1M A;  4G88 A;  5EAZ A;  4G4V A;  5EB1 B;  2K1S A;  2ZVZ A;  4PWT A;  4ZHW A;  3WPX A;  3S02 A;  2ZVY A; 
#chains in the Genus database with same CATH topology
 5JVD A;  3VOB A;  2BTQ B;  3EOR A;  5CA1 A;  2ZF8 A;  3RYH B;  1ZWZ A;  2OTL F;  3F6M A;  3QTY A;  1W5B A;  3ZP7 A;  3CCL F;  2FGY A;  4I4T A;  5HWE A;  4ZHQ A;  5JQG B;  4YJ2 B;  5G4U C;  2MQE A;  2YXZ A;  2HS3 A;  2Q1Y A;  5KX5 B;  1ONI A;  5CA0 B;  3HJW C;  2KTU A;  1QU9 A;  4X3M A;  4BVR A;  2Q1X A;  4O4H B;  2ZVZ A;  5EIB C;  3WPX A;  1JN1 A;  3L7Q A;  3ESJ A;  3S0Y A;  4TV8 A;  4C4W C;  4X1K B;  4X1I A;  5EB0 A;  3GTZ A;  3Q8H A;  4X20 A;  4I50 A;  2BTU A;  4ZI7 B;  3HKE B;  1FNK A;  1TUB A;  3QHD A;  3CB2 A;  4C81 A;  3VTI C;  3I7T A;  3MQW A;  2HX0 A;  5CB4 B;  4E6E A;  2DT4 A;  2CHT A;  5GON B;  1VH8 A;  2I6R A;  4BT6 A;  3RYC A;  2ALE A;  1YHQ F;  1FNJ A;  1YGY A;  1K9M H;  2RHL A;  5LYJ A;  1Q86 H;  4IIJ A;  5C8Y B;  2HP0 B;  2N48 A;  5LP6 A;  3HKB B;  1IV1 A;  2NMU A;  2W8B C;  4BVT A;  3JAW A;  3WXM B;  1UFY A;  3RYF B;  3FFM A;  4DRX B;  2G9I A;  3HWU A;  4TV9 A;  4X1Y B;  2Z1E A;  5J2U B;  4ZHW A;  3VIU A;  1CLI A;  4LNU A;  1H48 A;  3RA6 A;  1GO1 A;  3S0H A;  5LOV B;  4EI7 A;  3JAR B;  5GAP K;  2VAM A;  2CHS A;  4B45 A;  1Q82 H;  4ZOL B;  5IJ9 A;  3LFO A;  3VMF B;  4U3J A;  4DXD A;  3CCV F;  1QAH A;  5IYZ B;  3J7A R;  1W55 A;  2AIF A;  3B6N A;  3CG6 A;  4O2B A;  3CYP B;  5HP7 A;  1T0K B;  3VYS C;  3FD6 A;  2HS4 A;  2GLZ A;  2Z1T A;  3JAS B;  2H8E A;  4EB6 B;  4G88 A;  4F6R B;  1SA0 B;  3RE3 A;  3UT5 B;  5JVD B;  5EZY B;  2ZVY A;  2JNB A;  3JAL B;  4G4X A;  4ERH A;  1JD1 A;  2AIZ P;  4C8G A;  1XBI A;  5CA1 B;  4I4T B;  3V7Q A;  3VYT C;  5LXT A;  4G4W A;  1YQN A;  2QI2 A;  2EWC A;  1GZ0 A;  3JAT A;  1RLG A;  4B5C A;  4C82 A;  2QEX F;  3JAM M;  2Z01 A;  5J2T B;  1RQ7 A;  1Q81 H;  4HNA A;  3KE1 A;  3NMU C;  1YI2 F;  2LBW A;  5GAN K;  1W57 A;  5BMV A;  3LWP C;  5EWR A;  3CCQ F;  1W3E X;  2HS0 A;  4O2A B;  2FC3 A;  4BT4 A;  4X1I B;  5JCO A;  2LBX A;  3DC2 A;  3KJK A;  3WPW A;  4BVS A;  2QTP A;  4BY9 D;  2PMP A;  4R40 B;  3F0G A;  4X20 B;  3WGK A;  3LWV C;  4I50 B;  1YJN F;  3CYQ A;  3C9R A;  1NJI H;  2HVY D;  1TUB B;  3IKF A;  3CC7 F;  3CCE F;  1KQS F;  3OBW A;  2IQQ A;  3N2G A;  5FJ4 C;  1M90 H;  4NWO B;  4WBN A;  4O4L A;  3K14 A;  4X3L A;  5LYJ B;  3J81 M;  4IHJ B;  2KG4 A;  3OW2 F;  4IIJ B;  2IAF A;  2VGM A;  3VYU C;  1VQV A;  1YIT F;  3ZP4 A;  3K0T A;  2KGW A;  3K12 A;  5ITZ A;  1CN7 A;  3AGK A;  3NK6 A;  3NK7 A;  4NQ3 A;  5HY4 A;  5A2Q M;  3GHZ A;  3CCJ F;  2I6D A;  3FPI A;  2CSL A;  1UI9 A;  1SZQ A;  1RQ2 A;  4YJ3 B;  3UT5 A;  3SIV A;  4LNU B;  2RHO A;  3G6E F;  3N2K A;  2CZW A;  5G4V C;  4RHA A;  4TUY A;  4KWE A;  3JCM M;  5HY0 A;  3RYH A;  2RB9 A;  5IJ9 B;  4U3J B;  3CD6 F;  5KMG A;  4EI9 A;  1VQK F;  3HKC A;  5HXZ A;  4O2B B;  1KNJ A;  1H47 A;  3ZOP A;  1VQ4 F;  2UYK A;  3CMA F;  1W58 1;  1OAP A;  4RQO A;  4C8I A;  3F0D A;  1PXW A;  3CXC F;  3F0F A;  1RLU A;  2GZL A;  2UYN A;  3I56 F;  1KC8 H;  1X52 A;  1JJ2 F;  4X1K A;  3LWR C;  3LDT A;  1N8R H;  2VXY A;  1VQ9 F;  1S72 F;  5LXT B;  1U43 A;  4BT7 A;  1W59 A;  1VQM F;  2HP3 A;  2Z1U A;  1DBF A;  1JFF A;  3C9S A;  1U40 A;  1PF5 A;  3JAT B;  5JCO C;  1VQ6 F;  3I55 F;  3C9T A;  1NQ3 A;  1IPA A;  1JY8 A;  4TZZ A;  3IKE A;  2B33 A;  4HNA B;  3MBM A;  4XCQ A;  3FD5 A;  5IJ0 B;  5EIB D;  4BT2 A;  5BMV B;  5GON A;  1YJW F;  2CVL A;  4BT3 A;  1W5A A;  2ZOD A;  2VAP A;  3RYI A;  3S06 A;  4BT5 A;  2HQS C;  3TD5 A;  2GVI A;  3ZO8 A;  4ZHQ B;  3KHN A;  1M1K H;  1X7O A;  5LA6 A;  3D01 A;  5MN6 A;  3IR9 A;  2QA4 F;  3R0P A;  4O4I A;  4BW0 B;  3E20 B;  3VI6 A;  1KD1 H;  3KJJ A;  2ZOV A;  3N2G B;  5HP8 A;  4O4L B;  1W5F A;  3CME F;  4PWT A;  2YYE A;  4U39 A;  3JVH A;  4TV8 B;  3K2X A;  3OON A;  1J7H A;  1TVK A;  1XV2 A;  5JH7 A;  3IMP A;  3E22 A;  3WJR A;  4NUT A;  4ZOL A;  2UZH A;  3P0Z A;  3MDO A;  5ITZ B;  2OTM A;  2RHJ A;  1CK2 A;  5AVM A;  3FBA A;  4B62 A;  3CC4 F;  4FFB A;  1Z5V A;  1K73 H;  1X25 A;  1K8A H;  1FFX A;  5LP6 C;  1W2B F;  3HTN A;  3WJQ A;  1XRG A;  3JAK A;  2K1S A;  1QVF F;  2PHN A;  5FNV A;  3N2K B;  1YJ9 F;  3S02 A;  1OFU A;  3RYC B;  3CC2 F;  2V9Y A;  5EZY A;  4G4Z A;  4TUY B;  3JAL A;  1QD9 A;  3IEQ A;  3M84 A;  3PLA C;  3CCU F;  3NVI B;  5LP6 B;  4I55 A;  2UYP A;  4G4Y A;  5KMG B;  3CPW F;  1Q7Y H;  3HKC B;  2OZB A;  1QVG F;  3TD3 A;  3S0W A;  3CCR F;  4ZHV A;  3TD4 A;  2BTO A;  3JAW B;  3N4Z A;  5FLX M;  3C9U A;  2UYJ A;  4C8E A;  2OHW A;  3VOA A;  3F0E A;  5J2T A;  2VGN A;  4TV9 B;  3N4Y A;  2CW4 A;  5HY2 A;  5EYP A;  1SDS A;  3O85 A;  2UYN B;  1IV2 A;  3P10 A;  4O2A A;  4O4J A;  3HKD A;  2WAL A;  3D54 A;  3M4S A;  5B8F A;  1U3P A;  4ZHY B;  3J80 M;  3QUW A;  1W41 A;  1JFF B;  2LCA A;  3ERN A;  5JQG A;  2VAW A;  4YJ2 A;  2KTV A;  1VQN F;  3LWQ C;  5MN4 A;  1VHA A;  5KX5 A;  1X7P A;  1R1M A;  3WGJ A;  1U3L A;  5GIP C;  5CA0 A;  2R75 1;  3WGM A;  4O4H A;  3M1X A;  1VQ8 F;  5HY1 A;  2P6Y A;  5EO3 A;  5HXU A;  3KIZ A;  3BYQ A;  3CCS F;  2H6L A;  5GIO C;  4IHJ A;  1ODE A;  3PAF A;  3RYI B;  3NVK E;  1IV4 A;  5LA6 B;  3T80 A;  2RHH A;  5DCV A;  3P4E A;  3LYB A;  1XHO A;  4O4I B;  2HRY A;  2OTJ F;  2HRU A;  1RA4 A;  2IG8 A;  3G71 F;  4ZI7 A;  1GX1 A;  3HKE A;  5GIN C;  3CCM F;  2CWJ A;  5EAZ A;  4G4V A;  4YJ3 A;  1E7K A;  3E1Y A;  5CB4 A;  3I3F A;  1VK3 A;  3LME A;  2ZAU A;  1TVK B;  5JH7 B;  3D00 A;  4B46 A;  3E22 B;  4LCK A;  2F9Z C;  1W40 A;  5C8Y A;  2HP0 A;  1Z5W A;  3WGN A;  4ZK7 A;  4M8I A;  3HKB A;  1GO0 A;  1VQL F;  3RA5 A;  4FFB B;  3DDN A;  2DYY A;  1COM A;  1FFX B;  1W42 A;  3RYF A;  3VO8 A;  1VQ5 F;  5MN5 A;  3MCQ A;  3JAK B;  3IEW A;  3U0O A;  3WGL A;  1FSZ A;  1VQP F;  1KNK A;  3GYQ A;  4DRX A;  5FNV B;  4WBN B;  1T0A A;  4X1Y A;  2Z1F A;  5J2U A;  3HAX D;  3V3T A;  1Q8R A;  1VQ7 F;  5LOV A;  4I55 B;  1NMU B;  3SIU A;  3JAR A;  3G4S F;  3S03 A;  4BVQ A;  4EI8 A;  2R6R 1;  3ELC A;  3ON1 A;  3V4D A;  3CPQ A;  5IYZ A;  2LBT A;  1IV3 A;  3VCZ A;  3WJP A;  2H8C A;  2L26 A;  1VQO F;  3OBY A;  1YIJ F;  3C8L A;  1DT9 A;  3JAS A;  5EYP B;  2BO1 A;  2AMT A;  5EB1 B;  4EB6 A;  5IJ0 A;  4F6R A;  1SA0 A;  1W5E A;  3LWO C;  1H7M A;  4O4J B;  5IT9 M;  3HKD B;  3MCA B;  3V7E A; 
#chains in the Genus database with same CATH homology
 4G4Z A;  4G4X A;  4ERH A;  3S0Y A;  2AIZ P;  3OON A;  3S0H A;  4RHA A;  3IMP A;  3LDT A;  2ZF8 A;  5EB0 A;  2N48 A;  4G4Y A;  3WPW A;  3S03 A;  4ZHY B;  4R40 B;  3S06 A;  2LCA A;  2HQS C;  3TD5 A;  4G4W A;  2KGW A;  2W8B C;  3KHN A;  3TD3 A;  3S0W A;  3CYQ A;  4B62 A;  4ZHV A;  3TD4 A;  3CYP B;  4B5C A;  2LBT A;  2MQE A;  2ZOV A;  2L26 A;  1OAP A;  1R1M A;  4G88 A;  5EAZ A;  4G4V A;  5EB1 B;  2K1S A;  2ZVZ A;  4PWT A;  4ZHW A;  3WPX A;  3S02 A;  2ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...