3G4SF

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g4sF00
3CCJF 3LWQC 3RA6A 2I6DA 1E7KA 3G4SF 3CXCF 3CCSF 3NVKE 1YI2F 3OBWA 5GIPC 1X52A 4C4WC 5FJ4C 1CK2A 3SIUA 1VQMF 3SIVA 3CPWF 1S72F 3E20B 2QEXF 1VQ6F 1H7MA 2KTUA 5EO3A 5A2QM 1KC8H 3RA5A 2VGNA 1W2BF 1Q86H 1SDSA 1YJWF 5IT9M 3NVIB 1YJNF 3JAMM 5EWRA 3CCUF 1M90H 3CC2F 3GYQA 1M1KH 1VQ7F 1N8RH 1GO1A 1YITF 1GO0A 3CMEF 2CZWA 3J7AR 3CMAF 1QVGF 4BW0B 3LFOA 1CN7A 3CCEF 3CCQF 1Q81H 3OW2F 3LWRC 1K73H 1YIJF 3MCAB 2HVYD 1KQSF 1GZ0A 2LBWA 1VQKF 5DCVA 4TZZA 3CCMF 3G71F 3ON1A 1QVFF 2QA4F 3J80M 1PXWA 1K8AH 2QI2A 3CCVF 3NMUC 3PAFA 3PLAC 3VI6A 2BO1A 3CCRF 2OTJF 3E1YA 3WXMB 3I55F 1W41A 2FC3A 5GINC 4X3LA 2JNBA 3CCLF 3HJWC 3CG6A 1NJIH 1VQLF 3V7EA 1X7OA 1T0KB 1NMUB 3CPQA 3G6EF 5GANK 1VQOF 1W42A 2OZBA 5G4UC 3HAXD 2VGMA 3LWOC 2KG4A 3J81M 3CD6F 3I56F 1VQ4F 1VQPF 1W3EX 2WALA 3OBYA 3LWVC 1VQNF 3IR9A 2OTLF 1RLGA 1VQ5F 1W40A 1YJ9F 1DT9A 3JCMM 4BY9D 2AIFA 3NK7A 2ALEA 3NK6A 1Q7YH 1Q82H 3N4YA 1JJ2F 1VQ8F 4NUTA 3CC7F 3CC4F 1KD1H 1VQ9F 1XBIA 3N4ZA 3VMFB 5GAPK 5FLXM 1YHQF 2KTVA 2OHWA 5GIOC 1IPAA 3V7QA 1K9MH 5G4VC 3AGKA 1ZWZA 3LWPC 1RA4A 2LBXA 4LCKA 3FFMA 1X7PA 4X3MA 3O85A
chains in the Genus database with same CATH superfamily
5MN5A 3CCJF 3RA6A 2I6DA 4G4VA 4I4TB 4ZK7A 5JVDA 3OBWA 5GIPC 2MQEA 3QTYA 4I55B 2VXYA 3D00A 3JALA 3P10A 3RYCB 3ERNA 3JAKA 4ZOLB 4C82A 4M8IA 5LXTA 2R751 4ZHQA 3FD5A 3C9SA 3RYHA 4U3JB 1OFUA 4WBNA 1JY8A 1YJWF 2Z01A 5KMGA 3JAMM 4ZHWA 2BTQB 1W5EA 3HKCA 4O4LB 1U3PA 3JAWB 1M1KH 3F6MA 3RYCA 4BVQA 3J7AR 3CMAF 4I55A 5GONA 4IHJB 1JFFA 4O4HB 3HKBB 5LYJA 1OAPA 3C8LA 2RB9A 4X20A 3JARB 3L7QA 3HWUA 5CB4B 5LA6A 1GZ0A 3Q8HA 4U3JA 2LBWA 3CCMF 5DCVA 2GZLA 4BT3A 4KWEA 4X1KB 3MBMA 5LYJB 1W5AA 1QVFF 5BMVB 3UT5B 5ITZB 1IV1A 2QI2A 3PLAC 5IJ0B 2RHOA 2ZAUA 2CVLA 3U0OA 5HY2A 4BVSA 4G4XA 3RYFB 3DDNA 3I3FA 2FC3A 4F6RB 3HJWC 2HP0A 2UYPA 5LOVB 2Z1EA 3FPIA 3B6NA 5C8YA 1VQLF 5JQGB 3C9TA 4G4YA 3HAXD 4G88A 2KG4A 2CHTA 3ESJA 3K12A 3CD6F 3I56F 4ZHVA 1W3EX 3OBYA 1ODEA 5GONB 3S06A 3IKFA 1W5FA 2ZOVA 1VQ5F 4F6RA 1FFXB 1W40A 5CA0A 3JAWA 2Q1XA 3JCMM 2Z1UA 2AIFA 1Q7YH 3NK6A 4YJ2A 4NUTA 5LXTB 2Z1FA 5GIOC 4YJ3B 4G4ZA 1Z5VA 1T0AA 5G4VC 3AGKA 2LBXA 3FFMA 4G4WA 4X3MA 3M84A 4BT7A 3MQWA 3RYFA 3S0YA 3OONA 3E20B 1VQ6F 5HP7A 5EB0A 5EO3A 2VAWA 1KC8H 3DC2A 3HKEB 4LNUA 5IYZB 1SDSA 1Q86H 2UYKA 1Z5WA 5IT9M 3JASA 1YJNF 5EWRA 3CCUF 4IIJA 3CYPB 4BT6A 1KNJA 2B33A 2RHJA 5LP6C 2HX0A 1GO0A 3WJQA 3CMEF 5MN4A 1GX1A 2H8EA 4EB6A 1Q81H 5EIBD 2V9YA 2KGWA 3OW2F 3E22A 1YQNA 4O2BB 3WJRA 1U3LA 3R0PA 2UYJA 3IMPA 2I6RA 5CA1B 3S03A 5B8FA 3LYBA 5HXZA 3N2GB 2OTMA 3HKEA 3T80A 4HNAA 3ON1A 2HP0B 4EB6B 2QA4F 4B5CA 4B62A 1PXWA 2EWCA 3PAFA 1XRGA 2HQSC 3VCZA 2OTJF 5HP8A 3E1YA 5EZYB 5FNVB 3UT5A 4X3LA 4ZHYB 3S02A 3MDOA 1W55A 2YXZA 3IEQA 3JASB 3N2GA 4B45A 1W42A 5EIBC 4WBNB 2OZBA 5G4UC 3LWOC 5EYPB 3J81M 1R1MA 2RHLA 1W57A 5EYPA 3JAKB 4ZOLA 3VOAA 4YJ2B 3LWVC 3I7TA 4NQ3A 4C8GA 3WPXA 1TUBB 5EB1B 5KMGB 1XV2A 3K2XA 3NK7A 1Q82H 1JJ2F 4LNUB 2K1SA 4PWTA 3WPWA 1CLIA 3F0EA 3CC4F 1KD1H 2DYYA 2AMTA 2IG8A 3N4ZA 4ZHQB 5GAPK 1IV2A 3KJKA 2OHWA 3RYIB 2CW4A 3M4SA 2CSLA 1U43A 5HY4A 2G9IA 3WJPA 2BTUA 5JCOA 2ZF8A 3C9UA 3HKDB 4FFBB 1E7KA 2PMPA 3NVKE 1RQ7A 3JVHA 4C4WC 3ZOPA 4DXDA 5FJ4C 1CK2A 3SIUA 3SIVA 3CPWF 2PHNA 1DBFA 4BT2A 3LMEA 3VTIC 5LP6B 1H7MA 3KHNA 3RYIA 5BMVA 5ITZA 2H6LA 3F0FA 4B46A 5A2QM 3V4DA 1TVKB 4O2AB 3RA5A 5HY1A 2GVIA 2VGNA 4TUYA 1VQVA 3N2KA 3NVIB 4O2AA 2ZVZA 3KJJA 4X1IA 3S0HA 1M90H 4BVRA 3CYQA 3K14A 5HY0A 3GYQA 1FFXA 2HRYA 1VQ7F 3VYTC 1N8RH 2LBTA 2HS3A 3VYSC 1YITF 1VK3A 2UZHA 2CZWA 3KE1A 1ONIA 1QVGF 4TV8B 4BW0B 3LFOA 1X25A 5JVDB 1CN7A 3HKDA 2RHHA 3CCEF 3CCQF 4X1YA 3JATB 3VOBA 3LWRC 3N2KB 4ZI7B 2LCAA 5CB4A 1YIJF 4X20B 3MCAB 1KQSF 1VQKF 4TZZA 3G71F 5LOVA 2L26A 2DT4A 3J80M 1IV4A 4R40B 1K8AH 3FBAA 3M1XA 3CCVF 3C9RA 3S0WA 3F0GA 2Q1YA 3WGKA 3TD4A 2ZODA 3ZO8A 1H48A 1W5BA 4FFBA 1W41A 3I55F 2JNBA 3K0TA 3CCLF 4X1KA 4TV9A 3CG6A 1NJIH 3V7EA 1X7OA 1RLUA 1SA0B 2HP3A 3CPQA 3FD6A 5GANK 1VQOF 4BVTA 3JARA 3V3TA 4YJ3A 5CA1A 5IYZA 1YGYA 2VGMA 2F9ZC 1J7HA 1KNKA 1XHOA 1VQPF 1FNKA 2NMUA 3D01A 5HWEA 3WGLA 1FNJA 2WALA 1RQ2A 1PF5A 2IQQA 3IR9A 3QUWA 3HTNA 1RLGA 4I4TA 2N48A 1SZQA 3BYQA 4IIJB 3WGJA 5IJ0A 4BY9D 3KIZA 3WGMA 1VQ8F 1TVKA 3CC7F 3CB2A 5KX5B 1XBIA 1Q8RA 3VMFB 4HNAB 2KTVA 2HS4A 5J2TA 5LA6B 3ELCA 1K9MH 1H47A 3RE3A 4DRXA 1ZWZA 4ZI7A 3JALB 1SA0A 3LWPC 4BT4A 4C81A 4U39A 4ERHA 1X7PA 2R6R1 1JD1A 3LWQC 1JFFB 4O4HA 1IV3A 4NWOB 3CXCF 2CHSA 2VAMA 3G4SF 3CCSF 1YI2F 4TV8A 1X52A 5MN6A 1VQMF 4DRXB 1NQ3A 1S72F 4I50B 2QEXF 3LDTA 5J2TB 2KTUA 3VO8A 1VHAA 3EORA 5J2UB 5IJ9A 3P4EA 2IAFA 2CWJA 4O4JB 5HXUA 1W2BF 3D54A 4O4JA 5C8YB 3CC2F 3E22B 4O2BA 4RHAA 4X1YB 3HKBA 4IHJA 5EZYA 5FNVA 1GO1A 2P6YA 1UI9A 2Z1TA 3IKEA 3MCQA 3ZP7A 3VIUA 3P0ZA 2UYNB 3HKCB 2GLZA 1K73H 5JH7A 4C8IA 4BT5A 3ZP4A 2HVYD 2VAPA 3JATA 3IEWA 5IJ9B 5J2UA 4C8EA 4XCQA 5LP6A 3TD5A 3NMUC 1TUBA 3VI6A 5JCOC 2BO1A 3CCRF 3WXMB 4EI9A 2FGYA 2HS0A 3GHZA 5GINC 1VH8A 2W8BC 4X1IB 1T0KB 3F0DA 1NMUB 1COMA 3G6EF 3QHDA 4RQOA 1JN1A 4TUYB 5JH7B 4EI7A 1FSZA 4EI8A 2UYNA 1VQ4F 1QAHA 2AIZP 1VQNF 5JQGA 5AVMA 2OTLF 5CA0B 1U40A 1UFYA 2QTPA 1YJ9F 4E6EA 2YYEA 1DT9A 3WGNA 4O4LA 4O4IA 2ZVYA 2ALEA 1W59A 3N4YA 5EAZA 3RYHB 1VQ9F 2HRUA 3VYUC 5KX5A 1QD9A 3TD3A 5FLXM 1YHQF 1IPAA 3V7QA 4I50A 2BTOA 2H8CA 1W581 1RA4A 3GTZA 4LCKA 4TV9B 1QU9A 4O4IB 3O85A
chains in the Genus database with same CATH topology
3CCJF 3LWQC 3RA6A 2I6DA 1E7KA 3G4SF 3CXCF 3CCSF 3NVKE 1YI2F 3OBWA 5GIPC 1X52A 4C4WC 5FJ4C 1CK2A 3SIUA 3D00A 1VQMF 3SIVA 3CPWF 1S72F 3E20B 2QEXF 1VQ6F 1H7MA 2KTUA 5EO3A 5A2QM 1KC8H 3RA5A 5HXUA 5HY1A 2VGNA 1W2BF 1Q86H 1SDSA 1YJWF 5IT9M 3NVIB 1YJNF 3JAMM 5EWRA 3CCUF 1M90H 3CC2F 4BVRA 5HY0A 3GYQA 1M1KH 1VQ7F 1N8RH 1GO1A 1YITF 1GO0A 4BVQA 3CMEF 2CZWA 3J7AR 3CMAF 1QVGF 4BW0B 3LFOA 1CN7A 3CCEF 3CCQF 1Q81H 3OW2F 2GLZA 3LWRC 1K73H 1YIJF 3MCAB 5HXZA 1KQSF 1GZ0A 2LBWA 1VQKF 2HVYD 4TZZA 3CCMF 5DCVA 3G71F 3ON1A 1QVFF 2QA4F 4XCQA 3J80M 1PXWA 1K8AH 2QI2A 3CCVF 3NMUC 3PAFA 3PLAC 3VI6A 5HY2A 2BO1A 4BVSA 3CCRF 3E1YA 2OTJF 3WXMB 4EI9A 2FGYA 3I55F 1W41A 2FC3A 5GINC 4X3LA 2JNBA 3CCLF 3HJWC 3CG6A 1NJIH 1VQLF 3V7EA 1X7OA 1T0KB 1NMUB 3CPQA 3G6EF 5GANK 1VQOF 1W42A 4BVTA 2OZBA 3V3TA 5G4UC 3HAXD 2VGMA 2F9ZC 3LWOC 2KG4A 3J81M 4EI7A 3CD6F 4EI8A 3I56F 1VQ4F 1VQPF 5HWEA 1W3EX 2WALA 3OBYA 3LWVC 1VQNF 3IR9A 2OTLF 4NQ3A 1RLGA 1VQ5F 1W40A 1YJ9F 1DT9A 3JCMM 4BY9D 2AIFA 3NK7A 2ALEA 3NK6A 1Q7YH 1Q82H 3N4YA 1JJ2F 1VQ8F 4NUTA 3CC7F 3CC4F 1KD1H 1VQ9F 1XBIA 3N4ZA 3VMFB 5GAPK 5FLXM 1YHQF 2KTVA 2OHWA 5GIOC 1IPAA 3V7QA 1K9MH 5G4VC 3AGKA 1ZWZA 3LWPC 1RA4A 2LBXA 5HY4A 4LCKA 3FFMA 1X7PA 4X3MA 3O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ F;  3LWQ C;  3RA6 A;  2I6D A;  1E7K A;  3G4S F;  3CXC F;  3CCS F;  3NVK E;  1YI2 F;  3OBW A;  5GIP C;  1X52 A;  4C4W C;  5FJ4 C;  1CK2 A;  3SIU A;  1VQM F;  3SIV A;  3CPW F;  1S72 F;  3E20 B;  2QEX F;  1VQ6 F;  1H7M A;  2KTU A;  5EO3 A;  5A2Q M;  1KC8 H;  3RA5 A;  2VGN A;  1W2B F;  1Q86 H;  1SDS A;  1YJW F;  5IT9 M;  3NVI B;  1YJN F;  3JAM M;  5EWR A;  3CCU F;  1M90 H;  3CC2 F;  3GYQ A;  1M1K H;  1VQ7 F;  1N8R H;  1GO1 A;  1YIT F;  1GO0 A;  3CME F;  2CZW A;  3J7A R;  3CMA F;  1QVG F;  4BW0 B;  3LFO A;  1CN7 A;  3CCE F;  3CCQ F;  1Q81 H;  3OW2 F;  3LWR C;  1K73 H;  1YIJ F;  3MCA B;  2HVY D;  1KQS F;  1GZ0 A;  2LBW A;  1VQK F;  5DCV A;  4TZZ A;  3CCM F;  3G71 F;  3ON1 A;  1QVF F;  2QA4 F;  3J80 M;  1PXW A;  1K8A H;  2QI2 A;  3CCV F;  3NMU C;  3PAF A;  3PLA C;  3VI6 A;  2BO1 A;  3CCR F;  2OTJ F;  3E1Y A;  3WXM B;  3I55 F;  1W41 A;  2FC3 A;  5GIN C;  4X3L A;  2JNB A;  3CCL F;  3HJW C;  3CG6 A;  1NJI H;  1VQL F;  3V7E A;  1X7O A;  1T0K B;  1NMU B;  3CPQ A;  3G6E F;  5GAN K;  1VQO F;  1W42 A;  2OZB A;  5G4U C;  3HAX D;  2VGM A;  3LWO C;  2KG4 A;  3J81 M;  3CD6 F;  3I56 F;  1VQ4 F;  1VQP F;  1W3E X;  2WAL A;  3OBY A;  3LWV C;  1VQN F;  3IR9 A;  2OTL F;  1RLG A;  1VQ5 F;  1W40 A;  1YJ9 F;  1DT9 A;  3JCM M;  4BY9 D;  2AIF A;  3NK7 A;  2ALE A;  3NK6 A;  1Q7Y H;  1Q82 H;  3N4Y A;  1JJ2 F;  1VQ8 F;  4NUT A;  3CC7 F;  3CC4 F;  1KD1 H;  1VQ9 F;  1XBI A;  3N4Z A;  3VMF B;  5GAP K;  5FLX M;  1YHQ F;  2KTV A;  2OHW A;  5GIO C;  1IPA A;  3V7Q A;  1K9M H;  5G4V C;  3AGK A;  1ZWZ A;  3LWP C;  1RA4 A;  2LBX A;  4LCK A;  3FFM A;  1X7P A;  4X3M A;  3O85 A; 
#chains in the Genus database with same CATH topology
 5MN5 A;  3CCJ F;  3RA6 A;  2I6D A;  4G4V A;  4I4T B;  4ZK7 A;  5JVD A;  3OBW A;  5GIP C;  2MQE A;  3QTY A;  4I55 B;  2VXY A;  3D00 A;  3JAL A;  3P10 A;  3RYC B;  3ERN A;  3JAK A;  4ZOL B;  4C82 A;  4M8I A;  5LXT A;  2R75 1;  4ZHQ A;  3FD5 A;  3C9S A;  3RYH A;  4U3J B;  1OFU A;  4WBN A;  1JY8 A;  1YJW F;  2Z01 A;  5KMG A;  3JAM M;  4ZHW A;  2BTQ B;  1W5E A;  3HKC A;  4O4L B;  1U3P A;  3JAW B;  1M1K H;  3F6M A;  3RYC A;  4BVQ A;  3J7A R;  3CMA F;  4I55 A;  5GON A;  4IHJ B;  1JFF A;  4O4H B;  3HKB B;  5LYJ A;  1OAP A;  3C8L A;  2RB9 A;  4X20 A;  3JAR B;  3L7Q A;  3HWU A;  5CB4 B;  5LA6 A;  1GZ0 A;  3Q8H A;  4U3J A;  2LBW A;  3CCM F;  5DCV A;  2GZL A;  4BT3 A;  4KWE A;  4X1K B;  3MBM A;  5LYJ B;  1W5A A;  1QVF F;  5BMV B;  3UT5 B;  5ITZ B;  1IV1 A;  2QI2 A;  3PLA C;  5IJ0 B;  2RHO A;  2ZAU A;  2CVL A;  3U0O A;  5HY2 A;  4BVS A;  4G4X A;  3RYF B;  3DDN A;  3I3F A;  2FC3 A;  4F6R B;  3HJW C;  2HP0 A;  2UYP A;  5LOV B;  2Z1E A;  3FPI A;  3B6N A;  5C8Y A;  1VQL F;  5JQG B;  3C9T A;  4G4Y A;  3HAX D;  4G88 A;  2KG4 A;  2CHT A;  3ESJ A;  3K12 A;  3CD6 F;  3I56 F;  4ZHV A;  1W3E X;  3OBY A;  1ODE A;  5GON B;  3S06 A;  3IKF A;  1W5F A;  2ZOV A;  1VQ5 F;  4F6R A;  1FFX B;  1W40 A;  5CA0 A;  3JAW A;  2Q1X A;  3JCM M;  2Z1U A;  2AIF A;  1Q7Y H;  3NK6 A;  4YJ2 A;  4NUT A;  5LXT B;  2Z1F A;  5GIO C;  4YJ3 B;  4G4Z A;  1Z5V A;  1T0A A;  5G4V C;  3AGK A;  2LBX A;  3FFM A;  4G4W A;  4X3M A;  3M84 A;  4BT7 A;  3MQW A;  3RYF A;  3S0Y A;  3OON A;  3E20 B;  1VQ6 F;  5HP7 A;  5EB0 A;  5EO3 A;  2VAW A;  1KC8 H;  3DC2 A;  3HKE B;  4LNU A;  5IYZ B;  1SDS A;  1Q86 H;  2UYK A;  1Z5W A;  5IT9 M;  3JAS A;  1YJN F;  5EWR A;  3CCU F;  4IIJ A;  3CYP B;  4BT6 A;  1KNJ A;  2B33 A;  2RHJ A;  5LP6 C;  2HX0 A;  1GO0 A;  3WJQ A;  3CME F;  5MN4 A;  1GX1 A;  2H8E A;  4EB6 A;  1Q81 H;  5EIB D;  2V9Y A;  2KGW A;  3OW2 F;  3E22 A;  1YQN A;  4O2B B;  3WJR A;  1U3L A;  3R0P A;  2UYJ A;  3IMP A;  2I6R A;  5CA1 B;  3S03 A;  5B8F A;  3LYB A;  5HXZ A;  3N2G B;  2OTM A;  3HKE A;  3T80 A;  4HNA A;  3ON1 A;  2HP0 B;  4EB6 B;  2QA4 F;  4B5C A;  4B62 A;  1PXW A;  2EWC A;  3PAF A;  1XRG A;  2HQS C;  3VCZ A;  2OTJ F;  5HP8 A;  3E1Y A;  5EZY B;  5FNV B;  3UT5 A;  4X3L A;  4ZHY B;  3S02 A;  3MDO A;  1W55 A;  2YXZ A;  3IEQ A;  3JAS B;  3N2G A;  4B45 A;  1W42 A;  5EIB C;  4WBN B;  2OZB A;  5G4U C;  3LWO C;  5EYP B;  3J81 M;  1R1M A;  2RHL A;  1W57 A;  5EYP A;  3JAK B;  4ZOL A;  3VOA A;  4YJ2 B;  3LWV C;  3I7T A;  4NQ3 A;  4C8G A;  3WPX A;  1TUB B;  5EB1 B;  5KMG B;  1XV2 A;  3K2X A;  3NK7 A;  1Q82 H;  1JJ2 F;  4LNU B;  2K1S A;  4PWT A;  3WPW A;  1CLI A;  3F0E A;  3CC4 F;  1KD1 H;  2DYY A;  2AMT A;  2IG8 A;  3N4Z A;  4ZHQ B;  5GAP K;  1IV2 A;  3KJK A;  2OHW A;  3RYI B;  2CW4 A;  3M4S A;  2CSL A;  1U43 A;  5HY4 A;  2G9I A;  3WJP A;  2BTU A;  5JCO A;  2ZF8 A;  3C9U A;  3HKD B;  4FFB B;  1E7K A;  2PMP A;  3NVK E;  1RQ7 A;  3JVH A;  4C4W C;  3ZOP A;  4DXD A;  5FJ4 C;  1CK2 A;  3SIU A;  3SIV A;  3CPW F;  2PHN A;  1DBF A;  4BT2 A;  3LME A;  3VTI C;  5LP6 B;  1H7M A;  3KHN A;  3RYI A;  5BMV A;  5ITZ A;  2H6L A;  3F0F A;  4B46 A;  5A2Q M;  3V4D A;  1TVK B;  4O2A B;  3RA5 A;  5HY1 A;  2GVI A;  2VGN A;  4TUY A;  1VQV A;  3N2K A;  3NVI B;  4O2A A;  2ZVZ A;  3KJJ A;  4X1I A;  3S0H A;  1M90 H;  4BVR A;  3CYQ A;  3K14 A;  5HY0 A;  3GYQ A;  1FFX A;  2HRY A;  1VQ7 F;  3VYT C;  1N8R H;  2LBT A;  2HS3 A;  3VYS C;  1YIT F;  1VK3 A;  2UZH A;  2CZW A;  3KE1 A;  1ONI A;  1QVG F;  4TV8 B;  4BW0 B;  3LFO A;  1X25 A;  5JVD B;  1CN7 A;  3HKD A;  2RHH A;  3CCE F;  3CCQ F;  4X1Y A;  3JAT B;  3VOB A;  3LWR C;  3N2K B;  4ZI7 B;  2LCA A;  5CB4 A;  1YIJ F;  4X20 B;  3MCA B;  1KQS F;  1VQK F;  4TZZ A;  3G71 F;  5LOV A;  2L26 A;  2DT4 A;  3J80 M;  1IV4 A;  4R40 B;  1K8A H;  3FBA A;  3M1X A;  3CCV F;  3C9R A;  3S0W A;  3F0G A;  2Q1Y A;  3WGK A;  3TD4 A;  2ZOD A;  3ZO8 A;  1H48 A;  1W5B A;  4FFB A;  1W41 A;  3I55 F;  2JNB A;  3K0T A;  3CCL F;  4X1K A;  4TV9 A;  3CG6 A;  1NJI H;  3V7E A;  1X7O A;  1RLU A;  1SA0 B;  2HP3 A;  3CPQ A;  3FD6 A;  5GAN K;  1VQO F;  4BVT A;  3JAR A;  3V3T A;  4YJ3 A;  5CA1 A;  5IYZ A;  1YGY A;  2VGM A;  2F9Z C;  1J7H A;  1KNK A;  1XHO A;  1VQP F;  1FNK A;  2NMU A;  3D01 A;  5HWE A;  3WGL A;  1FNJ A;  2WAL A;  1RQ2 A;  1PF5 A;  2IQQ A;  3IR9 A;  3QUW A;  3HTN A;  1RLG A;  4I4T A;  2N48 A;  1SZQ A;  3BYQ A;  4IIJ B;  3WGJ A;  5IJ0 A;  4BY9 D;  3KIZ A;  3WGM A;  1VQ8 F;  1TVK A;  3CC7 F;  3CB2 A;  5KX5 B;  1XBI A;  1Q8R A;  3VMF B;  4HNA B;  2KTV A;  2HS4 A;  5J2T A;  5LA6 B;  3ELC A;  1K9M H;  1H47 A;  3RE3 A;  4DRX A;  1ZWZ A;  4ZI7 A;  3JAL B;  1SA0 A;  3LWP C;  4BT4 A;  4C81 A;  4U39 A;  4ERH A;  1X7P A;  2R6R 1;  1JD1 A;  3LWQ C;  1JFF B;  4O4H A;  1IV3 A;  4NWO B;  3CXC F;  2CHS A;  2VAM A;  3G4S F;  3CCS F;  1YI2 F;  4TV8 A;  1X52 A;  5MN6 A;  1VQM F;  4DRX B;  1NQ3 A;  1S72 F;  4I50 B;  2QEX F;  3LDT A;  5J2T B;  2KTU A;  3VO8 A;  1VHA A;  3EOR A;  5J2U B;  5IJ9 A;  3P4E A;  2IAF A;  2CWJ A;  4O4J B;  5HXU A;  1W2B F;  3D54 A;  4O4J A;  5C8Y B;  3CC2 F;  3E22 B;  4O2B A;  4RHA A;  4X1Y B;  3HKB A;  4IHJ A;  5EZY A;  5FNV A;  1GO1 A;  2P6Y A;  1UI9 A;  2Z1T A;  3IKE A;  3MCQ A;  3ZP7 A;  3VIU A;  3P0Z A;  2UYN B;  3HKC B;  2GLZ A;  1K73 H;  5JH7 A;  4C8I A;  4BT5 A;  3ZP4 A;  2HVY D;  2VAP A;  3JAT A;  3IEW A;  5IJ9 B;  5J2U A;  4C8E A;  4XCQ A;  5LP6 A;  3TD5 A;  3NMU C;  1TUB A;  3VI6 A;  5JCO C;  2BO1 A;  3CCR F;  3WXM B;  4EI9 A;  2FGY A;  2HS0 A;  3GHZ A;  5GIN C;  1VH8 A;  2W8B C;  4X1I B;  1T0K B;  3F0D A;  1NMU B;  1COM A;  3G6E F;  3QHD A;  4RQO A;  1JN1 A;  4TUY B;  5JH7 B;  4EI7 A;  1FSZ A;  4EI8 A;  2UYN A;  1VQ4 F;  1QAH A;  2AIZ P;  1VQN F;  5JQG A;  5AVM A;  2OTL F;  5CA0 B;  1U40 A;  1UFY A;  2QTP A;  1YJ9 F;  4E6E A;  2YYE A;  1DT9 A;  3WGN A;  4O4L A;  4O4I A;  2ZVY A;  2ALE A;  1W59 A;  3N4Y A;  5EAZ A;  3RYH B;  1VQ9 F;  2HRU A;  3VYU C;  5KX5 A;  1QD9 A;  3TD3 A;  5FLX M;  1YHQ F;  1IPA A;  3V7Q A;  4I50 A;  2BTO A;  2H8C A;  1W58 1;  1RA4 A;  3GTZ A;  4LCK A;  4TV9 B;  1QU9 A;  4O4I B;  3O85 A; 
#chains in the Genus database with same CATH homology
 3CCJ F;  3LWQ C;  3RA6 A;  2I6D A;  1E7K A;  3G4S F;  3CXC F;  3CCS F;  3NVK E;  1YI2 F;  3OBW A;  5GIP C;  1X52 A;  4C4W C;  5FJ4 C;  1CK2 A;  3SIU A;  3D00 A;  1VQM F;  3SIV A;  3CPW F;  1S72 F;  3E20 B;  2QEX F;  1VQ6 F;  1H7M A;  2KTU A;  5EO3 A;  5A2Q M;  1KC8 H;  3RA5 A;  5HXU A;  5HY1 A;  2VGN A;  1W2B F;  1Q86 H;  1SDS A;  1YJW F;  5IT9 M;  3NVI B;  1YJN F;  3JAM M;  5EWR A;  3CCU F;  1M90 H;  3CC2 F;  4BVR A;  5HY0 A;  3GYQ A;  1M1K H;  1VQ7 F;  1N8R H;  1GO1 A;  1YIT F;  1GO0 A;  4BVQ A;  3CME F;  2CZW A;  3J7A R;  3CMA F;  1QVG F;  4BW0 B;  3LFO A;  1CN7 A;  3CCE F;  3CCQ F;  1Q81 H;  3OW2 F;  2GLZ A;  3LWR C;  1K73 H;  1YIJ F;  3MCA B;  5HXZ A;  1KQS F;  1GZ0 A;  2LBW A;  1VQK F;  2HVY D;  4TZZ A;  3CCM F;  5DCV A;  3G71 F;  3ON1 A;  1QVF F;  2QA4 F;  4XCQ A;  3J80 M;  1PXW A;  1K8A H;  2QI2 A;  3CCV F;  3NMU C;  3PAF A;  3PLA C;  3VI6 A;  5HY2 A;  2BO1 A;  4BVS A;  3CCR F;  3E1Y A;  2OTJ F;  3WXM B;  4EI9 A;  2FGY A;  3I55 F;  1W41 A;  2FC3 A;  5GIN C;  4X3L A;  2JNB A;  3CCL F;  3HJW C;  3CG6 A;  1NJI H;  1VQL F;  3V7E A;  1X7O A;  1T0K B;  1NMU B;  3CPQ A;  3G6E F;  5GAN K;  1VQO F;  1W42 A;  4BVT A;  2OZB A;  3V3T A;  5G4U C;  3HAX D;  2VGM A;  2F9Z C;  3LWO C;  2KG4 A;  3J81 M;  4EI7 A;  3CD6 F;  4EI8 A;  3I56 F;  1VQ4 F;  1VQP F;  5HWE A;  1W3E X;  2WAL A;  3OBY A;  3LWV C;  1VQN F;  3IR9 A;  2OTL F;  4NQ3 A;  1RLG A;  1VQ5 F;  1W40 A;  1YJ9 F;  1DT9 A;  3JCM M;  4BY9 D;  2AIF A;  3NK7 A;  2ALE A;  3NK6 A;  1Q7Y H;  1Q82 H;  3N4Y A;  1JJ2 F;  1VQ8 F;  4NUT A;  3CC7 F;  3CC4 F;  1KD1 H;  1VQ9 F;  1XBI A;  3N4Z A;  3VMF B;  5GAP K;  5FLX M;  1YHQ F;  2KTV A;  2OHW A;  5GIO C;  1IPA A;  3V7Q A;  1K9M H;  5G4V C;  3AGK A;  1ZWZ A;  3LWP C;  1RA4 A;  2LBX A;  5HY4 A;  4LCK A;  3FFM A;  1X7P A;  4X3M A;  3O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...