1Q86H

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q86H00
3NMUC 1KC8H 3CCSF 1W40A 3WXMB 3G6EF 1NMUB 2QEXF 1SDSA 3O85A 2KG4A 1Q82H 2BO1A 5IT9M 3JCMM 2OTLF 1GO1A 1YJWF 1K8AH 1M90H 3CCRF 1YITF 4BY9D 3G71F 3RA5A 1E7KA 5GIOC 5EO3A 2WALA 3HJWC 3E1YA 2KTUA 5A2QM 1K9MH 1VQKF 1XBIA 1M1KH 3MCAB 1VQ6F 5DCVA 3LFOA 2QA4F 1VQ7F 1X7PA 3CG6A 3LWPC 2KTVA 3PAFA 1YJNF 3ON1A 3VI6A 3CC4F 1Q86H 2HVYD 3G4SF 1RA4A 4NUTA 2OZBA 3CXCF 4TZZA 1VQ9F 2VGNA 1CN7A 1GO0A 3FFMA 3CPWF 3HAXD 5GINC 1VQ8F 1H7MA 3J80M 5EWRA 3OBWA 3CCQF 1VQMF 5GANK 1YIJF 1VQNF 5G4VC 3CC2F 1T0KB 3LWVC 2VGMA 2AIFA 3J81M 3LWRC 1W42A 3AGKA 5G4UC 3LWOC 1VQ4F 4X3MA 2LBWA 3CC7F 1W41A 4LCKA 3VMFB 5FJ4C 3CCVF 1PXWA 3I55F 1VQLF 2FC3A 2LBXA 1IPAA 3LWQC 2ALEA 2CZWA 1YJ9F 3CCMF 3J7AR 1KQSF 1W3EX 3V7EA 5GIPC 1QVFF 1DT9A 3N4ZA 4BW0B 3I56F 3CCEF 1YI2F 2OHWA 1W2BF 2QI2A 1X7OA 1N8RH 3SIUA 1VQOF 2I6DA 3V7QA 3CCJF 3CCLF 3GYQA 2JNBA 3RA6A 3N4YA 3JAMM 3CMEF 1KD1H 3NK7A 2OTJF 3NVKE 1CK2A 3IR9A 1X52A 5FLXM 1NJIH 3SIVA 1YHQF 3CMAF 1S72F 3OBYA 4C4WC 1VQ5F 1GZ0A 3CCUF 5GAPK 1JJ2F 1ZWZA 3CPQA 3E20B 3NK6A 3CD6F 1VQPF 1Q81H 1RLGA 3NVIB 3PLAC 1K73H 1QVGF 1Q7YH 3OW2F 4X3LA
chains in the Genus database with same CATH superfamily
3NMUC 2B33A 3F0EA 3WXMB 4EI7A 1NMUB 2QEXF 1SDSA 1RLUA 3I7TA 3N2GB 3GHZA 4RQOA 1YJWF 5JVDB 4ZHQA 1K8AH 3N2KB 3C9UA 5JQGA 2GVIA 1E7KA 5GIOC 3HJWC 2WALA 3I3FA 3K12A 3E1YA 3KIZA 3IEWA 3BYQA 1K9MH 5CA1B 2CSLA 3MCAB 4IHJA 3LFOA 5AVMA 2P6YA 2CVLA 3WJQA 5IYZA 5EB1B 2RHOA 3ON1A 2IG8A 3VI6A 5KX5B 2UYNB 5EZYB 1Q86H 5EB0A 5MN6A 3KE1A 3M4SA 4M8IA 4TZZA 4ERHA 3RYHB 3RYFB 3WPXA 1VQ8F 4I4TA 5EWRA 5G4VC 1TVKB 3TD5A 3S06A 1T0KB 4I55A 1R1MA 2AIFA 3LWRC 1ODEA 1W42A 4DXDA 4ZOLB 4X3MA 4BVQA 3VYSC 3MBMA 3JAKB 2RB9A 5JCOC 4C8IA 4EI8A 3N2GA 3QHDA 4EB6B 4C81A 1JD1A 2G9IA 4PWTA 4G4WA 3CCVF 3I55F 1Q8RA 3RYCB 3JAWB 5LXTB 1QU9A 1IPAA 5HP8A 1RQ7A 1YJ9F 3C9SA 4ZHVA 3J7AR 5JCOA 2UYPA 3HKCB 3WGJA 1KQSF 4B5CA 3EORA 2KGWA 5GIPC 1QVFF 1W5BA 4BW0B 2HQSC 3IKFA 3V3TA 2K1SA 5J2TA 1W2BF 4BT5A 1JFFB 5GONB 4O4JA 3KJJA 2LBTA 3SIUA 2Z01A 2UYNA 3V7QA 5C8YA 4EI9A 4C8GA 1CLIA 3NVKE 1U3LA 1NJIH 3QUWA 2HP3A 3CMAF 1S72F 3OBYA 4DRXA 4ZHQB 3ZOPA 5JQGB 3F0GA 3CPQA 4BT6A 3LMEA 3FPIA 1VQPF 3FD6A 3IEQA 2YXZA 3PLAC 2CHSA 1T0AA 4IHJB 1U3PA 5HY1A 3DC2A 5IYZB 2KG4A 2HS4A 2GLZA 3MDOA 3JCMM 3ZP7A 1GO1A 1FFXA 1XHOA 2MQEA 1M90H 2UZHA 1YITF 1JY8A 3C9TA 3D00A 5HP7A 4NQ3A 3ZP4A 5CB4B 5MN5A 3IMPA 3P4EA 1M1KH 3E22A 3T80A 1VQ6F 1VQ7F 4I55B 1VK3A 5LA6A 5LOVA 5EIBD 5KMGA 3S03A 1H48A 5J2UA 3JVHA 2F9ZC 3LWPC 2KTVA 3QTYA 3CC4F 2HVYD 3G4SF 2DYYA 3VTIC 2L26A 1DBFA 3ESJA 2VGNA 1VH8A 2BTOA 5GINC 4E6EA 4WBNA 3OBWA 5GANK 1YIJF 4X20A 3L7QA 3VIUA 5HY4A 2VGMA 1COMA 5J2TB 5G4UC 1IV2A 2W8BC 4O4JB 4O4IA 2DT4A 5C8YB 4TV9A 1VQLF 3C9RA 1Z5VA 2RHHA 5FNVA 2LBXA 2ALEA 4YJ2A 2CZWA 3HKEA 4ZI7A 2Z1TA 4DRXB 1ONIA 5JH7A 5CB4A 3K14A 2VAWA 4ZK7A 2Z1UA 3N4ZA 5HXZA 2HP0A 5EAZA 2ZVYA 5HXUA 3I56F 2NMUA 4G4YA 3WPWA 4I50A 3S0WA 1FNJA 1Z5WA 3KJKA 3K0TA 4F6RA 3WGNA 3HKDA 2HS3A 4C82A 1VQOF 3F6MA 5MN4A 3CCLF 3GYQA 3JAMM 3IR9A 1IV3A 5LP6C 4X1KB 1W59A 3WGKA 3M84A 4LNUA 4C4WC 1FFXB 1XRGA 3GTZA 5HY0A 1JJ2F 3JATA 3E20B 3CD6F 1J7HA 2R6R1 3ZO8A 1K73H 5LP6A 1OAPA 3E22B 1JN1A 3OW2F 2BTUA 4X3LA 2BTQB 3FBAA 5HY2A 5EIBC 5LA6B 5J2UB 3VOBA 5KMGB 5LOVB 3CCSF 1KC8H 3UT5A 3MQWA 1UFYA 1SZQA 2Z1EA 1IV1A 2YYEA 3HTNA 3FD5A 2OTLF 3HWUA 4O2AA 2EWCA 1TUBA 2PHNA 4BY9D 3G71F 3RA5A 5EO3A 3VCZA 3F0FA 4WBNB 5A2QM 5IJ0A 1VQKF 1XBIA 5LYJA 4X20B 4B45A 4G4VA 1X7PA 3PAFA 3P10A 2VXYA 4BT3A 2HS0A 1RA4A 3WJPA 4X1KA 2OZBA 4O4IB 4YJ3A 3CXCF 3JASB 3TD3A 5HWEA 4TV9B 1GO0A 2ZF8A 3FFMA 3CPWF 5FNVB 3J80M 4IIJA 3P0ZA 4BT4A 4YJ2B 3OONA 3HKEB 4XCQA 2HRUA 1VQNF 2Q1YA 4ZI7B 2LCAA 3LWVC 5JH7B 1VHAA 2CHTA 1RQ2A 3J81M 4HNAA 5EYPB 1X25A 2HP0B 2AMTA 3HKBA 3VO8A 3KHNA 4I50B 3Q8HA 1VQ4F 3D54A 4F6RB 2VAMA 3HKDB 4X1IA 4TUYA 4LCKA 3VMFB 5FJ4C 1PXWA 3RE3A 2QTPA 3ELCA 3RYIA 4BT7A 1U40A 3JALA 3CYPB 3CCMF 2CWJA 4B46A 4LNUB 2ZVZA 5BMVA 1W5AA 1DT9A 3JATB 2CW4A 3CCEF 1YI2F 1NQ3A 3WGLA 5B8FA 4O4LA 1X7OA 3JARA 1SA0A 4G4XA 5LP6B 1U43A 4X1YA 1KNJA 3CCJF 2ZAUA 3M1XA 3RA6A 3LDTA 2OTJF 1XV2A 3C8LA 3NK7A 3UT5B 3V4DA 5IJ9A 1CK2A 3JASA 1W5FA 4BVRA 1X52A 1QAHA 5FLXM 1W5EA 1FNKA 1GZ0A 2RHJA 2H8EA 1YGYA 4O2AB 3CCUF 1W57A 1IV4A 5GAPK 1TUBB 4O2BA 3D01A 3B6NA 3NK6A 3ERNA 1W55A 2VAPA 1Q81H 2Z1FA 2UYJA 2HX0A 5EYPA 3NVIB 1OFUA 5IJ0B 2H6LA 4TV8A 5LYJB 3S02A 4O4HA 1PF5A 1W40A 3G6EF 4FFBB 3O85A 3F0DA 1Q82H 2BO1A 5IT9M 1UI9A 3CB2A 1VQVA 4G88A 4YJ3B 1W581 3R0PA 3CCRF 4IIJB 2KTUA 4G4ZA 3VYTC 4C8EA 4U3JA 1GX1A 4R40B 4BVTA 5DCVA 2QA4F 3S0HA 4HNAB 3HKBB 2IAFA 3CG6A 3K2XA 1YJNF 2HRYA 5ITZB 4X1IB 2Q1XA 4NUTA 4TUYB 5JVDA 3VYUC 2GZLA 3N2KA 1VQ9F 1CN7A 3RYIB 3HAXD 5CA0B 1H7MA 3JALB 2OTMA 3CCQF 1VQMF 5CA1A 3CC2F 5BMVB 3WGMA 2IQQA 2FGYA 3AGKA 3LYBA 3LWOC 2ZODA 2PMPA 4O4LB 5KX5A 2LBWA 1FSZA 1H47A 1SA0B 3DDNA 3JARB 5EZYA 3TD4A 3CC7F 3U0OA 4NWOB 4FFBA 4X1YB 1W41A 3RYHA 3S0YA 3RYFA 4BVSA 2FC3A 5IJ9B 3LWQC 2AIZP 2N48A 4B62A 3VOAA 2V9YA 1YQNA 1W3EX 1TVKA 3V7EA 4KWEA 1KNKA 4O2BB 2OHWA 2QI2A 4ZOLA 1N8RH 3JAKA 4TV8B 4ZHYB 2H8CA 4EB6A 2I6DA 4O4HB 5ITZA 2JNBA 2R751 3N4YA 3CMEF 1KD1H 3RYCA 3JAWA 5LXTA 4ZHWA 4U39A 1QD9A 3IKEA 5CA0A 3SIVA 3CYQA 1YHQF 3HKCA 2ZOVA 1VQ5F 3MCQA 4I4TB 1ZWZA 2UYKA 1RLGA 1JFFA 5GONA 2RHLA 1QVGF 4U3JB 1Q7YH 3WJRA 4RHAA 2I6RA 4BT2A
chains in the Genus database with same CATH topology
5HY2A 3NMUC 1KC8H 3CCSF 1W40A 3WXMB 4EI7A 3G6EF 1NMUB 5HY1A 2QEXF 1SDSA 3O85A 2KG4A 1Q82H 2BO1A 5IT9M 2GLZA 3JCMM 2OTLF 1GO1A 1YJWF 1K8AH 1M90H 3CCRF 1YITF 4BY9D 3G71F 3RA5A 1E7KA 3D00A 5GIOC 5EO3A 2WALA 3HJWC 3E1YA 2KTUA 4NQ3A 5A2QM 1K9MH 1VQKF 1XBIA 1M1KH 3MCAB 4BVTA 1VQ6F 5DCVA 3LFOA 2QA4F 1VQ7F 1X7PA 2F9ZC 3CG6A 3LWPC 2KTVA 3PAFA 1YJNF 3ON1A 3VI6A 3CC4F 1Q86H 2HVYD 3G4SF 1RA4A 4NUTA 2OZBA 3CXCF 5HWEA 4TZZA 1VQ9F 2VGNA 1CN7A 1GO0A 3FFMA 3CPWF 3HAXD 5GINC 1VQ8F 1H7MA 3J80M 5EWRA 3OBWA 3CCQF 1VQMF 5GANK 4XCQA 1YIJF 5G4VC 1VQNF 3CC2F 1T0KB 3LWVC 5HY4A 2VGMA 2AIFA 3J81M 3LWRC 2FGYA 1W42A 3AGKA 5G4UC 3LWOC 1VQ4F 4X3MA 2LBWA 4BVQA 3CC7F 4EI8A 1W41A 4LCKA 3VMFB 5FJ4C 3CCVF 1PXWA 3I55F 1VQLF 4BVSA 2FC3A 2LBXA 1IPAA 3LWQC 2ALEA 2CZWA 1YJ9F 3CCMF 3J7AR 1KQSF 1W3EX 3V7EA 5GIPC 1QVFF 1DT9A 3N4ZA 4BW0B 5HXZA 3I56F 3CCEF 5HXUA 2OHWA 3V3TA 1YI2F 1W2BF 2QI2A 1X7OA 1N8RH 3SIUA 1VQOF 2I6DA 3V7QA 3CCJF 3CCLF 3GYQA 2JNBA 3RA6A 4EI9A 3N4YA 3JAMM 3CMEF 1KD1H 3NK7A 2OTJF 3NVKE 1CK2A 3IR9A 4BVRA 1X52A 5FLXM 1NJIH 3SIVA 1YHQF 3CMAF 1S72F 3OBYA 4C4WC 1VQ5F 1GZ0A 3CCUF 5GAPK 5HY0A 1JJ2F 1ZWZA 3CPQA 3E20B 3NK6A 3CD6F 1VQPF 1Q81H 1RLGA 3NVIB 3PLAC 1K73H 1QVGF 1Q7YH 3OW2F 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMU C;  1KC8 H;  3CCS F;  1W40 A;  3WXM B;  3G6E F;  1NMU B;  2QEX F;  1SDS A;  3O85 A;  2KG4 A;  1Q82 H;  2BO1 A;  5IT9 M;  3JCM M;  2OTL F;  1GO1 A;  1YJW F;  1K8A H;  1M90 H;  3CCR F;  1YIT F;  4BY9 D;  3G71 F;  3RA5 A;  1E7K A;  5GIO C;  5EO3 A;  2WAL A;  3HJW C;  3E1Y A;  2KTU A;  5A2Q M;  1K9M H;  1VQK F;  1XBI A;  1M1K H;  3MCA B;  1VQ6 F;  5DCV A;  3LFO A;  2QA4 F;  1VQ7 F;  1X7P A;  3CG6 A;  3LWP C;  2KTV A;  3PAF A;  1YJN F;  3ON1 A;  3VI6 A;  3CC4 F;  1Q86 H;  2HVY D;  3G4S F;  1RA4 A;  4NUT A;  2OZB A;  3CXC F;  4TZZ A;  1VQ9 F;  2VGN A;  1CN7 A;  1GO0 A;  3FFM A;  3CPW F;  3HAX D;  5GIN C;  1VQ8 F;  1H7M A;  3J80 M;  5EWR A;  3OBW A;  3CCQ F;  1VQM F;  5GAN K;  1YIJ F;  1VQN F;  5G4V C;  3CC2 F;  1T0K B;  3LWV C;  2VGM A;  2AIF A;  3J81 M;  3LWR C;  1W42 A;  3AGK A;  5G4U C;  3LWO C;  1VQ4 F;  4X3M A;  2LBW A;  3CC7 F;  1W41 A;  4LCK A;  3VMF B;  5FJ4 C;  3CCV F;  1PXW A;  3I55 F;  1VQL F;  2FC3 A;  2LBX A;  1IPA A;  3LWQ C;  2ALE A;  2CZW A;  1YJ9 F;  3CCM F;  3J7A R;  1KQS F;  1W3E X;  3V7E A;  5GIP C;  1QVF F;  1DT9 A;  3N4Z A;  4BW0 B;  3I56 F;  3CCE F;  1YI2 F;  2OHW A;  1W2B F;  2QI2 A;  1X7O A;  1N8R H;  3SIU A;  1VQO F;  2I6D A;  3V7Q A;  3CCJ F;  3CCL F;  3GYQ A;  2JNB A;  3RA6 A;  3N4Y A;  3JAM M;  3CME F;  1KD1 H;  3NK7 A;  2OTJ F;  3NVK E;  1CK2 A;  3IR9 A;  1X52 A;  5FLX M;  1NJI H;  3SIV A;  1YHQ F;  3CMA F;  1S72 F;  3OBY A;  4C4W C;  1VQ5 F;  1GZ0 A;  3CCU F;  5GAP K;  1JJ2 F;  1ZWZ A;  3CPQ A;  3E20 B;  3NK6 A;  3CD6 F;  1VQP F;  1Q81 H;  1RLG A;  3NVI B;  3PLA C;  1K73 H;  1QVG F;  1Q7Y H;  3OW2 F;  4X3L A; 
#chains in the Genus database with same CATH topology
 3NMU C;  2B33 A;  3F0E A;  3WXM B;  4EI7 A;  1NMU B;  2QEX F;  1SDS A;  1RLU A;  3I7T A;  3N2G B;  3GHZ A;  4RQO A;  1YJW F;  5JVD B;  4ZHQ A;  1K8A H;  3N2K B;  3C9U A;  5JQG A;  2GVI A;  1E7K A;  5GIO C;  3HJW C;  2WAL A;  3I3F A;  3K12 A;  3E1Y A;  3KIZ A;  3IEW A;  3BYQ A;  1K9M H;  5CA1 B;  2CSL A;  3MCA B;  4IHJ A;  3LFO A;  5AVM A;  2P6Y A;  2CVL A;  3WJQ A;  5IYZ A;  5EB1 B;  2RHO A;  3ON1 A;  2IG8 A;  3VI6 A;  5KX5 B;  2UYN B;  5EZY B;  1Q86 H;  5EB0 A;  5MN6 A;  3KE1 A;  3M4S A;  4M8I A;  4TZZ A;  4ERH A;  3RYH B;  3RYF B;  3WPX A;  1VQ8 F;  4I4T A;  5EWR A;  5G4V C;  1TVK B;  3TD5 A;  3S06 A;  1T0K B;  4I55 A;  1R1M A;  2AIF A;  3LWR C;  1ODE A;  1W42 A;  4DXD A;  4ZOL B;  4X3M A;  4BVQ A;  3VYS C;  3MBM A;  3JAK B;  2RB9 A;  5JCO C;  4C8I A;  4EI8 A;  3N2G A;  3QHD A;  4EB6 B;  4C81 A;  1JD1 A;  2G9I A;  4PWT A;  4G4W A;  3CCV F;  3I55 F;  1Q8R A;  3RYC B;  3JAW B;  5LXT B;  1QU9 A;  1IPA A;  5HP8 A;  1RQ7 A;  1YJ9 F;  3C9S A;  4ZHV A;  3J7A R;  5JCO A;  2UYP A;  3HKC B;  3WGJ A;  1KQS F;  4B5C A;  3EOR A;  2KGW A;  5GIP C;  1QVF F;  1W5B A;  4BW0 B;  2HQS C;  3IKF A;  3V3T A;  2K1S A;  5J2T A;  1W2B F;  4BT5 A;  1JFF B;  5GON B;  4O4J A;  3KJJ A;  2LBT A;  3SIU A;  2Z01 A;  2UYN A;  3V7Q A;  5C8Y A;  4EI9 A;  4C8G A;  1CLI A;  3NVK E;  1U3L A;  1NJI H;  3QUW A;  2HP3 A;  3CMA F;  1S72 F;  3OBY A;  4DRX A;  4ZHQ B;  3ZOP A;  5JQG B;  3F0G A;  3CPQ A;  4BT6 A;  3LME A;  3FPI A;  1VQP F;  3FD6 A;  3IEQ A;  2YXZ A;  3PLA C;  2CHS A;  1T0A A;  4IHJ B;  1U3P A;  5HY1 A;  3DC2 A;  5IYZ B;  2KG4 A;  2HS4 A;  2GLZ A;  3MDO A;  3JCM M;  3ZP7 A;  1GO1 A;  1FFX A;  1XHO A;  2MQE A;  1M90 H;  2UZH A;  1YIT F;  1JY8 A;  3C9T A;  3D00 A;  5HP7 A;  4NQ3 A;  3ZP4 A;  5CB4 B;  5MN5 A;  3IMP A;  3P4E A;  1M1K H;  3E22 A;  3T80 A;  1VQ6 F;  1VQ7 F;  4I55 B;  1VK3 A;  5LA6 A;  5LOV A;  5EIB D;  5KMG A;  3S03 A;  1H48 A;  5J2U A;  3JVH A;  2F9Z C;  3LWP C;  2KTV A;  3QTY A;  3CC4 F;  2HVY D;  3G4S F;  2DYY A;  3VTI C;  2L26 A;  1DBF A;  3ESJ A;  2VGN A;  1VH8 A;  2BTO A;  5GIN C;  4E6E A;  4WBN A;  3OBW A;  5GAN K;  1YIJ F;  4X20 A;  3L7Q A;  3VIU A;  5HY4 A;  2VGM A;  1COM A;  5J2T B;  5G4U C;  1IV2 A;  2W8B C;  4O4J B;  4O4I A;  2DT4 A;  5C8Y B;  4TV9 A;  1VQL F;  3C9R A;  1Z5V A;  2RHH A;  5FNV A;  2LBX A;  2ALE A;  4YJ2 A;  2CZW A;  3HKE A;  4ZI7 A;  2Z1T A;  4DRX B;  1ONI A;  5JH7 A;  5CB4 A;  3K14 A;  2VAW A;  4ZK7 A;  2Z1U A;  3N4Z A;  5HXZ A;  2HP0 A;  5EAZ A;  2ZVY A;  5HXU A;  3I56 F;  2NMU A;  4G4Y A;  3WPW A;  4I50 A;  3S0W A;  1FNJ A;  1Z5W A;  3KJK A;  3K0T A;  4F6R A;  3WGN A;  3HKD A;  2HS3 A;  4C82 A;  1VQO F;  3F6M A;  5MN4 A;  3CCL F;  3GYQ A;  3JAM M;  3IR9 A;  1IV3 A;  5LP6 C;  4X1K B;  1W59 A;  3WGK A;  3M84 A;  4LNU A;  4C4W C;  1FFX B;  1XRG A;  3GTZ A;  5HY0 A;  1JJ2 F;  3JAT A;  3E20 B;  3CD6 F;  1J7H A;  2R6R 1;  3ZO8 A;  1K73 H;  5LP6 A;  1OAP A;  3E22 B;  1JN1 A;  3OW2 F;  2BTU A;  4X3L A;  2BTQ B;  3FBA A;  5HY2 A;  5EIB C;  5LA6 B;  5J2U B;  3VOB A;  5KMG B;  5LOV B;  3CCS F;  1KC8 H;  3UT5 A;  3MQW A;  1UFY A;  1SZQ A;  2Z1E A;  1IV1 A;  2YYE A;  3HTN A;  3FD5 A;  2OTL F;  3HWU A;  4O2A A;  2EWC A;  1TUB A;  2PHN A;  4BY9 D;  3G71 F;  3RA5 A;  5EO3 A;  3VCZ A;  3F0F A;  4WBN B;  5A2Q M;  5IJ0 A;  1VQK F;  1XBI A;  5LYJ A;  4X20 B;  4B45 A;  4G4V A;  1X7P A;  3PAF A;  3P10 A;  2VXY A;  4BT3 A;  2HS0 A;  1RA4 A;  3WJP A;  4X1K A;  2OZB A;  4O4I B;  4YJ3 A;  3CXC F;  3JAS B;  3TD3 A;  5HWE A;  4TV9 B;  1GO0 A;  2ZF8 A;  3FFM A;  3CPW F;  5FNV B;  3J80 M;  4IIJ A;  3P0Z A;  4BT4 A;  4YJ2 B;  3OON A;  3HKE B;  4XCQ A;  2HRU A;  1VQN F;  2Q1Y A;  4ZI7 B;  2LCA A;  3LWV C;  5JH7 B;  1VHA A;  2CHT A;  1RQ2 A;  3J81 M;  4HNA A;  5EYP B;  1X25 A;  2HP0 B;  2AMT A;  3HKB A;  3VO8 A;  3KHN A;  4I50 B;  3Q8H A;  1VQ4 F;  3D54 A;  4F6R B;  2VAM A;  3HKD B;  4X1I A;  4TUY A;  4LCK A;  3VMF B;  5FJ4 C;  1PXW A;  3RE3 A;  2QTP A;  3ELC A;  3RYI A;  4BT7 A;  1U40 A;  3JAL A;  3CYP B;  3CCM F;  2CWJ A;  4B46 A;  4LNU B;  2ZVZ A;  5BMV A;  1W5A A;  1DT9 A;  3JAT B;  2CW4 A;  3CCE F;  1YI2 F;  1NQ3 A;  3WGL A;  5B8F A;  4O4L A;  1X7O A;  3JAR A;  1SA0 A;  4G4X A;  5LP6 B;  1U43 A;  4X1Y A;  1KNJ A;  3CCJ F;  2ZAU A;  3M1X A;  3RA6 A;  3LDT A;  2OTJ F;  1XV2 A;  3C8L A;  3NK7 A;  3UT5 B;  3V4D A;  5IJ9 A;  1CK2 A;  3JAS A;  1W5F A;  4BVR A;  1X52 A;  1QAH A;  5FLX M;  1W5E A;  1FNK A;  1GZ0 A;  2RHJ A;  2H8E A;  1YGY A;  4O2A B;  3CCU F;  1W57 A;  1IV4 A;  5GAP K;  1TUB B;  4O2B A;  3D01 A;  3B6N A;  3NK6 A;  3ERN A;  1W55 A;  2VAP A;  1Q81 H;  2Z1F A;  2UYJ A;  2HX0 A;  5EYP A;  3NVI B;  1OFU A;  5IJ0 B;  2H6L A;  4TV8 A;  5LYJ B;  3S02 A;  4O4H A;  1PF5 A;  1W40 A;  3G6E F;  4FFB B;  3O85 A;  3F0D A;  1Q82 H;  2BO1 A;  5IT9 M;  1UI9 A;  3CB2 A;  1VQV A;  4G88 A;  4YJ3 B;  1W58 1;  3R0P A;  3CCR F;  4IIJ B;  2KTU A;  4G4Z A;  3VYT C;  4C8E A;  4U3J A;  1GX1 A;  4R40 B;  4BVT A;  5DCV A;  2QA4 F;  3S0H A;  4HNA B;  3HKB B;  2IAF A;  3CG6 A;  3K2X A;  1YJN F;  2HRY A;  5ITZ B;  4X1I B;  2Q1X A;  4NUT A;  4TUY B;  5JVD A;  3VYU C;  2GZL A;  3N2K A;  1VQ9 F;  1CN7 A;  3RYI B;  3HAX D;  5CA0 B;  1H7M A;  3JAL B;  2OTM A;  3CCQ F;  1VQM F;  5CA1 A;  3CC2 F;  5BMV B;  3WGM A;  2IQQ A;  2FGY A;  3AGK A;  3LYB A;  3LWO C;  2ZOD A;  2PMP A;  4O4L B;  5KX5 A;  2LBW A;  1FSZ A;  1H47 A;  1SA0 B;  3DDN A;  3JAR B;  5EZY A;  3TD4 A;  3CC7 F;  3U0O A;  4NWO B;  4FFB A;  4X1Y B;  1W41 A;  3RYH A;  3S0Y A;  3RYF A;  4BVS A;  2FC3 A;  5IJ9 B;  3LWQ C;  2AIZ P;  2N48 A;  4B62 A;  3VOA A;  2V9Y A;  1YQN A;  1W3E X;  1TVK A;  3V7E A;  4KWE A;  1KNK A;  4O2B B;  2OHW A;  2QI2 A;  4ZOL A;  1N8R H;  3JAK A;  4TV8 B;  4ZHY B;  2H8C A;  4EB6 A;  2I6D A;  4O4H B;  5ITZ A;  2JNB A;  2R75 1;  3N4Y A;  3CME F;  1KD1 H;  3RYC A;  3JAW A;  5LXT A;  4ZHW A;  4U39 A;  1QD9 A;  3IKE A;  5CA0 A;  3SIV A;  3CYQ A;  1YHQ F;  3HKC A;  2ZOV A;  1VQ5 F;  3MCQ A;  4I4T B;  1ZWZ A;  2UYK A;  1RLG A;  1JFF A;  5GON A;  2RHL A;  1QVG F;  4U3J B;  1Q7Y H;  3WJR A;  4RHA A;  2I6R A;  4BT2 A; 
#chains in the Genus database with same CATH homology
 5HY2 A;  3NMU C;  1KC8 H;  3CCS F;  1W40 A;  3WXM B;  4EI7 A;  3G6E F;  1NMU B;  5HY1 A;  2QEX F;  1SDS A;  3O85 A;  2KG4 A;  1Q82 H;  2BO1 A;  5IT9 M;  2GLZ A;  3JCM M;  2OTL F;  1GO1 A;  1YJW F;  1K8A H;  1M90 H;  3CCR F;  1YIT F;  4BY9 D;  3G71 F;  3RA5 A;  1E7K A;  3D00 A;  5GIO C;  5EO3 A;  2WAL A;  3HJW C;  3E1Y A;  2KTU A;  4NQ3 A;  5A2Q M;  1K9M H;  1VQK F;  1XBI A;  1M1K H;  3MCA B;  4BVT A;  1VQ6 F;  5DCV A;  3LFO A;  2QA4 F;  1VQ7 F;  1X7P A;  2F9Z C;  3CG6 A;  3LWP C;  2KTV A;  3PAF A;  1YJN F;  3ON1 A;  3VI6 A;  3CC4 F;  1Q86 H;  2HVY D;  3G4S F;  1RA4 A;  4NUT A;  2OZB A;  3CXC F;  5HWE A;  4TZZ A;  1VQ9 F;  2VGN A;  1CN7 A;  1GO0 A;  3FFM A;  3CPW F;  3HAX D;  5GIN C;  1VQ8 F;  1H7M A;  3J80 M;  5EWR A;  3OBW A;  3CCQ F;  1VQM F;  5GAN K;  4XCQ A;  1YIJ F;  5G4V C;  1VQN F;  3CC2 F;  1T0K B;  3LWV C;  5HY4 A;  2VGM A;  2AIF A;  3J81 M;  3LWR C;  2FGY A;  1W42 A;  3AGK A;  5G4U C;  3LWO C;  1VQ4 F;  4X3M A;  2LBW A;  4BVQ A;  3CC7 F;  4EI8 A;  1W41 A;  4LCK A;  3VMF B;  5FJ4 C;  3CCV F;  1PXW A;  3I55 F;  1VQL F;  4BVS A;  2FC3 A;  2LBX A;  1IPA A;  3LWQ C;  2ALE A;  2CZW A;  1YJ9 F;  3CCM F;  3J7A R;  1KQS F;  1W3E X;  3V7E A;  5GIP C;  1QVF F;  1DT9 A;  3N4Z A;  4BW0 B;  5HXZ A;  3I56 F;  3CCE F;  5HXU A;  2OHW A;  3V3T A;  1YI2 F;  1W2B F;  2QI2 A;  1X7O A;  1N8R H;  3SIU A;  1VQO F;  2I6D A;  3V7Q A;  3CCJ F;  3CCL F;  3GYQ A;  2JNB A;  3RA6 A;  4EI9 A;  3N4Y A;  3JAM M;  3CME F;  1KD1 H;  3NK7 A;  2OTJ F;  3NVK E;  1CK2 A;  3IR9 A;  4BVR A;  1X52 A;  5FLX M;  1NJI H;  3SIV A;  1YHQ F;  3CMA F;  1S72 F;  3OBY A;  4C4W C;  1VQ5 F;  1GZ0 A;  3CCU F;  5GAP K;  5HY0 A;  1JJ2 F;  1ZWZ A;  3CPQ A;  3E20 B;  3NK6 A;  3CD6 F;  1VQP F;  1Q81 H;  1RLG A;  3NVI B;  3PLA C;  1K73 H;  1QVG F;  1Q7Y H;  3OW2 F;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...