3CYPB

The crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256).
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
129
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Crystal structure of the cell wall anchor domain of MotB, a stator component of the bacterial flagellar motor: implications for peptidoglycan recognition.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 44
structure length 129
sequence length 133
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2008-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3cypB00
3CYQA 3S0WA 5EB1B 1R1MA 4RHAA 3TD5A 3S0YA 4B5CA 3TD4A 3S02A 2AIZP 2MQEA 4PWTA 2HQSC 2K1SA 2LBTA 4G4ZA 4ZHWA 3S03A 4B62A 3OONA 5EAZA 5EB0A 4ERHA 3S0HA 3TD3A 2ZVYA 3WPXA 4G88A 2W8BC 3LDTA 2KGWA 3WPWA 2LCAA 2ZOVA 2ZVZA 4G4VA 3S06A 4ZHYB 4R40B 2ZF8A 4ZHVA 3KHNA 3CYPB 2N48A 4G4YA 4G4XA 2L26A 1OAPA 3IMPA 4G4WA
chains in the Genus database with same CATH superfamily
4C8EA 3S0WA 3LWVC 3VOAA 1YHQF 4B46A 4B45A 5C8YB 3P0ZA 3TD4A 4IIJB 2CWJA 3CCQF 3GYQA 4G4ZA 1K8AH 4B62A 5LXTA 4ERHA 3S0HA 2QTPA 4EI7A 3ON1A 1T0AA 2LCAA 1KNJA 4FFBA 2GVIA 1VQ6F 5EO3A 5AVMA 5LA6B 2H8CA 2CZWA 1Q81H 1Z5WA 4BVTA 3JASA 1VQVA 3CCLF 2UYNA 3CXCF 5LP6C 5GIPC 4BVQA 3VTIC 3N2KB 1M90H 1GO0A 2VAWA 3N2GB 3OONA 3LWPC 3RE3A 3WPXA 4LCKA 4O2BB 1N8RH 4E6EA 2UYJA 4O4LB 5HY1A 1NMUB 2KTVA 2RB9A 1U40A 3MCAB 5LP6B 3P10A 1Z5VA 5JVDB 4ZHVA 5HY2A 2Z1EA 1W5AA 4O2AA 1CK2A 2BTQB 1QU9A 4TV8A 2LBWA 5IT9M 1OAPA 3CPWF 5CA1A 4U39A 4NWOB 4WBNB 1T0KB 1U3LA 5EYPA 2OHWA 4X20B 4C81A 3RYFB 2HP3A 2R751 4BVSA 1XBIA 3ZP4A 3VMFB 5HY4A 1W581 5KMGA 1H7MA 1RQ2A 1NQ3A 1SA0A 4X1YA 5EWRA 3WPWA 5GONA 4ZI7B 1W57A 2Z1UA 1GO1A 3LFOA 1FSZA 4I4TA 3C9UA 2ZF8A 4I50A 4LNUB 1GZ0A 4G4XA 2I6DA 4DRXA 3CB2A 4I55A 1VK3A 4EB6A 5GINC 1YJWF 3F6MA 2RHJA 2HRYA 1VQ5F 4BVRA 3FD5A 4BW0B 3F0FA 2HQSC 2LBTA 3I7TA 3C9TA 3FD6A 5CB4B 3HAXD 1RLUA 3D01A 3M1XA 5LXTB 4ZHQA 2VAMA 1J7HA 2VXYA 5LOVA 1YGYA 4FFBB 3CCRF 1W2BF 3RYIA 2DT4A 3MCQA 5J2UA 1VQOF 2VAPA 1VQMF 1W5BA 3JAWA 1K73H 3F0DA 1KD1H 4O4JB 3WGLA 2QA4F 3JASB 4IHJA 3E1YA 5JH7B 2HP0A 5J2TB 3WGNA 2ALEA 2UYNB 1CLIA 3LMEA 4TV9A 3IEQA 5BMVB 5EAZA 1XRGA 2FGYA 4X1KA 3E22A 5HY0A 1S72F 3CG6A 2RHOA 3FPIA 1K9MH 2Z01A 3QTYA 3JATB 4G4VA 5MN5A 4C82A 2HX0A 5HP7A 1OFUA 3CMEF 3GHZA 3QUWA 2ZODA 3CYQA 3JCMM 3ZOPA 5EB1B 1R1MA 4RHAA 5KX5A 1YITF 2HVYD 3F0EA 4YJ2A 1UI9A 5EYPB 4C8GA 1GX1A 3HKEA 1JJ2F 3ZO8A 5EB0A 1Q82H 3TD3A 1Q8RA 1VQKF 1X25A 1FNKA 5GAPK 3UT5A 4DXDA 1SA0B 4X1YB 4BT2A 1DT9A 2IG8A 3CYPB 3RYCA 1X7PA 5HXUA 2FC3A 4I4TB 2KTUA 3WGMA 4I50B 4G4WA 1JD1A 1UFYA 3M84A 3J80M 3PAFA 2DYYA 2AIZP 4I55B 4EB6B 1VQLF 3WJRA 2RHHA 1W40A 3JAKA 3WJPA 2YXZA 3HKBA 3IR9A 4C8IA 3T80A 3D00A 3D54A 2UYKA 4ZHQB 1H48A 1W59A 1W42A 5MN4A 1W5EA 4F6RA 5FJ4C 3RYIB 1CN7A 5J2UB 3KJKA 1VHAA 3WXMB 4KWEA 2CW4A 4YJ3A 3JAWB 2Z1FA 2K1SA 5EIBD 4IHJB 3LWRC 3SIUA 2HP0B 2LBXA 2R6R1 4TV9B 3OBYA 4EI8A 1TUBA 3DC2A 2AMTA 4X1KB 3E22B 5IJ9B 3G71F 1H47A 5EZYA 3VYTC 4X3LA 3V7EA 1VQ8F 4G4YA 1RLGA 3SIVA 2GZLA 4IIJA 4HNAA 4O4HA 2OTMA 3OW2F 1IPAA 1VH8A 3HKCA 1U43A 2H8EA 2YYEA 3NK6A 5KX5B 3S02A 5LYJA 4XCQA 4YJ2B 1DBFA 4ZHWA 3K0TA 3MQWA 5EIBC 2ZVYA 1QVGF 5LA6A 3HKEB 4U3JA 2W8BC 4ZOLA 5JQGA 2ZOVA 3E20B 1YJNF 1JN1A 4TZZA 2JNBA 3I55F 3GTZA 3CCEF 3K2XA 3HKDA 3IMPA 2UYPA 1IV1A 2OTLF 3I56F 4BT6A 3CC2F 3HWUA 4BY9D 3N2GA 2NMUA 3VCZA 3KJJA 3CC7F 3G6EF 3G4SF 3KIZA 1XV2A 4PWTA 3S03A 4O4LA 3NVIB 4X1IA 1KQSF 5LP6A 3HJWC 5IJ0A 1RA4A 3EORA 3C9RA 3IKEA 4M8IA 3ZP7A 2UZHA 3BYQA 3HKBB 4WBNA 2B33A 3CCSF 3J81M 3KHNA 3RA6A 4C4WC 3RYFA 3IKFA 4TUYA 3N4YA 2CVLA 3C8LA 4O2AB 3P4EA 2V9YA 1YI2F 4TV8B 2PMPA 3I3FA 4O4IA 3U0OA 3DDNA 5CA1B 2HS3A 3JVHA 5GIOC 4YJ3B 3NVKE 3WGKA 5GANK 5KMGB 1X7OA 3R0PA 3MBMA 3N4ZA 1W55A 1TUBB 1PF5A 5GONB 2L26A 1YIJF 5EZYB 2CHSA 1W3EX 3JALA 3PLAC 5FNVA 4B5CA 5CB4A 1VQ4F 4DRXB 3MDOA 3CCVF 5HXZA 4HNAB 4O4HB 2HRUA 1FNJA 3HKCB 3JAMM 2QEXF 3ESJA 5LYJB 1W41A 1XHOA 1SDSA 5CA0A 1TVKA 3B6NA 2Q1YA 3K14A 2HS0A 3LDTA 1KNKA 4X3MA 1RQ7A 2AIFA 1VQ9F 2RHLA 4U3JB 4ZOLB 5JQGB 3JARA 1IV3A 4NQ3A 4O4JA 3VOBA 3HKDB 5LOVB 3RA5A 5ITZA 5MN6A 5JH7A 5J2TA 3FBAA 5BMVA 1JFFA 1M1KH 2WALA 1FFXA 2P6YA 3IEWA 1QAHA 2CSLA 1YJ9F 1Q7YH 3WGJA 1IV2A 1ODEA 2ZAUA 3JATA 2IQQA 2HS4A 4BT3A 5IYZA 3RYHA 5G4VC 5JCOA 3V4DA 2KGWA 3L7QA 4X1IB 1VQPF 3CCUF 3S06A 3FFMA 4ZK7A 4ZHYB 5IJ0B 2KG4A 2N48A 3VYUC 3V3TA 5C8YA 3VYSC 4TUYB 1X52A 3AGKA 4BT4A 1W5FA 3TD5A 1E7KA 3J7AR 2GLZA 2Q1XA 2BO1A 1IV4A 4O4IB 3VIUA 3CCMF 2EWCA 4R40B 5FLXM 2F9ZC 3UT5B 1YQNA 3VI6A 3CC4F 5A2QM 1Q86H 3N2KA 1QVFF 3RYCB 3KE1A 3JALB 3CPQA 3LWOC 2OZBA 1VQ7F 3LWQC 2PHNA 4O2BA 5FNVB 4EI9A 3ELCA 3ERNA 3M4SA 3OBWA 4G88A 3C9SA 5JVDA 2ZVZA 5B8FA 3JAKB 1KC8H 3WJQA 3LYBA 5CA0B 1TVKB 3QHDA 3HTNA 4X20A 3K12A 1JY8A 3JARB 1SZQA 3Q8HA 2G9IA 2CHTA 1NJIH 2IAFA 1PXWA 5JCOC 3NK7A 3S0YA 1ZWZA 5ITZB 4BT5A 3V7QA 2MQEA 4F6RB 1JFFB 2I6RA 3O85A 1FFXB 3VO8A 3CD6F 4NUTA 2QI2A 5DCVA 3CCJF 2VGMA 4ZI7A 5IJ9A 2BTOA 2BTUA 4BT7A 1QD9A 3CMAF 4LNUA 5IYZB 2H6LA 1ONIA 3RYHB 4RQOA 1COMA 5HWEA 3F0GA 5G4UC 2Z1TA 1VQNF 1U3PA 5HP8A 2OTJF 3NMUC 2VGNA
chains in the Genus database with same CATH topology
3CYQA 3S0WA 5EB1B 1R1MA 4RHAA 3TD5A 3S0YA 4B5CA 3TD4A 3S02A 2AIZP 2MQEA 4PWTA 2HQSC 2K1SA 2LBTA 4G4ZA 4ZHWA 3S03A 4B62A 3OONA 5EAZA 5EB0A 4ERHA 3S0HA 3TD3A 2ZVYA 3WPXA 4G88A 2W8BC 3LDTA 2KGWA 3WPWA 2LCAA 2ZOVA 2ZVZA 4G4VA 3S06A 4ZHYB 4R40B 2ZF8A 4ZHVA 3KHNA 3CYPB 2N48A 4G4YA 4G4XA 2L26A 1OAPA 3IMPA 4G4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYQ A;  3S0W A;  5EB1 B;  1R1M A;  4RHA A;  3TD5 A;  3S0Y A;  4B5C A;  3TD4 A;  3S02 A;  2AIZ P;  2MQE A;  4PWT A;  2HQS C;  2K1S A;  2LBT A;  4G4Z A;  4ZHW A;  3S03 A;  4B62 A;  3OON A;  5EAZ A;  5EB0 A;  4ERH A;  3S0H A;  3TD3 A;  2ZVY A;  3WPX A;  4G88 A;  2W8B C;  3LDT A;  2KGW A;  3WPW A;  2LCA A;  2ZOV A;  2ZVZ A;  4G4V A;  3S06 A;  4ZHY B;  4R40 B;  2ZF8 A;  4ZHV A;  3KHN A;  3CYP B;  2N48 A;  4G4Y A;  4G4X A;  2L26 A;  1OAP A;  3IMP A;  4G4W A; 
#chains in the Genus database with same CATH topology
 4C8E A;  3S0W A;  3LWV C;  3VOA A;  1YHQ F;  4B46 A;  4B45 A;  5C8Y B;  3P0Z A;  3TD4 A;  4IIJ B;  2CWJ A;  3CCQ F;  3GYQ A;  4G4Z A;  1K8A H;  4B62 A;  5LXT A;  4ERH A;  3S0H A;  2QTP A;  4EI7 A;  3ON1 A;  1T0A A;  2LCA A;  1KNJ A;  4FFB A;  2GVI A;  1VQ6 F;  5EO3 A;  5AVM A;  5LA6 B;  2H8C A;  2CZW A;  1Q81 H;  1Z5W A;  4BVT A;  3JAS A;  1VQV A;  3CCL F;  2UYN A;  3CXC F;  5LP6 C;  5GIP C;  4BVQ A;  3VTI C;  3N2K B;  1M90 H;  1GO0 A;  2VAW A;  3N2G B;  3OON A;  3LWP C;  3RE3 A;  3WPX A;  4LCK A;  4O2B B;  1N8R H;  4E6E A;  2UYJ A;  4O4L B;  5HY1 A;  1NMU B;  2KTV A;  2RB9 A;  1U40 A;  3MCA B;  5LP6 B;  3P10 A;  1Z5V A;  5JVD B;  4ZHV A;  5HY2 A;  2Z1E A;  1W5A A;  4O2A A;  1CK2 A;  2BTQ B;  1QU9 A;  4TV8 A;  2LBW A;  5IT9 M;  1OAP A;  3CPW F;  5CA1 A;  4U39 A;  4NWO B;  4WBN B;  1T0K B;  1U3L A;  5EYP A;  2OHW A;  4X20 B;  4C81 A;  3RYF B;  2HP3 A;  2R75 1;  4BVS A;  1XBI A;  3ZP4 A;  3VMF B;  5HY4 A;  1W58 1;  5KMG A;  1H7M A;  1RQ2 A;  1NQ3 A;  1SA0 A;  4X1Y A;  5EWR A;  3WPW A;  5GON A;  4ZI7 B;  1W57 A;  2Z1U A;  1GO1 A;  3LFO A;  1FSZ A;  4I4T A;  3C9U A;  2ZF8 A;  4I50 A;  4LNU B;  1GZ0 A;  4G4X A;  2I6D A;  4DRX A;  3CB2 A;  4I55 A;  1VK3 A;  4EB6 A;  5GIN C;  1YJW F;  3F6M A;  2RHJ A;  2HRY A;  1VQ5 F;  4BVR A;  3FD5 A;  4BW0 B;  3F0F A;  2HQS C;  2LBT A;  3I7T A;  3C9T A;  3FD6 A;  5CB4 B;  3HAX D;  1RLU A;  3D01 A;  3M1X A;  5LXT B;  4ZHQ A;  2VAM A;  1J7H A;  2VXY A;  5LOV A;  1YGY A;  4FFB B;  3CCR F;  1W2B F;  3RYI A;  2DT4 A;  3MCQ A;  5J2U A;  1VQO F;  2VAP A;  1VQM F;  1W5B A;  3JAW A;  1K73 H;  3F0D A;  1KD1 H;  4O4J B;  3WGL A;  2QA4 F;  3JAS B;  4IHJ A;  3E1Y A;  5JH7 B;  2HP0 A;  5J2T B;  3WGN A;  2ALE A;  2UYN B;  1CLI A;  3LME A;  4TV9 A;  3IEQ A;  5BMV B;  5EAZ A;  1XRG A;  2FGY A;  4X1K A;  3E22 A;  5HY0 A;  1S72 F;  3CG6 A;  2RHO A;  3FPI A;  1K9M H;  2Z01 A;  3QTY A;  3JAT B;  4G4V A;  5MN5 A;  4C82 A;  2HX0 A;  5HP7 A;  1OFU A;  3CME F;  3GHZ A;  3QUW A;  2ZOD A;  3CYQ A;  3JCM M;  3ZOP A;  5EB1 B;  1R1M A;  4RHA A;  5KX5 A;  1YIT F;  2HVY D;  3F0E A;  4YJ2 A;  1UI9 A;  5EYP B;  4C8G A;  1GX1 A;  3HKE A;  1JJ2 F;  3ZO8 A;  5EB0 A;  1Q82 H;  3TD3 A;  1Q8R A;  1VQK F;  1X25 A;  1FNK A;  5GAP K;  3UT5 A;  4DXD A;  1SA0 B;  4X1Y B;  4BT2 A;  1DT9 A;  2IG8 A;  3CYP B;  3RYC A;  1X7P A;  5HXU A;  2FC3 A;  4I4T B;  2KTU A;  3WGM A;  4I50 B;  4G4W A;  1JD1 A;  1UFY A;  3M84 A;  3J80 M;  3PAF A;  2DYY A;  2AIZ P;  4I55 B;  4EB6 B;  1VQL F;  3WJR A;  2RHH A;  1W40 A;  3JAK A;  3WJP A;  2YXZ A;  3HKB A;  3IR9 A;  4C8I A;  3T80 A;  3D00 A;  3D54 A;  2UYK A;  4ZHQ B;  1H48 A;  1W59 A;  1W42 A;  5MN4 A;  1W5E A;  4F6R A;  5FJ4 C;  3RYI B;  1CN7 A;  5J2U B;  3KJK A;  1VHA A;  3WXM B;  4KWE A;  2CW4 A;  4YJ3 A;  3JAW B;  2Z1F A;  2K1S A;  5EIB D;  4IHJ B;  3LWR C;  3SIU A;  2HP0 B;  2LBX A;  2R6R 1;  4TV9 B;  3OBY A;  4EI8 A;  1TUB A;  3DC2 A;  2AMT A;  4X1K B;  3E22 B;  5IJ9 B;  3G71 F;  1H47 A;  5EZY A;  3VYT C;  4X3L A;  3V7E A;  1VQ8 F;  4G4Y A;  1RLG A;  3SIV A;  2GZL A;  4IIJ A;  4HNA A;  4O4H A;  2OTM A;  3OW2 F;  1IPA A;  1VH8 A;  3HKC A;  1U43 A;  2H8E A;  2YYE A;  3NK6 A;  5KX5 B;  3S02 A;  5LYJ A;  4XCQ A;  4YJ2 B;  1DBF A;  4ZHW A;  3K0T A;  3MQW A;  5EIB C;  2ZVY A;  1QVG F;  5LA6 A;  3HKE B;  4U3J A;  2W8B C;  4ZOL A;  5JQG A;  2ZOV A;  3E20 B;  1YJN F;  1JN1 A;  4TZZ A;  2JNB A;  3I55 F;  3GTZ A;  3CCE F;  3K2X A;  3HKD A;  3IMP A;  2UYP A;  1IV1 A;  2OTL F;  3I56 F;  4BT6 A;  3CC2 F;  3HWU A;  4BY9 D;  3N2G A;  2NMU A;  3VCZ A;  3KJJ A;  3CC7 F;  3G6E F;  3G4S F;  3KIZ A;  1XV2 A;  4PWT A;  3S03 A;  4O4L A;  3NVI B;  4X1I A;  1KQS F;  5LP6 A;  3HJW C;  5IJ0 A;  1RA4 A;  3EOR A;  3C9R A;  3IKE A;  4M8I A;  3ZP7 A;  2UZH A;  3BYQ A;  3HKB B;  4WBN A;  2B33 A;  3CCS F;  3J81 M;  3KHN A;  3RA6 A;  4C4W C;  3RYF A;  3IKF A;  4TUY A;  3N4Y A;  2CVL A;  3C8L A;  4O2A B;  3P4E A;  2V9Y A;  1YI2 F;  4TV8 B;  2PMP A;  3I3F A;  4O4I A;  3U0O A;  3DDN A;  5CA1 B;  2HS3 A;  3JVH A;  5GIO C;  4YJ3 B;  3NVK E;  3WGK A;  5GAN K;  5KMG B;  1X7O A;  3R0P A;  3MBM A;  3N4Z A;  1W55 A;  1TUB B;  1PF5 A;  5GON B;  2L26 A;  1YIJ F;  5EZY B;  2CHS A;  1W3E X;  3JAL A;  3PLA C;  5FNV A;  4B5C A;  5CB4 A;  1VQ4 F;  4DRX B;  3MDO A;  3CCV F;  5HXZ A;  4HNA B;  4O4H B;  2HRU A;  1FNJ A;  3HKC B;  3JAM M;  2QEX F;  3ESJ A;  5LYJ B;  1W41 A;  1XHO A;  1SDS A;  5CA0 A;  1TVK A;  3B6N A;  2Q1Y A;  3K14 A;  2HS0 A;  3LDT A;  1KNK A;  4X3M A;  1RQ7 A;  2AIF A;  1VQ9 F;  2RHL A;  4U3J B;  4ZOL B;  5JQG B;  3JAR A;  1IV3 A;  4NQ3 A;  4O4J A;  3VOB A;  3HKD B;  5LOV B;  3RA5 A;  5ITZ A;  5MN6 A;  5JH7 A;  5J2T A;  3FBA A;  5BMV A;  1JFF A;  1M1K H;  2WAL A;  1FFX A;  2P6Y A;  3IEW A;  1QAH A;  2CSL A;  1YJ9 F;  1Q7Y H;  3WGJ A;  1IV2 A;  1ODE A;  2ZAU A;  3JAT A;  2IQQ A;  2HS4 A;  4BT3 A;  5IYZ A;  3RYH A;  5G4V C;  5JCO A;  3V4D A;  2KGW A;  3L7Q A;  4X1I B;  1VQP F;  3CCU F;  3S06 A;  3FFM A;  4ZK7 A;  4ZHY B;  5IJ0 B;  2KG4 A;  2N48 A;  3VYU C;  3V3T A;  5C8Y A;  3VYS C;  4TUY B;  1X52 A;  3AGK A;  4BT4 A;  1W5F A;  3TD5 A;  1E7K A;  3J7A R;  2GLZ A;  2Q1X A;  2BO1 A;  1IV4 A;  4O4I B;  3VIU A;  3CCM F;  2EWC A;  4R40 B;  5FLX M;  2F9Z C;  3UT5 B;  1YQN A;  3VI6 A;  3CC4 F;  5A2Q M;  1Q86 H;  3N2K A;  1QVF F;  3RYC B;  3KE1 A;  3JAL B;  3CPQ A;  3LWO C;  2OZB A;  1VQ7 F;  3LWQ C;  2PHN A;  4O2B A;  5FNV B;  4EI9 A;  3ELC A;  3ERN A;  3M4S A;  3OBW A;  4G88 A;  3C9S A;  5JVD A;  2ZVZ A;  5B8F A;  3JAK B;  1KC8 H;  3WJQ A;  3LYB A;  5CA0 B;  1TVK B;  3QHD A;  3HTN A;  4X20 A;  3K12 A;  1JY8 A;  3JAR B;  1SZQ A;  3Q8H A;  2G9I A;  2CHT A;  1NJI H;  2IAF A;  1PXW A;  5JCO C;  3NK7 A;  3S0Y A;  1ZWZ A;  5ITZ B;  4BT5 A;  3V7Q A;  2MQE A;  4F6R B;  1JFF B;  2I6R A;  3O85 A;  1FFX B;  3VO8 A;  3CD6 F;  4NUT A;  2QI2 A;  5DCV A;  3CCJ F;  2VGM A;  4ZI7 A;  5IJ9 A;  2BTO A;  2BTU A;  4BT7 A;  1QD9 A;  3CMA F;  4LNU A;  5IYZ B;  2H6L A;  1ONI A;  3RYH B;  4RQO A;  1COM A;  5HWE A;  3F0G A;  5G4U C;  2Z1T A;  1VQN F;  1U3P A;  5HP8 A;  2OTJ F;  3NMU C;  2VGN A; 
#chains in the Genus database with same CATH homology
 3CYQ A;  3S0W A;  5EB1 B;  1R1M A;  4RHA A;  3TD5 A;  3S0Y A;  4B5C A;  3TD4 A;  3S02 A;  2AIZ P;  2MQE A;  4PWT A;  2HQS C;  2K1S A;  2LBT A;  4G4Z A;  4ZHW A;  3S03 A;  4B62 A;  3OON A;  5EAZ A;  5EB0 A;  4ERH A;  3S0H A;  3TD3 A;  2ZVY A;  3WPX A;  4G88 A;  2W8B C;  3LDT A;  2KGW A;  3WPW A;  2LCA A;  2ZOV A;  2ZVZ A;  4G4V A;  3S06 A;  4ZHY B;  4R40 B;  2ZF8 A;  4ZHV A;  3KHN A;  3CYP B;  2N48 A;  4G4Y A;  4G4X A;  2L26 A;  1OAP A;  3IMP A;  4G4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...