3G4SF

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g4sF00
3CPWF 2BO1A 1KQSF 1QVFF 3LWOC 1W41A 1GO0A 3JAMM 1M90H 3NMUC 1RLGA 3NVKE 3RA5A 1N8RH 1K8AH 2KG4A 3O85A 3OBWA 3G4SF 3ON1A 5FJ4C 4X3MA 1H7MA 1YITF 1VQKF 5EO3A 1VQ7F 1VQ6F 3LFOA 5DCVA 2QI2A 3N4YA 1VQ9F 3CCRF 1YJ9F 3CMEF 2FC3A 2LBWA 3CD6F 3CCJF 3OW2F 5G4VC 3CC7F 1VQ5F 1K73H 1YHQF 3LWRC 5GAPK 4NUTA 3LWQC 1VQOF 1M1KH 5GANK 4LCKA 1CK2A 3CC2F 3WXMB 2VGMA 2ALEA 3PAFA 3MCAB 1ZWZA 1YIJF 3LWPC 3CCQF 1JJ2F 1X7PA 2LBXA 3OBYA 3NK6A 3JCMM 1KC8H 3I56F 1VQPF 3VMFB 1W40A 1VQ8F 3V7QA 1YJWF 3CC4F 1X7OA 3J81M 1W42A 3VI6A 4X3LA 2KTUA 3SIVA 2OZBA 1W2BF 3HJWC 3PLAC 1GZ0A 3LWVC 1NMUB 3G6EF 1CN7A 5A2QM 2VGNA 5IT9M 2OHWA 3SIUA 5EWRA 1E7KA 1KD1H 1SDSA 2QEXF 1W3EX 1VQNF 3NVIB 4C4WC 3N4ZA 3G71F 5GIPC 5GIOC 1Q86H 3CCLF 4TZZA 1DT9A 5FLXM 1IPAA 3CMAF 1VQMF 1Q7YH 1T0KB 1VQLF 4BY9D 3FFMA 1XBIA 2CZWA 1YI2F 2I6DA 2HVYD 1X52A 3HAXD 2JNBA 3V7EA 3RA6A 3CXCF 1VQ4F 1S72F 1RA4A 3I55F 4BW0B 3CCUF 1YJNF 1Q82H 2QA4F 3E20B 5G4UC 3CCVF 3CPQA 3IR9A 3NK7A 3J80M 2KTVA 3E1YA 1QVGF 3CG6A 3AGKA 2OTLF 3CCMF 1PXWA 2OTJF 3J7AR 1GO1A 3CCEF 5GINC 2WALA 1Q81H 1K9MH 1NJIH 2AIFA 3CCSF 3GYQA
chains in the Genus database with same CATH superfamily
2CWJA 2H8CA 3VOAA 3CYPB 2HRUA 2IAFA 2IG8A 3LWOC 1W41A 1GO0A 3JAMM 2QTPA 1W5AA 1N8RH 3VYTC 3FBAA 1H7MA 3N2KB 1YITF 2FGYA 5IJ9A 3OONA 4I55B 1TUBB 2N48A 1RQ2A 3LMEA 1VQ6F 3I7TA 5IJ0B 1QU9A 4O4JB 5MN4A 5EZYB 2NMUA 4X1KB 4C82A 4NWOB 2ZF8A 3JVHA 1YHQF 3K12A 3FD5A 3JATA 3LWQC 1VQOF 1M1KH 3IEQA 5EIBC 2RB9A 5CB4B 2ALEA 4BT2A 3S0HA 2HQSC 5J2TA 3RYIA 3K14A 4B5CA 1ZWZA 3D00A 4ERHA 2RHLA 4C8EA 5EAZA 3E22B 3NK6A 4KWEA 3K0TA 1W581 4C81A 2HP0B 3HWUA 1JY8A 3J81M 1JN1A 5BMVA 3KJJA 5HY2A 4X3LA 3S02A 2OZBA 3S03A 3PLAC 1GZ0A 3LWVC 4YJ3B 3S0WA 5A2QM 4HNAA 2H8EA 3JAWA 2OHWA 1XRGA 1PF5A 1COMA 5KX5A 1KD1H 2VAWA 4G4VA 4I50B 5LP6A 5LXTB 2KGWA 4O4IB 3RYHB 3CCLF 1DT9A 4IHJB 2CSLA 2UYNA 5HXZA 2HRYA 3ZP4A 1VQMF 4WBNA 2AMTA 2UZHA 3N2GB 4O4LA 4BY9D 3FFMA 5EYPA 1Z5VA 2PMPA 3VIUA 2HVYD 4ZI7A 5LOVA 1VH8A 1X52A 4U3JA 1SA0A 2L26A 5IYZA 3MCQA 2UYJA 2VAMA 2LBTA 3CXCF 4TUYA 1RA4A 3I55F 3HKDB 2DT4A 3CCUF 1Q82H 1U43A 2QA4F 3IR9A 3J80M 3TD5A 1NQ3A 1YQNA 3E1YA 3KIZA 4BVSA 4O2BA 3GHZA 3CCMF 1PXWA 1W55A 4EB6B 2ZOVA 5HWEA 1H48A 3CCEF 3ESJA 3JAKB 3M4SA 5C8YB 5GINC 2WALA 1JD1A 1H47A 2RHHA 2AIFA 3CCSF 5FNVA 1UI9A 4RQOA 4G88A 3LYBA 4ZHQB 3ZP7A 1M90H 2I6RA 5HXUA 3NVKE 3RA5A 2ZODA 2HS4A 4IIJA 5JH7B 3TD4A 1VHAA 5FJ4C 4X3MA 4BT7A 5J2TB 5KMGA 5LP6C 2Q1XA 3TD3A 3VTIC 2QI2A 3N4YA 5ITZB 1YJ9F 3CMEF 1X25A 4O4HB 2FC3A 4DXDA 2VAPA 3QUWA 2DYYA 2YYEA 1U40A 4YJ2B 5GAPK 1FNJA 4FFBA 1JFFB 3L7QA 1CK2A 5GANK 2PHNA 4I4TB 3WXMB 3CC2F 3HKEB 4LCKA 4X1YA 4B62A 3RYCA 3MCAB 5HP7A 5LP6B 3LWPC 3CCQF 4C8IA 3HKBB 4F6RA 2F9ZC 2LBXA 3OBYA 4O2AA 5MN5A 5LA6A 1VQPF 5JQGA 2HP3A 1W40A 3CC4F 1X7OA 2HS3A 3S06A 1W42A 3WGKA 1UFYA 2KTUA 3SIVA 1FNKA 3IKFA 1CN7A 5EB0A 3QHDA 4BVRA 3F0DA 5IYZB 3SIUA 1E7KA 3F0GA 1Q8RA 4ZK7A 1W5BA 3WGMA 1VQNF 4C4WC 3KJKA 4TV8B 5GIOC 4LNUB 2G9IA 1IPAA 3JALA 4ZHYB 3ERNA 3CYQA 1KNJA 1YI2F 2RHJA 5EB1B 2Z1FA 2JNBA 3FPIA 4PWTA 3RA6A 5JVDB 3V7EA 4DRXB 1VQ4F 4TV9A 1R1MA 2MQEA 5HY4A 4X20B 4BW0B 2Q1YA 2CHTA 3RYFA 3CCVF 3CPQA 4B45A 3JASB 5CA1B 4ZHWA 5HY1A 3C8LA 4XCQA 3CB2A 4X1IB 3UT5B 5LYJB 5JCOA 2OTJF 4ZOLA 1OAPA 2Z1EA 5CA0A 1Q81H 1W5FA 1K9MH 3MQWA 5HP8A 1OFUA 3WJPA 2BO1A 3WJRA 1VQ9F 3MDOA 5AVMA 1QVFF 5J2UA 3WGJA 1FSZA 4BVQA 3NMUC 1K8AH 2KG4A 3G4SF 4X1YB 3S0YA 3ZOPA 2RHOA 5HY0A 1VQKF 3HTNA 5EO3A 4EI8A 1VQ7F 4EI7A 5IJ9B 3LFOA 5DCVA 4O4JA 5EZYA 2ZVYA 4X1KA 3CCRF 3KE1A 3BYQA 3VO8A 3EORA 3CCJF 3OW2F 5G4VC 2HX0A 3CC7F 1VQ5F 1K73H 4R40B 3LWRC 3WPWA 2HS0A 5CB4A 4NUTA 3JATB 2VGMA 3PAFA 1ONIA 3QTYA 3DDNA 3P0ZA 4BT6A 5B8FA 1YIJF 1JJ2F 5MN6A 3RYIB 2HP0A 1W59A 4G4WA 3IEWA 3U0OA 1YJWF 3JALB 5JCOC 3DC2A 3VI6A 4YJ3A 3KHNA 1YGYA 3HJWC 5BMVB 1NMUB 3G6EF 4HNAB 1SDSA 3JAWB 5LXTA 2QEXF 1W3EX 1W57A 5KX5B 2GLZA 1TVKA 3RYHA 3RYFB 3M1XA 2R751 4IHJA 3G71F 4TZZA 2K1SA 2B33A 4BT4A 3N2GA 5FLXM 3CMAF 1Q7YH 1VQLF 2UYPA 2UYNB 1XBIA 2CZWA 4WBNB 2GZLA 4O4LB 5EYPB 2I6DA 4C8GA 4M8IA 1U3PA 4ZI7B 5LOVB 3HKDA 2VXYA 4U3JB 5J2UB 1SA0B 1YJNF 4TUYB 3GTZA 4RHAA 2BTUA 2KTVA 3C9TA 3WGLA 3JARA 3CG6A 3Q8HA 4EB6A 2OTLF 1SZQA 3JAKA 5C8YA 4O2BB 3ZO8A 3J7AR 4E6EA 1NJIH 2UYKA 3FD6A 1U3LA 3V4DA 3ELCA 3CPWF 1J7HA 1KQSF 1FFXA 1VK3A 4ZHQA 2BTQB 3VOBA 5FNVB 3HKCA 5JH7A 1RLGA 1GX1A 3OBWA 3O85A 3ON1A 1IV2A 3WPXA 4IIJB 4G4XA 1XHOA 5KMGB 1ODEA 1Z5WA 5ITZA 3MBMA 1VQVA 3IKEA 4O4HA 4EI9A 5GONA 1RQ7A 1KNKA 3P4EA 4B46A 2OTMA 3D54A 2CHSA 2LBWA 3CD6F 3F0FA 1QD9A 4YJ2A 1IV1A 2P6YA 1JFFA 4BT5A 4I4TA 3HKEA 4G4ZA 4FFBB 3K2XA 5EIBD 2EWCA 3N2KA 3HKBA 3RYCB 1TVKB 3D01A 4I55A 2LCAA 1TUBA 1W5EA 1X7PA 1RLUA 3M84A 3R0PA 3JCMM 3IMPA 1KC8H 3I56F 5IJ0A 4F6RB 4O2AB 3VMFB 1VQ8F 3P10A 5LA6B 3V7QA 4BT3A 5JQGB 3F6MA 2CW4A 1W2BF 4U39A 4BVTA 3T80A 2VGNA 5IT9M 5EWRA 2W8BC 1QAHA 1XV2A 4TV8A 3WJQA 3C9RA 4LNUA 3NVIB 3N4ZA 2V9YA 5GIPC 2BTOA 3E22A 1Q86H 1IV4A 1DBFA 3JARB 1T0KB 2AIZP 3I3FA 2CVLA 2IQQA 4NQ3A 2Z1TA 5JVDA 4DRXA 3HAXD 2ZAUA 3VYSC 4X20A 2H6LA 3RE3A 1T0AA 1FFXB 1IV3A 1S72F 3VYUC 2ZVZA 3C9UA 3VCZA 3B6NA 4I50A 4TV9B 3HKCB 1CLIA 3LDTA 3V3TA 4G4YA 3E20B 5G4UC 3JASA 3NK7A 5CA1A 4O4IA 4X1IA 3UT5A 4ZHVA 5LYJA 1QVGF 2Z01A 3AGKA 2R6R1 2GVIA 3C9SA 1GO1A 3WGNA 2YXZA 2Z1UA 5GONB 4ZOLB 5CA0B 3F0EA 3GYQA
chains in the Genus database with same CATH topology
3CPWF 2BO1A 1KQSF 1QVFF 3LWOC 1W41A 1GO0A 3JAMM 1M90H 4BVQA 3NMUC 5HXUA 1RLGA 3RA5A 1N8RH 1K8AH 3NVKE 3OBWA 2KG4A 3O85A 3G4SF 3ON1A 5FJ4C 4X3MA 1H7MA 1YITF 2FGYA 5HY0A 1VQKF 5EO3A 4EI8A 1VQ7F 4EI7A 1VQ6F 3LFOA 5DCVA 2QI2A 3N4YA 4EI9A 1VQ9F 3CCRF 1YJ9F 3CMEF 2FC3A 2LBWA 3CD6F 3CCJF 3OW2F 5G4VC 3CC7F 1VQ5F 1K73H 1YHQF 3LWRC 5GAPK 4NUTA 3LWQC 1VQOF 1M1KH 5GANK 4LCKA 1CK2A 3CC2F 3WXMB 2VGMA 2ALEA 3PAFA 3MCAB 1ZWZA 3D00A 1YIJF 3LWPC 3CCQF 1JJ2F 2F9ZC 1X7PA 2LBXA 3OBYA 3NK6A 3JCMM 1KC8H 3I56F 1VQPF 3VMFB 1W40A 1VQ8F 3V7QA 1YJWF 3CC4F 1X7OA 3J81M 1W42A 3VI6A 5HY2A 4X3LA 2KTUA 3SIVA 2OZBA 1W2BF 3HJWC 3PLAC 1GZ0A 3LWVC 1NMUB 4BVTA 3G6EF 1CN7A 5A2QM 4BVRA 2VGNA 5IT9M 2OHWA 3SIUA 5EWRA 1E7KA 1KD1H 1SDSA 2QEXF 1W3EX 2GLZA 1VQNF 3NVIB 4C4WC 3N4ZA 3G71F 5GIPC 5GIOC 1Q86H 3CCLF 4TZZA 1DT9A 5FLXM 1IPAA 5HXZA 3CMAF 1VQMF 1Q7YH 1T0KB 1VQLF 4BY9D 3FFMA 1XBIA 2CZWA 1YI2F 4NQ3A 2I6DA 2HVYD 1X52A 3HAXD 2JNBA 3V7EA 3RA6A 3CXCF 1VQ4F 1S72F 1RA4A 3I55F 5HY4A 4BW0B 3CCUF 1YJNF 1Q82H 3V3TA 2QA4F 3E20B 5G4UC 3CCVF 3CPQA 3IR9A 3NK7A 3J80M 2KTVA 3E1YA 1QVGF 4BVSA 3CG6A 5HY1A 3AGKA 4XCQA 2OTLF 3CCMF 1PXWA 2OTJF 3J7AR 1GO1A 5HWEA 3CCEF 5GINC 2WALA 1Q81H 1K9MH 1NJIH 2AIFA 3CCSF 3GYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW F;  2BO1 A;  1KQS F;  1QVF F;  3LWO C;  1W41 A;  1GO0 A;  3JAM M;  1M90 H;  3NMU C;  1RLG A;  3NVK E;  3RA5 A;  1N8R H;  1K8A H;  2KG4 A;  3O85 A;  3OBW A;  3G4S F;  3ON1 A;  5FJ4 C;  4X3M A;  1H7M A;  1YIT F;  1VQK F;  5EO3 A;  1VQ7 F;  1VQ6 F;  3LFO A;  5DCV A;  2QI2 A;  3N4Y A;  1VQ9 F;  3CCR F;  1YJ9 F;  3CME F;  2FC3 A;  2LBW A;  3CD6 F;  3CCJ F;  3OW2 F;  5G4V C;  3CC7 F;  1VQ5 F;  1K73 H;  1YHQ F;  3LWR C;  5GAP K;  4NUT A;  3LWQ C;  1VQO F;  1M1K H;  5GAN K;  4LCK A;  1CK2 A;  3CC2 F;  3WXM B;  2VGM A;  2ALE A;  3PAF A;  3MCA B;  1ZWZ A;  1YIJ F;  3LWP C;  3CCQ F;  1JJ2 F;  1X7P A;  2LBX A;  3OBY A;  3NK6 A;  3JCM M;  1KC8 H;  3I56 F;  1VQP F;  3VMF B;  1W40 A;  1VQ8 F;  3V7Q A;  1YJW F;  3CC4 F;  1X7O A;  3J81 M;  1W42 A;  3VI6 A;  4X3L A;  2KTU A;  3SIV A;  2OZB A;  1W2B F;  3HJW C;  3PLA C;  1GZ0 A;  3LWV C;  1NMU B;  3G6E F;  1CN7 A;  5A2Q M;  2VGN A;  5IT9 M;  2OHW A;  3SIU A;  5EWR A;  1E7K A;  1KD1 H;  1SDS A;  2QEX F;  1W3E X;  1VQN F;  3NVI B;  4C4W C;  3N4Z A;  3G71 F;  5GIP C;  5GIO C;  1Q86 H;  3CCL F;  4TZZ A;  1DT9 A;  5FLX M;  1IPA A;  3CMA F;  1VQM F;  1Q7Y H;  1T0K B;  1VQL F;  4BY9 D;  3FFM A;  1XBI A;  2CZW A;  1YI2 F;  2I6D A;  2HVY D;  1X52 A;  3HAX D;  2JNB A;  3V7E A;  3RA6 A;  3CXC F;  1VQ4 F;  1S72 F;  1RA4 A;  3I55 F;  4BW0 B;  3CCU F;  1YJN F;  1Q82 H;  2QA4 F;  3E20 B;  5G4U C;  3CCV F;  3CPQ A;  3IR9 A;  3NK7 A;  3J80 M;  2KTV A;  3E1Y A;  1QVG F;  3CG6 A;  3AGK A;  2OTL F;  3CCM F;  1PXW A;  2OTJ F;  3J7A R;  1GO1 A;  3CCE F;  5GIN C;  2WAL A;  1Q81 H;  1K9M H;  1NJI H;  2AIF A;  3CCS F;  3GYQ A; 
#chains in the Genus database with same CATH topology
 2CWJ A;  2H8C A;  3VOA A;  3CYP B;  2HRU A;  2IAF A;  2IG8 A;  3LWO C;  1W41 A;  1GO0 A;  3JAM M;  2QTP A;  1W5A A;  1N8R H;  3VYT C;  3FBA A;  1H7M A;  3N2K B;  1YIT F;  2FGY A;  5IJ9 A;  3OON A;  4I55 B;  1TUB B;  2N48 A;  1RQ2 A;  3LME A;  1VQ6 F;  3I7T A;  5IJ0 B;  1QU9 A;  4O4J B;  5MN4 A;  5EZY B;  2NMU A;  4X1K B;  4C82 A;  4NWO B;  2ZF8 A;  3JVH A;  1YHQ F;  3K12 A;  3FD5 A;  3JAT A;  3LWQ C;  1VQO F;  1M1K H;  3IEQ A;  5EIB C;  2RB9 A;  5CB4 B;  2ALE A;  4BT2 A;  3S0H A;  2HQS C;  5J2T A;  3RYI A;  3K14 A;  4B5C A;  1ZWZ A;  3D00 A;  4ERH A;  2RHL A;  4C8E A;  5EAZ A;  3E22 B;  3NK6 A;  4KWE A;  3K0T A;  1W58 1;  4C81 A;  2HP0 B;  3HWU A;  1JY8 A;  3J81 M;  1JN1 A;  5BMV A;  3KJJ A;  5HY2 A;  4X3L A;  3S02 A;  2OZB A;  3S03 A;  3PLA C;  1GZ0 A;  3LWV C;  4YJ3 B;  3S0W A;  5A2Q M;  4HNA A;  2H8E A;  3JAW A;  2OHW A;  1XRG A;  1PF5 A;  1COM A;  5KX5 A;  1KD1 H;  2VAW A;  4G4V A;  4I50 B;  5LP6 A;  5LXT B;  2KGW A;  4O4I B;  3RYH B;  3CCL F;  1DT9 A;  4IHJ B;  2CSL A;  2UYN A;  5HXZ A;  2HRY A;  3ZP4 A;  1VQM F;  4WBN A;  2AMT A;  2UZH A;  3N2G B;  4O4L A;  4BY9 D;  3FFM A;  5EYP A;  1Z5V A;  2PMP A;  3VIU A;  2HVY D;  4ZI7 A;  5LOV A;  1VH8 A;  1X52 A;  4U3J A;  1SA0 A;  2L26 A;  5IYZ A;  3MCQ A;  2UYJ A;  2VAM A;  2LBT A;  3CXC F;  4TUY A;  1RA4 A;  3I55 F;  3HKD B;  2DT4 A;  3CCU F;  1Q82 H;  1U43 A;  2QA4 F;  3IR9 A;  3J80 M;  3TD5 A;  1NQ3 A;  1YQN A;  3E1Y A;  3KIZ A;  4BVS A;  4O2B A;  3GHZ A;  3CCM F;  1PXW A;  1W55 A;  4EB6 B;  2ZOV A;  5HWE A;  1H48 A;  3CCE F;  3ESJ A;  3JAK B;  3M4S A;  5C8Y B;  5GIN C;  2WAL A;  1JD1 A;  1H47 A;  2RHH A;  2AIF A;  3CCS F;  5FNV A;  1UI9 A;  4RQO A;  4G88 A;  3LYB A;  4ZHQ B;  3ZP7 A;  1M90 H;  2I6R A;  5HXU A;  3NVK E;  3RA5 A;  2ZOD A;  2HS4 A;  4IIJ A;  5JH7 B;  3TD4 A;  1VHA A;  5FJ4 C;  4X3M A;  4BT7 A;  5J2T B;  5KMG A;  5LP6 C;  2Q1X A;  3TD3 A;  3VTI C;  2QI2 A;  3N4Y A;  5ITZ B;  1YJ9 F;  3CME F;  1X25 A;  4O4H B;  2FC3 A;  4DXD A;  2VAP A;  3QUW A;  2DYY A;  2YYE A;  1U40 A;  4YJ2 B;  5GAP K;  1FNJ A;  4FFB A;  1JFF B;  3L7Q A;  1CK2 A;  5GAN K;  2PHN A;  4I4T B;  3WXM B;  3CC2 F;  3HKE B;  4LCK A;  4X1Y A;  4B62 A;  3RYC A;  3MCA B;  5HP7 A;  5LP6 B;  3LWP C;  3CCQ F;  4C8I A;  3HKB B;  4F6R A;  2F9Z C;  2LBX A;  3OBY A;  4O2A A;  5MN5 A;  5LA6 A;  1VQP F;  5JQG A;  2HP3 A;  1W40 A;  3CC4 F;  1X7O A;  2HS3 A;  3S06 A;  1W42 A;  3WGK A;  1UFY A;  2KTU A;  3SIV A;  1FNK A;  3IKF A;  1CN7 A;  5EB0 A;  3QHD A;  4BVR A;  3F0D A;  5IYZ B;  3SIU A;  1E7K A;  3F0G A;  1Q8R A;  4ZK7 A;  1W5B A;  3WGM A;  1VQN F;  4C4W C;  3KJK A;  4TV8 B;  5GIO C;  4LNU B;  2G9I A;  1IPA A;  3JAL A;  4ZHY B;  3ERN A;  3CYQ A;  1KNJ A;  1YI2 F;  2RHJ A;  5EB1 B;  2Z1F A;  2JNB A;  3FPI A;  4PWT A;  3RA6 A;  5JVD B;  3V7E A;  4DRX B;  1VQ4 F;  4TV9 A;  1R1M A;  2MQE A;  5HY4 A;  4X20 B;  4BW0 B;  2Q1Y A;  2CHT A;  3RYF A;  3CCV F;  3CPQ A;  4B45 A;  3JAS B;  5CA1 B;  4ZHW A;  5HY1 A;  3C8L A;  4XCQ A;  3CB2 A;  4X1I B;  3UT5 B;  5LYJ B;  5JCO A;  2OTJ F;  4ZOL A;  1OAP A;  2Z1E A;  5CA0 A;  1Q81 H;  1W5F A;  1K9M H;  3MQW A;  5HP8 A;  1OFU A;  3WJP A;  2BO1 A;  3WJR A;  1VQ9 F;  3MDO A;  5AVM A;  1QVF F;  5J2U A;  3WGJ A;  1FSZ A;  4BVQ A;  3NMU C;  1K8A H;  2KG4 A;  3G4S F;  4X1Y B;  3S0Y A;  3ZOP A;  2RHO A;  5HY0 A;  1VQK F;  3HTN A;  5EO3 A;  4EI8 A;  1VQ7 F;  4EI7 A;  5IJ9 B;  3LFO A;  5DCV A;  4O4J A;  5EZY A;  2ZVY A;  4X1K A;  3CCR F;  3KE1 A;  3BYQ A;  3VO8 A;  3EOR A;  3CCJ F;  3OW2 F;  5G4V C;  2HX0 A;  3CC7 F;  1VQ5 F;  1K73 H;  4R40 B;  3LWR C;  3WPW A;  2HS0 A;  5CB4 A;  4NUT A;  3JAT B;  2VGM A;  3PAF A;  1ONI A;  3QTY A;  3DDN A;  3P0Z A;  4BT6 A;  5B8F A;  1YIJ F;  1JJ2 F;  5MN6 A;  3RYI B;  2HP0 A;  1W59 A;  4G4W A;  3IEW A;  3U0O A;  1YJW F;  3JAL B;  5JCO C;  3DC2 A;  3VI6 A;  4YJ3 A;  3KHN A;  1YGY A;  3HJW C;  5BMV B;  1NMU B;  3G6E F;  4HNA B;  1SDS A;  3JAW B;  5LXT A;  2QEX F;  1W3E X;  1W57 A;  5KX5 B;  2GLZ A;  1TVK A;  3RYH A;  3RYF B;  3M1X A;  2R75 1;  4IHJ A;  3G71 F;  4TZZ A;  2K1S A;  2B33 A;  4BT4 A;  3N2G A;  5FLX M;  3CMA F;  1Q7Y H;  1VQL F;  2UYP A;  2UYN B;  1XBI A;  2CZW A;  4WBN B;  2GZL A;  4O4L B;  5EYP B;  2I6D A;  4C8G A;  4M8I A;  1U3P A;  4ZI7 B;  5LOV B;  3HKD A;  2VXY A;  4U3J B;  5J2U B;  1SA0 B;  1YJN F;  4TUY B;  3GTZ A;  4RHA A;  2BTU A;  2KTV A;  3C9T A;  3WGL A;  3JAR A;  3CG6 A;  3Q8H A;  4EB6 A;  2OTL F;  1SZQ A;  3JAK A;  5C8Y A;  4O2B B;  3ZO8 A;  3J7A R;  4E6E A;  1NJI H;  2UYK A;  3FD6 A;  1U3L A;  3V4D A;  3ELC A;  3CPW F;  1J7H A;  1KQS F;  1FFX A;  1VK3 A;  4ZHQ A;  2BTQ B;  3VOB A;  5FNV B;  3HKC A;  5JH7 A;  1RLG A;  1GX1 A;  3OBW A;  3O85 A;  3ON1 A;  1IV2 A;  3WPX A;  4IIJ B;  4G4X A;  1XHO A;  5KMG B;  1ODE A;  1Z5W A;  5ITZ A;  3MBM A;  1VQV A;  3IKE A;  4O4H A;  4EI9 A;  5GON A;  1RQ7 A;  1KNK A;  3P4E A;  4B46 A;  2OTM A;  3D54 A;  2CHS A;  2LBW A;  3CD6 F;  3F0F A;  1QD9 A;  4YJ2 A;  1IV1 A;  2P6Y A;  1JFF A;  4BT5 A;  4I4T A;  3HKE A;  4G4Z A;  4FFB B;  3K2X A;  5EIB D;  2EWC A;  3N2K A;  3HKB A;  3RYC B;  1TVK B;  3D01 A;  4I55 A;  2LCA A;  1TUB A;  1W5E A;  1X7P A;  1RLU A;  3M84 A;  3R0P A;  3JCM M;  3IMP A;  1KC8 H;  3I56 F;  5IJ0 A;  4F6R B;  4O2A B;  3VMF B;  1VQ8 F;  3P10 A;  5LA6 B;  3V7Q A;  4BT3 A;  5JQG B;  3F6M A;  2CW4 A;  1W2B F;  4U39 A;  4BVT A;  3T80 A;  2VGN A;  5IT9 M;  5EWR A;  2W8B C;  1QAH A;  1XV2 A;  4TV8 A;  3WJQ A;  3C9R A;  4LNU A;  3NVI B;  3N4Z A;  2V9Y A;  5GIP C;  2BTO A;  3E22 A;  1Q86 H;  1IV4 A;  1DBF A;  3JAR B;  1T0K B;  2AIZ P;  3I3F A;  2CVL A;  2IQQ A;  4NQ3 A;  2Z1T A;  5JVD A;  4DRX A;  3HAX D;  2ZAU A;  3VYS C;  4X20 A;  2H6L A;  3RE3 A;  1T0A A;  1FFX B;  1IV3 A;  1S72 F;  3VYU C;  2ZVZ A;  3C9U A;  3VCZ A;  3B6N A;  4I50 A;  4TV9 B;  3HKC B;  1CLI A;  3LDT A;  3V3T A;  4G4Y A;  3E20 B;  5G4U C;  3JAS A;  3NK7 A;  5CA1 A;  4O4I A;  4X1I A;  3UT5 A;  4ZHV A;  5LYJ A;  1QVG F;  2Z01 A;  3AGK A;  2R6R 1;  2GVI A;  3C9S A;  1GO1 A;  3WGN A;  2YXZ A;  2Z1U A;  5GON B;  4ZOL B;  5CA0 B;  3F0E A;  3GYQ A; 
#chains in the Genus database with same CATH homology
 3CPW F;  2BO1 A;  1KQS F;  1QVF F;  3LWO C;  1W41 A;  1GO0 A;  3JAM M;  1M90 H;  4BVQ A;  3NMU C;  5HXU A;  1RLG A;  3RA5 A;  1N8R H;  1K8A H;  3NVK E;  3OBW A;  2KG4 A;  3O85 A;  3G4S F;  3ON1 A;  5FJ4 C;  4X3M A;  1H7M A;  1YIT F;  2FGY A;  5HY0 A;  1VQK F;  5EO3 A;  4EI8 A;  1VQ7 F;  4EI7 A;  1VQ6 F;  3LFO A;  5DCV A;  2QI2 A;  3N4Y A;  4EI9 A;  1VQ9 F;  3CCR F;  1YJ9 F;  3CME F;  2FC3 A;  2LBW A;  3CD6 F;  3CCJ F;  3OW2 F;  5G4V C;  3CC7 F;  1VQ5 F;  1K73 H;  1YHQ F;  3LWR C;  5GAP K;  4NUT A;  3LWQ C;  1VQO F;  1M1K H;  5GAN K;  4LCK A;  1CK2 A;  3CC2 F;  3WXM B;  2VGM A;  2ALE A;  3PAF A;  3MCA B;  1ZWZ A;  3D00 A;  1YIJ F;  3LWP C;  3CCQ F;  1JJ2 F;  2F9Z C;  1X7P A;  2LBX A;  3OBY A;  3NK6 A;  3JCM M;  1KC8 H;  3I56 F;  1VQP F;  3VMF B;  1W40 A;  1VQ8 F;  3V7Q A;  1YJW F;  3CC4 F;  1X7O A;  3J81 M;  1W42 A;  3VI6 A;  5HY2 A;  4X3L A;  2KTU A;  3SIV A;  2OZB A;  1W2B F;  3HJW C;  3PLA C;  1GZ0 A;  3LWV C;  1NMU B;  4BVT A;  3G6E F;  1CN7 A;  5A2Q M;  4BVR A;  2VGN A;  5IT9 M;  2OHW A;  3SIU A;  5EWR A;  1E7K A;  1KD1 H;  1SDS A;  2QEX F;  1W3E X;  2GLZ A;  1VQN F;  3NVI B;  4C4W C;  3N4Z A;  3G71 F;  5GIP C;  5GIO C;  1Q86 H;  3CCL F;  4TZZ A;  1DT9 A;  5FLX M;  1IPA A;  5HXZ A;  3CMA F;  1VQM F;  1Q7Y H;  1T0K B;  1VQL F;  4BY9 D;  3FFM A;  1XBI A;  2CZW A;  1YI2 F;  4NQ3 A;  2I6D A;  2HVY D;  1X52 A;  3HAX D;  2JNB A;  3V7E A;  3RA6 A;  3CXC F;  1VQ4 F;  1S72 F;  1RA4 A;  3I55 F;  5HY4 A;  4BW0 B;  3CCU F;  1YJN F;  1Q82 H;  3V3T A;  2QA4 F;  3E20 B;  5G4U C;  3CCV F;  3CPQ A;  3IR9 A;  3NK7 A;  3J80 M;  2KTV A;  3E1Y A;  1QVG F;  4BVS A;  3CG6 A;  5HY1 A;  3AGK A;  4XCQ A;  2OTL F;  3CCM F;  1PXW A;  2OTJ F;  3J7A R;  1GO1 A;  5HWE A;  3CCE F;  5GIN C;  2WAL A;  1Q81 H;  1K9M H;  1NJI H;  2AIF A;  3CCS F;  3GYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...