3G4SF

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g4sF00
2VGMA 1DT9A 3J7AR 3JAMM 3RA6A 1XBIA 5GAPK 3CD6F 1H7MA 3CCLF 1VQLF 3LWPC 2QA4F 4X3LA 3VMFB 5EO3A 5G4UC 1GO1A 3NMUC 1VQ6F 3CCRF 3CCSF 3G6EF 4BY9D 1CN7A 3FFMA 1M1KH 4NUTA 5GANK 1YITF 1VQ5F 3CPQA 1X52A 3MCAB 3CMEF 1VQOF 5FJ4C 2I6DA 3LWQC 1YJNF 3J81M 1IPAA 5GIPC 3CPWF 1VQPF 3CCMF 1T0KB 1VQ7F 5DCVA 1NMUB 3LFOA 1S72F 3NK7A 3CXCF 1PXWA 3G71F 1Q86H 1VQNF 1YIJF 1W2BF 3OBYA 2OHWA 3E20B 5IT9M 1K73H 1GZ0A 3CCUF 3CCEF 1YHQF 3AGKA 1Q82H 2KG4A 3PLAC 2QI2A 2KTVA 2OTLF 1JJ2F 1W40A 1YJWF 3OW2F 1ZWZA 1SDSA 5FLXM 1K9MH 3CC7F 2AIFA 2KTUA 3CCVF 1KQSF 2HVYD 3NVKE 1X7PA 4C4WC 3RA5A 5A2QM 1E7KA 3LWOC 1CK2A 1X7OA 1K8AH 2CZWA 3NK6A 3NVIB 1VQ8F 3N4YA 1GO0A 1VQ9F 1RA4A 1N8RH 4TZZA 1YJ9F 3E1YA 1KC8H 3HJWC 3LWRC 3CC2F 3IR9A 3CG6A 3O85A 3JCMM 3CMAF 2WALA 1W41A 1YI2F 1W3EX 5GINC 1QVGF 1W42A 2FC3A 5G4VC 3HAXD 3PAFA 1M90H 2LBXA 3GYQA 2JNBA 4X3MA 3G4SF 3ON1A 3V7QA 2LBWA 3CC4F 3I56F 1NJIH 3V7EA 1VQMF 2OZBA 3WXMB 5EWRA 4LCKA 1Q81H 3I55F 1QVFF 3N4ZA 2VGNA 1VQ4F 1VQKF 1RLGA 5GIOC 2BO1A 3LWVC 3SIVA 3CCQF 1Q7YH 2OTJF 3J80M 1KD1H 2QEXF 3VI6A 4BW0B 2ALEA 3CCJF 3OBWA 3SIUA
chains in the Genus database with same CATH superfamily
1DT9A 4X1IB 5GAPK 2Z1UA 5IYZA 2IG8A 4YJ3B 3VMFB 4G4WA 4BT3A 5G4UC 3HKCA 3JVHA 3NMUC 5CB4A 3M84A 1JFFA 2EWCA 3F0GA 1VQ6F 2ZOVA 4BVTA 3VCZA 4NUTA 2R751 1VQ5F 1JY8A 3JAWA 4O4HA 2OTMA 1W59A 2HQSC 1VQPF 3OONA 4M8IA 2RHOA 3WJRA 5JH7B 3ELCA 4B5CA 2CHTA 2HP0B 4YJ2B 4O2AB 3HKBA 2F9ZC 3WJPA 3OBYA 2OHWA 3HKBB 1K73H 3CCUF 2V9YA 3IKFA 1YHQF 3IMPA 2KG4A 4TV9A 3JAKA 3KJKA 1RQ7A 1UI9A 3HKDA 4I55B 2AIZP 3S02A 5FNVA 3WPWA 2N48A 3FD6A 4I50B 5LP6C 5HP8A 3NVKE 5JQGB 1W5FA 3JATA 5KX5A 1E7KA 3E22B 3LWOC 2CZWA 2HS0A 5HWEA 1W57A 1IV4A 2QTPA 1UFYA 4KWEA 5GONA 5EIBD 5LXTB 3MQWA 5LA6B 1FNJA 3LWRC 4IHJB 2UZHA 3HKEA 3CG6A 3IEWA 5MN5A 3O85A 3RYFA 5LOVA 1COMA 3P10A 2FC3A 4ZHVA 1QVGF 1TVKA 4DRXA 3VYTC 4RQOA 4WBNA 4X3MA 4C8IA 4ZI7B 3G4SF 3V7QA 1Q8RA 2RHLA 4LCKA 4TV8A 4G4YA 3V3TA 5JCOA 2UYNA 5B8FA 4E6EA 5MN4A 3K0TA 3F0DA 3SIVA 2GLZA 2ZAUA 3F0FA 1JN1A 3VOBA 5KMGA 1KD1H 3WPXA 1SA0A 3F6MA 1XRGA 3N2GA 4X1YB 5HXUA 3P4EA 2VGMA 4B45A 4ZHQB 3J7AR 2UYJA 4X20A 3RA6A 2KGWA 2BTOA 3CCLF 3C9UA 1VQLF 3LWPC 2QA4F 3DC2A 2RHHA 5BMVB 3S0WA 5IJ9B 1VK3A 3CCRF 2DT4A 1M1KH 1YITF 1X52A 4ZHWA 5LYJB 3F0EA 1YJNF 1RLUA 1Z5WA 1IPAA 5GIPC 5IJ0B 4IIJA 5EIBC 4TUYB 2Q1XA 4BT4A 4X1IA 3D54A 1FFXB 3HTNA 4BT2A 1PXWA 2HRYA 4YJ3A 3WGJA 3EORA 1W2BF 1VQNF 2ZVZA 4O4JB 4PWTA 3S0YA 4O4LA 4EI7A 3CCEF 3IEQA 3AGKA 1Q82H 4O4LB 4BT7A 4LNUB 3RE3A 1GX1A 1J7HA 5JH7A 1U3PA 3JARB 5LP6A 1VH8A 2KTUA 2HP0A 5LP6B 4YJ2A 2CSLA 2GZLA 4O2AA 1X7PA 4C4WC 3MBMA 2YXZA 4U39A 1X7OA 3NVIB 1RQ2A 1GO0A 4G4XA 1ODEA 1RA4A 1N8RH 4TZZA 1YJ9F 5J2UB 5EZYB 3CC2F 3IR9A 4I55A 1CLIA 1XHOA 2MQEA 5HY1A 3CMAF 1KNKA 2WALA 3RYCB 2UYKA 4I50A 4BVSA 4G88A 3RYHB 5JQGA 2VAMA 5J2TA 3E22A 3ON1A 3CC4F 5J2TB 2P6YA 5CA0A 4HNAB 1KNJA 5EWRA 2HS3A 5HY0A 5CA0B 1Q81H 1IV1A 2RB9A 2H6LA 4NQ3A 3T80A 5LXTA 1RLGA 3S0HA 5LA6A 2BO1A 4IHJA 4O2BB 3VYUC 5JVDB 3CCJF 4U3JA 5EAZA 4U3JB 2FGYA 3CD6F 2LCAA 4ZI7A 2BTQB 4X3LA 4NWOB 2ZVYA 5EO3A 3I7TA 4X1KB 1H47A 3JALB 2VAPA 3D00A 3R0PA 1SZQA 1QD9A 3CCSF 3G6EF 2K1SA 3L7QA 1H48A 3CB2A 5GANK 1FSZA 3MCQA 1IV3A 3CPQA 3M1XA 2I6DA 3TD4A 3LWQC 3K12A 2UYPA 4O4IA 3RYIB 4X1YA 3CCMF 2ZF8A 4O4IB 1T0KB 1VQ7F 5DCVA 2G9IA 4ZHQA 4G4VA 3LFOA 1S72F 2YYEA 4FFBB 2Z1TA 4RHAA 1YGYA 2B33A 2I6RA 5MN6A 4I4TB 3DDNA 5BMVA 3GHZA 5EB0A 5EB1B 4EB6B 5IJ9A 1GZ0A 3KHNA 2PMPA 1IV2A 1U40A 1XV2A 2CW4A 2ZODA 3C9RA 2QI2A 3JASB 5LYJA 3WGMA 4ERHA 1JJ2F 5AVMA 1YJWF 5IJ0A 2HP3A 3D01A 3QUWA 4TUYA 1ZWZA 5EYPB 3VOAA 1VQVA 2HS4A 3CC7F 5CA1B 1FFXA 2AIFA 3ZO8A 3CCVF 1W5AA 3C8LA 1KQSF 2HVYD 2CWJA 2DYYA 3ERNA 4ZOLA 4O4JA 3RA5A 3VTIC 4ZOLB 4F6RB 2BTUA 1TUBA 1VQ8F 3S06A 4B46A 1VQ9F 1TUBB 3UT5B 5ITZB 3C9TA 3E1YA 4LNUA 4C8GA 3KJJA 1FNKA 2IAFA 3S03A 4EI8A 3N2KB 3JCMM 5C8YB 3JARA 1W3EX 2NMUA 3CYPB 5GINC 1W42A 3PAFA 1M90H 2VAWA 4BVQA 3GYQA 4EI9A 3ZP7A 1OFUA 3GTZA 2JNBA 5IYZB 2Q1YA 1QU9A 3LMEA 2OZBA 3HKCB 3WXMB 3B6NA 5CB4B 1JFFB 3I55F 3KIZA 1VQ4F 1VQKF 5GIOC 3LWVC 5J2UA 2R6R1 2Z1FA 3JAWB 5EZYA 3CCQF 1Q7YH 4O4HB 1U43A 2CHSA 2ALEA 1U3LA 3RYCA 3OBWA 4ZHYB 3SIUA 3JAMM 1XBIA 3RYHA 1H7MA 2HX0A 4DXDA 4HNAA 4C82A 1GO1A 4ZK7A 3FPIA 2Z1EA 4BY9D 1NQ3A 1CN7A 3FFMA 1W581 2LBTA 4R40B 3CYQA 2VXYA 3WGNA 4BVRA 3TD5A 4TV9B 3MCAB 3CMEF 1VQOF 5FJ4C 4O2BA 1YQNA 3JAKB 3IKEA 3J81M 3WJQA 5JVDA 3HWUA 2GVIA 3CPWF 3HKDB 4BT5A 1NMUB 3NK7A 1PF5A 3CXCF 5FNVB 2W8BC 3WGKA 3G71F 3P0ZA 4B62A 1Q86H 1YIJF 3LDTA 4X1KA 3JALA 3JATB 5KX5B 3E20B 1X25A 5IT9M 3TD3A 3VIUA 1R1MA 1QAHA 2H8EA 1W5BA 4C8EA 3PLAC 5GONB 3ZOPA 2KTVA 2OTLF 2RHJA 2H8CA 1W40A 3RYIA 3OW2F 3QTYA 4G4ZA 3HKEB 1SDSA 5FLXM 1K9MH 3RYFB 5HP7A 3KE1A 3LYBA 5LOVB 3C9SA 5HY4A 4FFBA 1Z5VA 1TVKB 4DRXB 3VO8A 4I4TA 4C81A 1VHAA 4WBNB 4EB6A 3BYQA 2CVLA 5A2QM 1CK2A 1K8AH 3NK6A 3I3FA 4TV8B 3N4YA 3WGLA 4BT6A 3JASA 2UYNB 1KC8H 3K2XA 3HJWC 5HY2A 5KMGB 2L26A 1OAPA 1SA0B 5EYPA 3N2GB 1W41A 1YI2F 3MDOA 5CA1A 3K14A 3ZP4A 5G4VC 3HAXD 2LBXA 3ESJA 4X20B 3FD5A 4XCQA 2LBWA 1W5EA 1ONIA 5HXZA 3I56F 3M4SA 1NJIH 1VQMF 3V7EA 1T0AA 3VYSC 4F6RA 3V4DA 3U0OA 1QVFF 3Q8HA 3N4ZA 2VGNA 5ITZA 3UT5A 3QHDA 1W55A 2Z01A 5JCOC 2PHNA 2OTJF 2IQQA 3J80M 3FBAA 2HRUA 2QEXF 1DBFA 3N2KA 5C8YA 4BW0B 3VI6A 4IIJB 1JD1A 2AMTA
chains in the Genus database with same CATH topology
2VGMA 1DT9A 3J7AR 2FGYA 3RA6A 3JAMM 1XBIA 5GAPK 3CD6F 1H7MA 3CCLF 1VQLF 3LWPC 2QA4F 4X3LA 3VMFB 5EO3A 5G4UC 1GO1A 3NMUC 3D00A 1VQ6F 3CCRF 3CCSF 3G6EF 4BY9D 1CN7A 4BVTA 3FFMA 1M1KH 4NUTA 5GANK 4BVRA 1YITF 1VQ5F 3CPQA 1X52A 3MCAB 3CMEF 1VQOF 5FJ4C 2I6DA 3LWQC 1YJNF 3J81M 1IPAA 5GIPC 3CPWF 1VQPF 3CCMF 1T0KB 1VQ7F 5DCVA 1NMUB 3LFOA 1S72F 3NK7A 3CXCF 1PXWA 3G71F 1Q86H 1VQNF 1YIJF 1W2BF 2F9ZC 3OBYA 2OHWA 3E20B 5IT9M 1K73H 1GZ0A 4EI7A 3CCUF 3CCEF 1YHQF 3AGKA 1Q82H 2KG4A 3PLAC 2QI2A 2KTVA 2OTLF 1JJ2F 1W40A 1YJWF 3OW2F 1ZWZA 1SDSA 5FLXM 1K9MH 3CC7F 5HY4A 2AIFA 2KTUA 3CCVF 1KQSF 2HVYD 3NVKE 1X7PA 4C4WC 3RA5A 5A2QM 1E7KA 3LWOC 1CK2A 1X7OA 1K8AH 2CZWA 3NK6A 5HWEA 3NVIB 1VQ8F 3N4YA 1GO0A 1VQ9F 1RA4A 1N8RH 4TZZA 1YJ9F 3E1YA 1KC8H 3HJWC 3LWRC 5HY2A 3CC2F 3IR9A 4EI8A 3CG6A 3O85A 3JCMM 5HY1A 3CMAF 2WALA 1W41A 1YI2F 1W3EX 5GINC 1QVGF 1W42A 2FC3A 5G4VC 3HAXD 3PAFA 1M90H 4BVSA 4BVQA 2LBXA 3GYQA 4EI9A 2JNBA 4X3MA 4XCQA 3G4SF 3ON1A 3V7QA 2LBWA 3CC4F 5HXZA 3I56F 1NJIH 3V7EA 1VQMF 2OZBA 3WXMB 5EWRA 4LCKA 5HY0A 3I55F 1Q81H 1QVFF 3N4ZA 2VGNA 1VQ4F 1VQKF 3V3TA 4NQ3A 1RLGA 5GIOC 2BO1A 3LWVC 3SIVA 2GLZA 3CCQF 1Q7YH 2OTJF 3J80M 1KD1H 2QEXF 3VI6A 4BW0B 2ALEA 3CCJF 3OBWA 5HXUA 3SIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGM A;  1DT9 A;  3J7A R;  3JAM M;  3RA6 A;  1XBI A;  5GAP K;  3CD6 F;  1H7M A;  3CCL F;  1VQL F;  3LWP C;  2QA4 F;  4X3L A;  3VMF B;  5EO3 A;  5G4U C;  1GO1 A;  3NMU C;  1VQ6 F;  3CCR F;  3CCS F;  3G6E F;  4BY9 D;  1CN7 A;  3FFM A;  1M1K H;  4NUT A;  5GAN K;  1YIT F;  1VQ5 F;  3CPQ A;  1X52 A;  3MCA B;  3CME F;  1VQO F;  5FJ4 C;  2I6D A;  3LWQ C;  1YJN F;  3J81 M;  1IPA A;  5GIP C;  3CPW F;  1VQP F;  3CCM F;  1T0K B;  1VQ7 F;  5DCV A;  1NMU B;  3LFO A;  1S72 F;  3NK7 A;  3CXC F;  1PXW A;  3G71 F;  1Q86 H;  1VQN F;  1YIJ F;  1W2B F;  3OBY A;  2OHW A;  3E20 B;  5IT9 M;  1K73 H;  1GZ0 A;  3CCU F;  3CCE F;  1YHQ F;  3AGK A;  1Q82 H;  2KG4 A;  3PLA C;  2QI2 A;  2KTV A;  2OTL F;  1JJ2 F;  1W40 A;  1YJW F;  3OW2 F;  1ZWZ A;  1SDS A;  5FLX M;  1K9M H;  3CC7 F;  2AIF A;  2KTU A;  3CCV F;  1KQS F;  2HVY D;  3NVK E;  1X7P A;  4C4W C;  3RA5 A;  5A2Q M;  1E7K A;  3LWO C;  1CK2 A;  1X7O A;  1K8A H;  2CZW A;  3NK6 A;  3NVI B;  1VQ8 F;  3N4Y A;  1GO0 A;  1VQ9 F;  1RA4 A;  1N8R H;  4TZZ A;  1YJ9 F;  3E1Y A;  1KC8 H;  3HJW C;  3LWR C;  3CC2 F;  3IR9 A;  3CG6 A;  3O85 A;  3JCM M;  3CMA F;  2WAL A;  1W41 A;  1YI2 F;  1W3E X;  5GIN C;  1QVG F;  1W42 A;  2FC3 A;  5G4V C;  3HAX D;  3PAF A;  1M90 H;  2LBX A;  3GYQ A;  2JNB A;  4X3M A;  3G4S F;  3ON1 A;  3V7Q A;  2LBW A;  3CC4 F;  3I56 F;  1NJI H;  3V7E A;  1VQM F;  2OZB A;  3WXM B;  5EWR A;  4LCK A;  1Q81 H;  3I55 F;  1QVF F;  3N4Z A;  2VGN A;  1VQ4 F;  1VQK F;  1RLG A;  5GIO C;  2BO1 A;  3LWV C;  3SIV A;  3CCQ F;  1Q7Y H;  2OTJ F;  3J80 M;  1KD1 H;  2QEX F;  3VI6 A;  4BW0 B;  2ALE A;  3CCJ F;  3OBW A;  3SIU A; 
#chains in the Genus database with same CATH topology
 1DT9 A;  4X1I B;  5GAP K;  2Z1U A;  5IYZ A;  2IG8 A;  4YJ3 B;  3VMF B;  4G4W A;  4BT3 A;  5G4U C;  3HKC A;  3JVH A;  3NMU C;  5CB4 A;  3M84 A;  1JFF A;  2EWC A;  3F0G A;  1VQ6 F;  2ZOV A;  4BVT A;  3VCZ A;  4NUT A;  2R75 1;  1VQ5 F;  1JY8 A;  3JAW A;  4O4H A;  2OTM A;  1W59 A;  2HQS C;  1VQP F;  3OON A;  4M8I A;  2RHO A;  3WJR A;  5JH7 B;  3ELC A;  4B5C A;  2CHT A;  2HP0 B;  4YJ2 B;  4O2A B;  3HKB A;  2F9Z C;  3WJP A;  3OBY A;  2OHW A;  3HKB B;  1K73 H;  3CCU F;  2V9Y A;  3IKF A;  1YHQ F;  3IMP A;  2KG4 A;  4TV9 A;  3JAK A;  3KJK A;  1RQ7 A;  1UI9 A;  3HKD A;  4I55 B;  2AIZ P;  3S02 A;  5FNV A;  3WPW A;  2N48 A;  3FD6 A;  4I50 B;  5LP6 C;  5HP8 A;  3NVK E;  5JQG B;  1W5F A;  3JAT A;  5KX5 A;  1E7K A;  3E22 B;  3LWO C;  2CZW A;  2HS0 A;  5HWE A;  1W57 A;  1IV4 A;  2QTP A;  1UFY A;  4KWE A;  5GON A;  5EIB D;  5LXT B;  3MQW A;  5LA6 B;  1FNJ A;  3LWR C;  4IHJ B;  2UZH A;  3HKE A;  3CG6 A;  3IEW A;  5MN5 A;  3O85 A;  3RYF A;  5LOV A;  1COM A;  3P10 A;  2FC3 A;  4ZHV A;  1QVG F;  1TVK A;  4DRX A;  3VYT C;  4RQO A;  4WBN A;  4X3M A;  4C8I A;  4ZI7 B;  3G4S F;  3V7Q A;  1Q8R A;  2RHL A;  4LCK A;  4TV8 A;  4G4Y A;  3V3T A;  5JCO A;  2UYN A;  5B8F A;  4E6E A;  5MN4 A;  3K0T A;  3F0D A;  3SIV A;  2GLZ A;  2ZAU A;  3F0F A;  1JN1 A;  3VOB A;  5KMG A;  1KD1 H;  3WPX A;  1SA0 A;  3F6M A;  1XRG A;  3N2G A;  4X1Y B;  5HXU A;  3P4E A;  2VGM A;  4B45 A;  4ZHQ B;  3J7A R;  2UYJ A;  4X20 A;  3RA6 A;  2KGW A;  2BTO A;  3CCL F;  3C9U A;  1VQL F;  3LWP C;  2QA4 F;  3DC2 A;  2RHH A;  5BMV B;  3S0W A;  5IJ9 B;  1VK3 A;  3CCR F;  2DT4 A;  1M1K H;  1YIT F;  1X52 A;  4ZHW A;  5LYJ B;  3F0E A;  1YJN F;  1RLU A;  1Z5W A;  1IPA A;  5GIP C;  5IJ0 B;  4IIJ A;  5EIB C;  4TUY B;  2Q1X A;  4BT4 A;  4X1I A;  3D54 A;  1FFX B;  3HTN A;  4BT2 A;  1PXW A;  2HRY A;  4YJ3 A;  3WGJ A;  3EOR A;  1W2B F;  1VQN F;  2ZVZ A;  4O4J B;  4PWT A;  3S0Y A;  4O4L A;  4EI7 A;  3CCE F;  3IEQ A;  3AGK A;  1Q82 H;  4O4L B;  4BT7 A;  4LNU B;  3RE3 A;  1GX1 A;  1J7H A;  5JH7 A;  1U3P A;  3JAR B;  5LP6 A;  1VH8 A;  2KTU A;  2HP0 A;  5LP6 B;  4YJ2 A;  2CSL A;  2GZL A;  4O2A A;  1X7P A;  4C4W C;  3MBM A;  2YXZ A;  4U39 A;  1X7O A;  3NVI B;  1RQ2 A;  1GO0 A;  4G4X A;  1ODE A;  1RA4 A;  1N8R H;  4TZZ A;  1YJ9 F;  5J2U B;  5EZY B;  3CC2 F;  3IR9 A;  4I55 A;  1CLI A;  1XHO A;  2MQE A;  5HY1 A;  3CMA F;  1KNK A;  2WAL A;  3RYC B;  2UYK A;  4I50 A;  4BVS A;  4G88 A;  3RYH B;  5JQG A;  2VAM A;  5J2T A;  3E22 A;  3ON1 A;  3CC4 F;  5J2T B;  2P6Y A;  5CA0 A;  4HNA B;  1KNJ A;  5EWR A;  2HS3 A;  5HY0 A;  5CA0 B;  1Q81 H;  1IV1 A;  2RB9 A;  2H6L A;  4NQ3 A;  3T80 A;  5LXT A;  1RLG A;  3S0H A;  5LA6 A;  2BO1 A;  4IHJ A;  4O2B B;  3VYU C;  5JVD B;  3CCJ F;  4U3J A;  5EAZ A;  4U3J B;  2FGY A;  3CD6 F;  2LCA A;  4ZI7 A;  2BTQ B;  4X3L A;  4NWO B;  2ZVY A;  5EO3 A;  3I7T A;  4X1K B;  1H47 A;  3JAL B;  2VAP A;  3D00 A;  3R0P A;  1SZQ A;  1QD9 A;  3CCS F;  3G6E F;  2K1S A;  3L7Q A;  1H48 A;  3CB2 A;  5GAN K;  1FSZ A;  3MCQ A;  1IV3 A;  3CPQ A;  3M1X A;  2I6D A;  3TD4 A;  3LWQ C;  3K12 A;  2UYP A;  4O4I A;  3RYI B;  4X1Y A;  3CCM F;  2ZF8 A;  4O4I B;  1T0K B;  1VQ7 F;  5DCV A;  2G9I A;  4ZHQ A;  4G4V A;  3LFO A;  1S72 F;  2YYE A;  4FFB B;  2Z1T A;  4RHA A;  1YGY A;  2B33 A;  2I6R A;  5MN6 A;  4I4T B;  3DDN A;  5BMV A;  3GHZ A;  5EB0 A;  5EB1 B;  4EB6 B;  5IJ9 A;  1GZ0 A;  3KHN A;  2PMP A;  1IV2 A;  1U40 A;  1XV2 A;  2CW4 A;  2ZOD A;  3C9R A;  2QI2 A;  3JAS B;  5LYJ A;  3WGM A;  4ERH A;  1JJ2 F;  5AVM A;  1YJW F;  5IJ0 A;  2HP3 A;  3D01 A;  3QUW A;  4TUY A;  1ZWZ A;  5EYP B;  3VOA A;  1VQV A;  2HS4 A;  3CC7 F;  5CA1 B;  1FFX A;  2AIF A;  3ZO8 A;  3CCV F;  1W5A A;  3C8L A;  1KQS F;  2HVY D;  2CWJ A;  2DYY A;  3ERN A;  4ZOL A;  4O4J A;  3RA5 A;  3VTI C;  4ZOL B;  4F6R B;  2BTU A;  1TUB A;  1VQ8 F;  3S06 A;  4B46 A;  1VQ9 F;  1TUB B;  3UT5 B;  5ITZ B;  3C9T A;  3E1Y A;  4LNU A;  4C8G A;  3KJJ A;  1FNK A;  2IAF A;  3S03 A;  4EI8 A;  3N2K B;  3JCM M;  5C8Y B;  3JAR A;  1W3E X;  2NMU A;  3CYP B;  5GIN C;  1W42 A;  3PAF A;  1M90 H;  2VAW A;  4BVQ A;  3GYQ A;  4EI9 A;  3ZP7 A;  1OFU A;  3GTZ A;  2JNB A;  5IYZ B;  2Q1Y A;  1QU9 A;  3LME A;  2OZB A;  3HKC B;  3WXM B;  3B6N A;  5CB4 B;  1JFF B;  3I55 F;  3KIZ A;  1VQ4 F;  1VQK F;  5GIO C;  3LWV C;  5J2U A;  2R6R 1;  2Z1F A;  3JAW B;  5EZY A;  3CCQ F;  1Q7Y H;  4O4H B;  1U43 A;  2CHS A;  2ALE A;  1U3L A;  3RYC A;  3OBW A;  4ZHY B;  3SIU A;  3JAM M;  1XBI A;  3RYH A;  1H7M A;  2HX0 A;  4DXD A;  4HNA A;  4C82 A;  1GO1 A;  4ZK7 A;  3FPI A;  2Z1E A;  4BY9 D;  1NQ3 A;  1CN7 A;  3FFM A;  1W58 1;  2LBT A;  4R40 B;  3CYQ A;  2VXY A;  3WGN A;  4BVR A;  3TD5 A;  4TV9 B;  3MCA B;  3CME F;  1VQO F;  5FJ4 C;  4O2B A;  1YQN A;  3JAK B;  3IKE A;  3J81 M;  3WJQ A;  5JVD A;  3HWU A;  2GVI A;  3CPW F;  3HKD B;  4BT5 A;  1NMU B;  3NK7 A;  1PF5 A;  3CXC F;  5FNV B;  2W8B C;  3WGK A;  3G71 F;  3P0Z A;  4B62 A;  1Q86 H;  1YIJ F;  3LDT A;  4X1K A;  3JAL A;  3JAT B;  5KX5 B;  3E20 B;  1X25 A;  5IT9 M;  3TD3 A;  3VIU A;  1R1M A;  1QAH A;  2H8E A;  1W5B A;  4C8E A;  3PLA C;  5GON B;  3ZOP A;  2KTV A;  2OTL F;  2RHJ A;  2H8C A;  1W40 A;  3RYI A;  3OW2 F;  3QTY A;  4G4Z A;  3HKE B;  1SDS A;  5FLX M;  1K9M H;  3RYF B;  5HP7 A;  3KE1 A;  3LYB A;  5LOV B;  3C9S A;  5HY4 A;  4FFB A;  1Z5V A;  1TVK B;  4DRX B;  3VO8 A;  4I4T A;  4C81 A;  1VHA A;  4WBN B;  4EB6 A;  3BYQ A;  2CVL A;  5A2Q M;  1CK2 A;  1K8A H;  3NK6 A;  3I3F A;  4TV8 B;  3N4Y A;  3WGL A;  4BT6 A;  3JAS A;  2UYN B;  1KC8 H;  3K2X A;  3HJW C;  5HY2 A;  5KMG B;  2L26 A;  1OAP A;  1SA0 B;  5EYP A;  3N2G B;  1W41 A;  1YI2 F;  3MDO A;  5CA1 A;  3K14 A;  3ZP4 A;  5G4V C;  3HAX D;  2LBX A;  3ESJ A;  4X20 B;  3FD5 A;  4XCQ A;  2LBW A;  1W5E A;  1ONI A;  5HXZ A;  3I56 F;  3M4S A;  1NJI H;  1VQM F;  3V7E A;  1T0A A;  3VYS C;  4F6R A;  3V4D A;  3U0O A;  1QVF F;  3Q8H A;  3N4Z A;  2VGN A;  5ITZ A;  3UT5 A;  3QHD A;  1W55 A;  2Z01 A;  5JCO C;  2PHN A;  2OTJ F;  2IQQ A;  3J80 M;  3FBA A;  2HRU A;  2QEX F;  1DBF A;  3N2K A;  5C8Y A;  4BW0 B;  3VI6 A;  4IIJ B;  1JD1 A;  2AMT A; 
#chains in the Genus database with same CATH homology
 2VGM A;  1DT9 A;  3J7A R;  2FGY A;  3RA6 A;  3JAM M;  1XBI A;  5GAP K;  3CD6 F;  1H7M A;  3CCL F;  1VQL F;  3LWP C;  2QA4 F;  4X3L A;  3VMF B;  5EO3 A;  5G4U C;  1GO1 A;  3NMU C;  3D00 A;  1VQ6 F;  3CCR F;  3CCS F;  3G6E F;  4BY9 D;  1CN7 A;  4BVT A;  3FFM A;  1M1K H;  4NUT A;  5GAN K;  4BVR A;  1YIT F;  1VQ5 F;  3CPQ A;  1X52 A;  3MCA B;  3CME F;  1VQO F;  5FJ4 C;  2I6D A;  3LWQ C;  1YJN F;  3J81 M;  1IPA A;  5GIP C;  3CPW F;  1VQP F;  3CCM F;  1T0K B;  1VQ7 F;  5DCV A;  1NMU B;  3LFO A;  1S72 F;  3NK7 A;  3CXC F;  1PXW A;  3G71 F;  1Q86 H;  1VQN F;  1YIJ F;  1W2B F;  2F9Z C;  3OBY A;  2OHW A;  3E20 B;  5IT9 M;  1K73 H;  1GZ0 A;  4EI7 A;  3CCU F;  3CCE F;  1YHQ F;  3AGK A;  1Q82 H;  2KG4 A;  3PLA C;  2QI2 A;  2KTV A;  2OTL F;  1JJ2 F;  1W40 A;  1YJW F;  3OW2 F;  1ZWZ A;  1SDS A;  5FLX M;  1K9M H;  3CC7 F;  5HY4 A;  2AIF A;  2KTU A;  3CCV F;  1KQS F;  2HVY D;  3NVK E;  1X7P A;  4C4W C;  3RA5 A;  5A2Q M;  1E7K A;  3LWO C;  1CK2 A;  1X7O A;  1K8A H;  2CZW A;  3NK6 A;  5HWE A;  3NVI B;  1VQ8 F;  3N4Y A;  1GO0 A;  1VQ9 F;  1RA4 A;  1N8R H;  4TZZ A;  1YJ9 F;  3E1Y A;  1KC8 H;  3HJW C;  3LWR C;  5HY2 A;  3CC2 F;  3IR9 A;  4EI8 A;  3CG6 A;  3O85 A;  3JCM M;  5HY1 A;  3CMA F;  2WAL A;  1W41 A;  1YI2 F;  1W3E X;  5GIN C;  1QVG F;  1W42 A;  2FC3 A;  5G4V C;  3HAX D;  3PAF A;  1M90 H;  4BVS A;  4BVQ A;  2LBX A;  3GYQ A;  4EI9 A;  2JNB A;  4X3M A;  4XCQ A;  3G4S F;  3ON1 A;  3V7Q A;  2LBW A;  3CC4 F;  5HXZ A;  3I56 F;  1NJI H;  3V7E A;  1VQM F;  2OZB A;  3WXM B;  5EWR A;  4LCK A;  5HY0 A;  3I55 F;  1Q81 H;  1QVF F;  3N4Z A;  2VGN A;  1VQ4 F;  1VQK F;  3V3T A;  4NQ3 A;  1RLG A;  5GIO C;  2BO1 A;  3LWV C;  3SIV A;  2GLZ A;  3CCQ F;  1Q7Y H;  2OTJ F;  3J80 M;  1KD1 H;  2QEX F;  3VI6 A;  4BW0 B;  2ALE A;  3CCJ F;  3OBW A;  5HXU A;  3SIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...