1Q86H

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q86H00
1XBIA 2KTUA 3V7EA 1YJNF 4X3MA 3CMAF 3SIUA 3OBWA 3RA5A 2OHWA 4C4WC 1W2BF 5DCVA 1NMUB 3CCMF 3CG6A 1YIJF 1VQKF 1K8AH 3CCRF 4NUTA 1IPAA 3IR9A 3CCVF 5IT9M 3RA6A 2AIFA 1VQMF 3I55F 3CC7F 1YJWF 5GANK 1GO1A 1SDSA 1X7OA 3CCQF 5G4VC 1VQNF 2OZBA 3MCAB 2HVYD 2KTVA 1Q82H 3J81M 3WXMB 3OBYA 3J7AR 1T0KB 3HJWC 3NK6A 2BO1A 2JNBA 2QI2A 3G71F 1PXWA 3G4SF 2VGNA 1W41A 1VQ7F 1VQPF 3LWQC 1YITF 1CK2A 4TZZA 4BY9D 3V7QA 2I6DA 5G4UC 3CC4F 2CZWA 3E1YA 3PLAC 3GYQA 1X7PA 1YHQF 5EWRA 3G6EF 3N4ZA 4BW0B 3CXCF 1Q86H 3SIVA 1VQ9F 1NJIH 1QVGF 1VQLF 1KD1H 1E7KA 3CCSF 3JCMM 1H7MA 2OTLF 1W3EX 1W40A 3CC2F 3CCJF 3PAFA 1K73H 1W42A 3I56F 3HAXD 3N4YA 5FJ4C 1KC8H 3AGKA 1S72F 3NVKE 1DT9A 1VQ8F 3VI6A 1VQ4F 1VQOF 4LCKA 2OTJF 1JJ2F 3VMFB 1YI2F 3LFOA 5GIOC 1YJ9F 1KQSF 1N8RH 3CCUF 3E20B 3ON1A 3CPQA 2WALA 5EO3A 5GAPK 2FC3A 3LWOC 2VGMA 2QEXF 1CN7A 1RA4A 1GO0A 2LBWA 3CMEF 1QVFF 2LBXA 2ALEA 3NMUC 5FLXM 3CCLF 1Q7YH 3JAMM 1GZ0A 2QA4F 1VQ5F 3J80M 3O85A 3LWRC 2KG4A 5A2QM 5GIPC 1RLGA 3OW2F 5GINC 1X52A 1VQ6F 3CD6F 3NK7A 1M90H 3CCEF 3FFMA 3LWVC 1K9MH 1M1KH 1Q81H 3NVIB 3CPWF 3LWPC 1ZWZA 4X3LA
chains in the Genus database with same CATH superfamily
1XBIA 3LMEA 5CB4B 1KNKA 5IYZB 4X3MA 4ZI7A 2YYEA 5CA1A 3OBWA 1JFFB 3F6MA 5HP7A 2OHWA 4C4WC 3S0YA 5DCVA 3CG6A 2LCAA 4BT4A 3S02A 4WBNB 4BVTA 3M4SA 3N2GA 4BVSA 4ZI7B 3IR9A 5CA1B 5J2TB 5ITZB 3RA6A 2AIFA 4B5CA 3KIZA 5GANK 2HP0A 1GO1A 4B62A 1X7OA 1ODEA 5G4VC 1PF5A 3N2GB 4TV8B 2OZBA 1GX1A 3C9UA 3HJWC 1IV2A 1JD1A 2BO1A 3ZO8A 3UT5A 2VGNA 4EI9A 2CHSA 2RHHA 3HKDB 5JH7B 4BY9D 3V7QA 2I6DA 3UT5B 4DXDA 2UYNA 2W8BC 3QUWA 3G6EF 4I4TA 4C8GA 2ZOVA 2Q1XA 2UYNB 1ONIA 2Z1EA 3CCSF 1H47A 5LOVA 1W3EX 4I4TB 3DDNA 1W42A 4O4HA 3N4YA 2VAPA 5FNVA 4O2AA 3P10A 3K2XA 4ZHVA 5IJ0B 3JAKA 5JQGB 4LCKA 5HP8A 3HKCA 5MN4A 5HY2A 1JJ2F 1QD9A 2IAFA 1ZWZA 3LFOA 4O2AB 1YJ9F 1YI2F 4RHAA 5HY1A 5KMGA 1N8RH 5EZYB 2YXZA 3R0PA 3S0WA 3CPQA 4U3JA 4ZK7A 2QEXF 3FD5A 4G4WA 5KMGB 5GONB 1NQ3A 2PMPA 3QTYA 5KX5B 2CW4A 1GZ0A 5EIBD 2HQSC 1VQ5F 4EB6A 3JAWA 5GIPC 3RYHB 2B33A 1FFXB 3OW2F 4O4LA 1VQ6F 3MDOA 4IIJA 2DYYA 1M90H 4EB6B 3JAWB 3CCEF 1Q81H 3ZP4A 2RHLA 2HP3A 3CPWF 1QVFF 4X3LA 3KE1A 1YJNF 3CMAF 4IIJB 5EB0A 3RA5A 5LP6B 3VO8A 1W2BF 3V4DA 2Z01A 3GTZA 1SA0B 2UYJA 3JALB 4TUYA 1YIJF 3CCRF 2L26A 1H48A 3CCVF 3QHDA 3MQWA 5IJ9B 2VAMA 3I55F 1YJWF 5BMVA 2G9IA 2UYPA 4YJ2A 3CCQF 2H6LA 2ZAUA 5CB4A 2GZLA 3M84A 2HVYD 2KTVA 1JFFA 3KHNA 3OBYA 4ZHQB 1FNKA 3NK6A 2R751 4YJ2B 3TD5A 4X1YA 4WBNA 2QI2A 5J2TA 3C9SA 5ITZA 4HNAA 3G4SF 4TV9A 1VQ7F 2MQEA 1IV1A 4M8IA 4X1YB 4BT6A 3S0HA 2CSLA 4TV8A 4E6EA 4I55A 3VYTC 4HNAB 1TVKB 4TV9B 3PLAC 3E1YA 3MBMA 3I7TA 3GYQA 1X7PA 1U3PA 3U0OA 4FFBB 1Z5WA 2GLZA 5EWRA 4BW0B 3HKBA 5LYJB 4I55B 5C8YB 5J2UA 1VQ9F 2K1SA 3WGMA 1NJIH 1QVGF 1VQLF 1KD1H 2H8CA 3JASB 3HKDA 4G88A 5JH7A 2VXYA 2OTLF 3CCJF 3CC2F 1XRGA 3HKBB 4ZHYB 3I56F 5J2UB 5FJ4C 4X1IA 2ZF8A 1S72F 1JN1A 3D00A 4O4IA 1SZQA 3NVKE 1VQ8F 3VI6A 3VTIC 1VQOF 1TUBA 1VQ4F 4X1IB 3ERNA 3VMFB 3VOAA 1QU9A 4KWEA 5GIOC 4O4IB 1QAHA 1TUBB 5EB1B 1W59A 5GAPK 2FC3A 5IJ0A 2GVIA 4LNUA 1RA4A 1GO0A 3WJPA 5JQGA 2LBXA 3NMUC 1RQ7A 4C81A 4B46A 1Q7YH 4X20A 1XHOA 3D54A 1DBFA 4LNUB 1VQVA 5HXZA 2Z1TA 1R1MA 5EZYA 2RHJA 3IEQA 3RYIB 2Q1YA 3IKFA 1COMA 4X20B 1X52A 3ELCA 4ZOLA 3WGNA 3RYCB 1KNJA 3NK7A 4YJ3B 5AVMA 2CHTA 2VAWA 3LWPC 4X1KA 3WGJA 4C8IA 5GONA 2KTUA 1OAPA 3V7EA 4ZOLB 5KX5A 3LDTA 2FGYA 2IG8A 3CCMF 3BYQA 3RYHA 4X1KB 1VQKF 1FFXA 3RE3A 3IMPA 4NUTA 2CWJA 4RQOA 5IT9M 4G4YA 3CC7F 1VHAA 3VOBA 2DT4A 1VQNF 5LP6A 3J81M 1Q82H 1T0KB 1SA0A 3JALA 3K14A 1W5BA 2PHNA 5HXUA 1FNJA 2HX0A 4U39A 1PXWA 3B6NA 4G4VA 1W41A 2QTPA 5IJ9A 3F0DA 4BVRA 1T0AA 4I50B 4TZZA 1Q8RA 2Z1UA 3HTNA 1W5FA 3JARB 3ZOPA 3K12A 2BTQB 2CZWA 4ZHQA 3CC4F 2AMTA 2I6RA 4IHJA 4O4JB 3N4ZA 3GHZA 1Q86H 2ZVYA 1VH8A 1E7KA 2BTUA 5LP6C 5MN5A 5LXTB 1H7MA 1IV4A 4IHJB 1U43A 1W40A 3PAFA 5JVDB 1K73H 4C82A 2HS4A 3HAXD 4BT5A 1OFUA 1TVKA 3RYFA 1KC8H 3P4EA 2R6R1 3WPXA 3S03A 4ERHA 3AGKA 4FFBA 5HY0A 4C8EA 1DT9A 5LYJA 5C8YA 2RHOA 2OTJF 2P6YA 3RYFB 2V9YA 2RB9A 3JASA 5LA6A 3LYBA 4NQ3A 2HS3A 2ZODA 3P0ZA 5JCOA 3V3TA 5EIBC 1JY8A 1CN7A 5LA6B 2VGMA 3CMEF 1W5AA 3F0GA 5FLXM 3CCLF 4BT2A 3J80M 3O85A 3LWRC 2KG4A 3VYUC 3ESJA 3D01A 3KJKA 2UZHA 3JVHA 3FFMA 3F0FA 2HP0B 3VIUA 4F6RA 1Z5VA 3FPIA 3OONA 3TD4A 4XCQA 3T80A 4O2BA 3SIUA 2HRYA 1NMUB 5JCOC 4F6RB 2EWCA 1UFYA 2IQQA 1K8AH 3RYIA 3CYQA 4O2BB 1IPAA 3EORA 3WGKA 3RYCA 4YJ3A 1VQMF 2NMUA 3C9RA 5HY4A 5CA0A 1SDSA 3MCAB 4ZHWA 5EAZA 3WXMB 3J7AR 1W57A 1W5EA 3ZP7A 4B45A 3VCZA 5CA0B 4EI8A 2JNBA 3G71F 1CLIA 2N48A 3HWUA 1VQPF 3LWQC 1YITF 5LOVB 1CK2A 1U40A 4EI7A 3I3FA 4O4HB 2Z1FA 1J7HA 1UI9A 5G4UC 1RQ2A 1W581 1IV3A 5FNVB 3MCQA 1YGYA 1YHQF 2LBTA 4G4ZA 3JAKB 5HWEA 5MN6A 3CXCF 3SIVA 3HKCB 2AIZP 3WJRA 3JCMM 3C8LA 3Q8HA 4I50A 2HRUA 3HKEA 4BVQA 3JARA 3KJJA 4U3JB 5EYPA 1RLUA 3JATA 3VYSC 1YQNA 3WPWA 3TD3A 3M1XA 1X25A 4O4JA 3HKEB 3DC2A 4NWOB 4PWTA 3C9TA 4BT7A 5EYPB 3JATB 2HS0A 3K0TA 4R40B 5LXTA 1U3LA 1KQSF 3CCUF 1FSZA 3E20B 1XV2A 3L7QA 3ON1A 5JVDA 4O4LB 2WALA 3N2KA 1W55A 5EO3A 2UYKA 3LWOC 5B8FA 2LBWA 3FD6A 3E22A 3WGLA 2ALEA 2BTOA 1VK3A 3FBAA 4DRXA 2KGWA 3JAMM 2ZVZA 3N2KB 2QA4F 3IKEA 5A2QM 1RLGA 2CVLA 4TUYB 3E22B 3S06A 3IEWA 5GINC 4DRXB 2F9ZC 2H8EA 5IYZA 3CB2A 3CD6F 3CYPB 4G4XA 2OTMA 3NVIB 3LWVC 1K9MH 1M1KH 4BT3A 3WJQA 5BMVB 3F0EA
chains in the Genus database with same CATH topology
1XBIA 2KTUA 3V7EA 1YJNF 4XCQA 4X3MA 3CMAF 3SIUA 3OBWA 3RA5A 2OHWA 4C4WC 1W2BF 5DCVA 2FGYA 1NMUB 3CCMF 3CG6A 1YIJF 1VQKF 1K8AH 3CCRF 4BVTA 4NUTA 4BVSA 1IPAA 3IR9A 3CCVF 5IT9M 3RA6A 2AIFA 1VQMF 3I55F 3CC7F 1YJWF 5GANK 1GO1A 5HY4A 1SDSA 1X7OA 3CCQF 5G4VC 1VQNF 2OZBA 3MCAB 2HVYD 2KTVA 1Q82H 3J81M 3WXMB 3OBYA 3J7AR 1T0KB 3HJWC 3NK6A 2BO1A 4EI8A 5HXUA 2JNBA 2QI2A 3G71F 1PXWA 3G4SF 2VGNA 1W41A 4EI9A 1VQPF 3LWQC 1VQ7F 4BVRA 1YITF 1CK2A 4TZZA 4EI7A 4BY9D 3V7QA 2I6DA 5G4UC 3CC4F 2CZWA 3E1YA 3PLAC 3GYQA 1X7PA 1YHQF 2GLZA 5EWRA 3G6EF 3N4ZA 4BW0B 5HWEA 3CXCF 1Q86H 3SIVA 1VQ9F 1NJIH 1QVGF 1VQLF 1KD1H 1E7KA 3CCSF 3JCMM 1H7MA 2OTLF 1W3EX 1W40A 3CC2F 3CCJF 3PAFA 4BVQA 1K73H 1W42A 3I56F 3HAXD 3N4YA 5FJ4C 1KC8H 3AGKA 1S72F 3D00A 5HY0A 3NVKE 1DT9A 1VQ8F 3VI6A 1VQ4F 1VQOF 4LCKA 2OTJF 1JJ2F 5HY2A 3VMFB 1YI2F 3LFOA 5GIOC 1YJ9F 5HY1A 1KQSF 1N8RH 3CCUF 4NQ3A 3E20B 3ON1A 3CPQA 2WALA 3V3TA 5EO3A 5GAPK 2FC3A 3LWOC 2VGMA 2QEXF 1CN7A 1RA4A 1GO0A 2LBWA 3CMEF 1QVFF 2LBXA 2ALEA 3NMUC 5FLXM 3CCLF 1Q7YH 3JAMM 1GZ0A 2QA4F 1VQ5F 3J80M 3O85A 3LWRC 5HXZA 2KG4A 5A2QM 5GIPC 1RLGA 3OW2F 5GINC 2F9ZC 1X52A 1VQ6F 3CD6F 3NK7A 1M90H 3CCEF 3FFMA 3LWVC 1K9MH 1M1KH 1Q81H 3NVIB 3CPWF 3LWPC 1ZWZA 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBI A;  2KTU A;  3V7E A;  1YJN F;  4X3M A;  3CMA F;  3SIU A;  3OBW A;  3RA5 A;  2OHW A;  4C4W C;  1W2B F;  5DCV A;  1NMU B;  3CCM F;  3CG6 A;  1YIJ F;  1VQK F;  1K8A H;  3CCR F;  4NUT A;  1IPA A;  3IR9 A;  3CCV F;  5IT9 M;  3RA6 A;  2AIF A;  1VQM F;  3I55 F;  3CC7 F;  1YJW F;  5GAN K;  1GO1 A;  1SDS A;  1X7O A;  3CCQ F;  5G4V C;  1VQN F;  2OZB A;  3MCA B;  2HVY D;  2KTV A;  1Q82 H;  3J81 M;  3WXM B;  3OBY A;  3J7A R;  1T0K B;  3HJW C;  3NK6 A;  2BO1 A;  2JNB A;  2QI2 A;  3G71 F;  1PXW A;  3G4S F;  2VGN A;  1W41 A;  1VQ7 F;  1VQP F;  3LWQ C;  1YIT F;  1CK2 A;  4TZZ A;  4BY9 D;  3V7Q A;  2I6D A;  5G4U C;  3CC4 F;  2CZW A;  3E1Y A;  3PLA C;  3GYQ A;  1X7P A;  1YHQ F;  5EWR A;  3G6E F;  3N4Z A;  4BW0 B;  3CXC F;  1Q86 H;  3SIV A;  1VQ9 F;  1NJI H;  1QVG F;  1VQL F;  1KD1 H;  1E7K A;  3CCS F;  3JCM M;  1H7M A;  2OTL F;  1W3E X;  1W40 A;  3CC2 F;  3CCJ F;  3PAF A;  1K73 H;  1W42 A;  3I56 F;  3HAX D;  3N4Y A;  5FJ4 C;  1KC8 H;  3AGK A;  1S72 F;  3NVK E;  1DT9 A;  1VQ8 F;  3VI6 A;  1VQ4 F;  1VQO F;  4LCK A;  2OTJ F;  1JJ2 F;  3VMF B;  1YI2 F;  3LFO A;  5GIO C;  1YJ9 F;  1KQS F;  1N8R H;  3CCU F;  3E20 B;  3ON1 A;  3CPQ A;  2WAL A;  5EO3 A;  5GAP K;  2FC3 A;  3LWO C;  2VGM A;  2QEX F;  1CN7 A;  1RA4 A;  1GO0 A;  2LBW A;  3CME F;  1QVF F;  2LBX A;  2ALE A;  3NMU C;  5FLX M;  3CCL F;  1Q7Y H;  3JAM M;  1GZ0 A;  2QA4 F;  1VQ5 F;  3J80 M;  3O85 A;  3LWR C;  2KG4 A;  5A2Q M;  5GIP C;  1RLG A;  3OW2 F;  5GIN C;  1X52 A;  1VQ6 F;  3CD6 F;  3NK7 A;  1M90 H;  3CCE F;  3FFM A;  3LWV C;  1K9M H;  1M1K H;  1Q81 H;  3NVI B;  3CPW F;  3LWP C;  1ZWZ A;  4X3L A; 
#chains in the Genus database with same CATH topology
 1XBI A;  3LME A;  5CB4 B;  1KNK A;  5IYZ B;  4X3M A;  4ZI7 A;  2YYE A;  5CA1 A;  3OBW A;  1JFF B;  3F6M A;  5HP7 A;  2OHW A;  4C4W C;  3S0Y A;  5DCV A;  3CG6 A;  2LCA A;  4BT4 A;  3S02 A;  4WBN B;  4BVT A;  3M4S A;  3N2G A;  4BVS A;  4ZI7 B;  3IR9 A;  5CA1 B;  5J2T B;  5ITZ B;  3RA6 A;  2AIF A;  4B5C A;  3KIZ A;  5GAN K;  2HP0 A;  1GO1 A;  4B62 A;  1X7O A;  1ODE A;  5G4V C;  1PF5 A;  3N2G B;  4TV8 B;  2OZB A;  1GX1 A;  3C9U A;  3HJW C;  1IV2 A;  1JD1 A;  2BO1 A;  3ZO8 A;  3UT5 A;  2VGN A;  4EI9 A;  2CHS A;  2RHH A;  3HKD B;  5JH7 B;  4BY9 D;  3V7Q A;  2I6D A;  3UT5 B;  4DXD A;  2UYN A;  2W8B C;  3QUW A;  3G6E F;  4I4T A;  4C8G A;  2ZOV A;  2Q1X A;  2UYN B;  1ONI A;  2Z1E A;  3CCS F;  1H47 A;  5LOV A;  1W3E X;  4I4T B;  3DDN A;  1W42 A;  4O4H A;  3N4Y A;  2VAP A;  5FNV A;  4O2A A;  3P10 A;  3K2X A;  4ZHV A;  5IJ0 B;  3JAK A;  5JQG B;  4LCK A;  5HP8 A;  3HKC A;  5MN4 A;  5HY2 A;  1JJ2 F;  1QD9 A;  2IAF A;  1ZWZ A;  3LFO A;  4O2A B;  1YJ9 F;  1YI2 F;  4RHA A;  5HY1 A;  5KMG A;  1N8R H;  5EZY B;  2YXZ A;  3R0P A;  3S0W A;  3CPQ A;  4U3J A;  4ZK7 A;  2QEX F;  3FD5 A;  4G4W A;  5KMG B;  5GON B;  1NQ3 A;  2PMP A;  3QTY A;  5KX5 B;  2CW4 A;  1GZ0 A;  5EIB D;  2HQS C;  1VQ5 F;  4EB6 A;  3JAW A;  5GIP C;  3RYH B;  2B33 A;  1FFX B;  3OW2 F;  4O4L A;  1VQ6 F;  3MDO A;  4IIJ A;  2DYY A;  1M90 H;  4EB6 B;  3JAW B;  3CCE F;  1Q81 H;  3ZP4 A;  2RHL A;  2HP3 A;  3CPW F;  1QVF F;  4X3L A;  3KE1 A;  1YJN F;  3CMA F;  4IIJ B;  5EB0 A;  3RA5 A;  5LP6 B;  3VO8 A;  1W2B F;  3V4D A;  2Z01 A;  3GTZ A;  1SA0 B;  2UYJ A;  3JAL B;  4TUY A;  1YIJ F;  3CCR F;  2L26 A;  1H48 A;  3CCV F;  3QHD A;  3MQW A;  5IJ9 B;  2VAM A;  3I55 F;  1YJW F;  5BMV A;  2G9I A;  2UYP A;  4YJ2 A;  3CCQ F;  2H6L A;  2ZAU A;  5CB4 A;  2GZL A;  3M84 A;  2HVY D;  2KTV A;  1JFF A;  3KHN A;  3OBY A;  4ZHQ B;  1FNK A;  3NK6 A;  2R75 1;  4YJ2 B;  3TD5 A;  4X1Y A;  4WBN A;  2QI2 A;  5J2T A;  3C9S A;  5ITZ A;  4HNA A;  3G4S F;  4TV9 A;  1VQ7 F;  2MQE A;  1IV1 A;  4M8I A;  4X1Y B;  4BT6 A;  3S0H A;  2CSL A;  4TV8 A;  4E6E A;  4I55 A;  3VYT C;  4HNA B;  1TVK B;  4TV9 B;  3PLA C;  3E1Y A;  3MBM A;  3I7T A;  3GYQ A;  1X7P A;  1U3P A;  3U0O A;  4FFB B;  1Z5W A;  2GLZ A;  5EWR A;  4BW0 B;  3HKB A;  5LYJ B;  4I55 B;  5C8Y B;  5J2U A;  1VQ9 F;  2K1S A;  3WGM A;  1NJI H;  1QVG F;  1VQL F;  1KD1 H;  2H8C A;  3JAS B;  3HKD A;  4G88 A;  5JH7 A;  2VXY A;  2OTL F;  3CCJ F;  3CC2 F;  1XRG A;  3HKB B;  4ZHY B;  3I56 F;  5J2U B;  5FJ4 C;  4X1I A;  2ZF8 A;  1S72 F;  1JN1 A;  3D00 A;  4O4I A;  1SZQ A;  3NVK E;  1VQ8 F;  3VI6 A;  3VTI C;  1VQO F;  1TUB A;  1VQ4 F;  4X1I B;  3ERN A;  3VMF B;  3VOA A;  1QU9 A;  4KWE A;  5GIO C;  4O4I B;  1QAH A;  1TUB B;  5EB1 B;  1W59 A;  5GAP K;  2FC3 A;  5IJ0 A;  2GVI A;  4LNU A;  1RA4 A;  1GO0 A;  3WJP A;  5JQG A;  2LBX A;  3NMU C;  1RQ7 A;  4C81 A;  4B46 A;  1Q7Y H;  4X20 A;  1XHO A;  3D54 A;  1DBF A;  4LNU B;  1VQV A;  5HXZ A;  2Z1T A;  1R1M A;  5EZY A;  2RHJ A;  3IEQ A;  3RYI B;  2Q1Y A;  3IKF A;  1COM A;  4X20 B;  1X52 A;  3ELC A;  4ZOL A;  3WGN A;  3RYC B;  1KNJ A;  3NK7 A;  4YJ3 B;  5AVM A;  2CHT A;  2VAW A;  3LWP C;  4X1K A;  3WGJ A;  4C8I A;  5GON A;  2KTU A;  1OAP A;  3V7E A;  4ZOL B;  5KX5 A;  3LDT A;  2FGY A;  2IG8 A;  3CCM F;  3BYQ A;  3RYH A;  4X1K B;  1VQK F;  1FFX A;  3RE3 A;  3IMP A;  4NUT A;  2CWJ A;  4RQO A;  5IT9 M;  4G4Y A;  3CC7 F;  1VHA A;  3VOB A;  2DT4 A;  1VQN F;  5LP6 A;  3J81 M;  1Q82 H;  1T0K B;  1SA0 A;  3JAL A;  3K14 A;  1W5B A;  2PHN A;  5HXU A;  1FNJ A;  2HX0 A;  4U39 A;  1PXW A;  3B6N A;  4G4V A;  1W41 A;  2QTP A;  5IJ9 A;  3F0D A;  4BVR A;  1T0A A;  4I50 B;  4TZZ A;  1Q8R A;  2Z1U A;  3HTN A;  1W5F A;  3JAR B;  3ZOP A;  3K12 A;  2BTQ B;  2CZW A;  4ZHQ A;  3CC4 F;  2AMT A;  2I6R A;  4IHJ A;  4O4J B;  3N4Z A;  3GHZ A;  1Q86 H;  2ZVY A;  1VH8 A;  1E7K A;  2BTU A;  5LP6 C;  5MN5 A;  5LXT B;  1H7M A;  1IV4 A;  4IHJ B;  1U43 A;  1W40 A;  3PAF A;  5JVD B;  1K73 H;  4C82 A;  2HS4 A;  3HAX D;  4BT5 A;  1OFU A;  1TVK A;  3RYF A;  1KC8 H;  3P4E A;  2R6R 1;  3WPX A;  3S03 A;  4ERH A;  3AGK A;  4FFB A;  5HY0 A;  4C8E A;  1DT9 A;  5LYJ A;  5C8Y A;  2RHO A;  2OTJ F;  2P6Y A;  3RYF B;  2V9Y A;  2RB9 A;  3JAS A;  5LA6 A;  3LYB A;  4NQ3 A;  2HS3 A;  2ZOD A;  3P0Z A;  5JCO A;  3V3T A;  5EIB C;  1JY8 A;  1CN7 A;  5LA6 B;  2VGM A;  3CME F;  1W5A A;  3F0G A;  5FLX M;  3CCL F;  4BT2 A;  3J80 M;  3O85 A;  3LWR C;  2KG4 A;  3VYU C;  3ESJ A;  3D01 A;  3KJK A;  2UZH A;  3JVH A;  3FFM A;  3F0F A;  2HP0 B;  3VIU A;  4F6R A;  1Z5V A;  3FPI A;  3OON A;  3TD4 A;  4XCQ A;  3T80 A;  4O2B A;  3SIU A;  2HRY A;  1NMU B;  5JCO C;  4F6R B;  2EWC A;  1UFY A;  2IQQ A;  1K8A H;  3RYI A;  3CYQ A;  4O2B B;  1IPA A;  3EOR A;  3WGK A;  3RYC A;  4YJ3 A;  1VQM F;  2NMU A;  3C9R A;  5HY4 A;  5CA0 A;  1SDS A;  3MCA B;  4ZHW A;  5EAZ A;  3WXM B;  3J7A R;  1W57 A;  1W5E A;  3ZP7 A;  4B45 A;  3VCZ A;  5CA0 B;  4EI8 A;  2JNB A;  3G71 F;  1CLI A;  2N48 A;  3HWU A;  1VQP F;  3LWQ C;  1YIT F;  5LOV B;  1CK2 A;  1U40 A;  4EI7 A;  3I3F A;  4O4H B;  2Z1F A;  1J7H A;  1UI9 A;  5G4U C;  1RQ2 A;  1W58 1;  1IV3 A;  5FNV B;  3MCQ A;  1YGY A;  1YHQ F;  2LBT A;  4G4Z A;  3JAK B;  5HWE A;  5MN6 A;  3CXC F;  3SIV A;  3HKC B;  2AIZ P;  3WJR A;  3JCM M;  3C8L A;  3Q8H A;  4I50 A;  2HRU A;  3HKE A;  4BVQ A;  3JAR A;  3KJJ A;  4U3J B;  5EYP A;  1RLU A;  3JAT A;  3VYS C;  1YQN A;  3WPW A;  3TD3 A;  3M1X A;  1X25 A;  4O4J A;  3HKE B;  3DC2 A;  4NWO B;  4PWT A;  3C9T A;  4BT7 A;  5EYP B;  3JAT B;  2HS0 A;  3K0T A;  4R40 B;  5LXT A;  1U3L A;  1KQS F;  3CCU F;  1FSZ A;  3E20 B;  1XV2 A;  3L7Q A;  3ON1 A;  5JVD A;  4O4L B;  2WAL A;  3N2K A;  1W55 A;  5EO3 A;  2UYK A;  3LWO C;  5B8F A;  2LBW A;  3FD6 A;  3E22 A;  3WGL A;  2ALE A;  2BTO A;  1VK3 A;  3FBA A;  4DRX A;  2KGW A;  3JAM M;  2ZVZ A;  3N2K B;  2QA4 F;  3IKE A;  5A2Q M;  1RLG A;  2CVL A;  4TUY B;  3E22 B;  3S06 A;  3IEW A;  5GIN C;  4DRX B;  2F9Z C;  2H8E A;  5IYZ A;  3CB2 A;  3CD6 F;  3CYP B;  4G4X A;  2OTM A;  3NVI B;  3LWV C;  1K9M H;  1M1K H;  4BT3 A;  3WJQ A;  5BMV B;  3F0E A; 
#chains in the Genus database with same CATH homology
 1XBI A;  2KTU A;  3V7E A;  1YJN F;  4XCQ A;  4X3M A;  3CMA F;  3SIU A;  3OBW A;  3RA5 A;  2OHW A;  4C4W C;  1W2B F;  5DCV A;  2FGY A;  1NMU B;  3CCM F;  3CG6 A;  1YIJ F;  1VQK F;  1K8A H;  3CCR F;  4BVT A;  4NUT A;  4BVS A;  1IPA A;  3IR9 A;  3CCV F;  5IT9 M;  3RA6 A;  2AIF A;  1VQM F;  3I55 F;  3CC7 F;  1YJW F;  5GAN K;  1GO1 A;  5HY4 A;  1SDS A;  1X7O A;  3CCQ F;  5G4V C;  1VQN F;  2OZB A;  3MCA B;  2HVY D;  2KTV A;  1Q82 H;  3J81 M;  3WXM B;  3OBY A;  3J7A R;  1T0K B;  3HJW C;  3NK6 A;  2BO1 A;  4EI8 A;  5HXU A;  2JNB A;  2QI2 A;  3G71 F;  1PXW A;  3G4S F;  2VGN A;  1W41 A;  4EI9 A;  1VQP F;  3LWQ C;  1VQ7 F;  4BVR A;  1YIT F;  1CK2 A;  4TZZ A;  4EI7 A;  4BY9 D;  3V7Q A;  2I6D A;  5G4U C;  3CC4 F;  2CZW A;  3E1Y A;  3PLA C;  3GYQ A;  1X7P A;  1YHQ F;  2GLZ A;  5EWR A;  3G6E F;  3N4Z A;  4BW0 B;  5HWE A;  3CXC F;  1Q86 H;  3SIV A;  1VQ9 F;  1NJI H;  1QVG F;  1VQL F;  1KD1 H;  1E7K A;  3CCS F;  3JCM M;  1H7M A;  2OTL F;  1W3E X;  1W40 A;  3CC2 F;  3CCJ F;  3PAF A;  4BVQ A;  1K73 H;  1W42 A;  3I56 F;  3HAX D;  3N4Y A;  5FJ4 C;  1KC8 H;  3AGK A;  1S72 F;  3D00 A;  5HY0 A;  3NVK E;  1DT9 A;  1VQ8 F;  3VI6 A;  1VQ4 F;  1VQO F;  4LCK A;  2OTJ F;  1JJ2 F;  5HY2 A;  3VMF B;  1YI2 F;  3LFO A;  5GIO C;  1YJ9 F;  5HY1 A;  1KQS F;  1N8R H;  3CCU F;  4NQ3 A;  3E20 B;  3ON1 A;  3CPQ A;  2WAL A;  3V3T A;  5EO3 A;  5GAP K;  2FC3 A;  3LWO C;  2VGM A;  2QEX F;  1CN7 A;  1RA4 A;  1GO0 A;  2LBW A;  3CME F;  1QVF F;  2LBX A;  2ALE A;  3NMU C;  5FLX M;  3CCL F;  1Q7Y H;  3JAM M;  1GZ0 A;  2QA4 F;  1VQ5 F;  3J80 M;  3O85 A;  3LWR C;  5HXZ A;  2KG4 A;  5A2Q M;  5GIP C;  1RLG A;  3OW2 F;  5GIN C;  2F9Z C;  1X52 A;  1VQ6 F;  3CD6 F;  3NK7 A;  1M90 H;  3CCE F;  3FFM A;  3LWV C;  1K9M H;  1M1K H;  1Q81 H;  3NVI B;  3CPW F;  3LWP C;  1ZWZ A;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...