1Q86H

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q86H00
2LBWA 3CCJF 3LWRC 1M90H 1W41A 3V7QA 3LWPC 3OBYA 1K9MH 1E7KA 1VQ6F 3E20B 3CPWF 2VGMA 3FFMA 3PLAC 3CCMF 3OBWA 3CG6A 4X3MA 5GIPC 1T0KB 1K8AH 1YJWF 1YJNF 1X7OA 1VQOF 3I56F 3N4YA 2WALA 3I55F 1ZWZA 2KTUA 2BO1A 3CCUF 2FC3A 3CCQF 5EWRA 3O85A 1W40A 5DCVA 3E1YA 1VQ7F 3NMUC 3WXMB 4BY9D 3RA5A 3NK7A 3VI6A 1VQNF 1N8RH 3GYQA 3MCAB 1IPAA 1YIJF 1H7MA 2LBXA 1RA4A 2OZBA 1VQ9F 3JAMM 2KTVA 3CC2F 2VGNA 4TZZA 1VQ5F 3CD6F 3AGKA 1S72F 5A2QM 1W42A 3PAFA 1X7PA 2ALEA 3CCLF 3G71F 3CMAF 3CCRF 1YI2F 1M1KH 3CCEF 5FJ4C 1X52A 1Q82H 1GO0A 3CCVF 1VQLF 5GAPK 3OW2F 1PXWA 3NK6A 5GINC 2QI2A 3VMFB 3CXCF 3JCMM 3CC4F 1W3EX 3SIUA 2KG4A 1VQ8F 2HVYD 1QVGF 2JNBA 3LWOC 5FLXM 3V7EA 1SDSA 3LWQC 1YJ9F 5IT9M 1NJIH 4X3LA 1KQSF 3J80M 5EO3A 2QEXF 1XBIA 3NVIB 1JJ2F 1GO1A 1NMUB 3CPQA 1VQ4F 5G4UC 1GZ0A 1CK2A 3ON1A 2OTLF 3CMEF 3J81M 1KD1H 1YHQF 4BW0B 4LCKA 1K73H 5GIOC 3LWVC 3IR9A 1Q81H 2OHWA 4NUTA 1CN7A 1RLGA 3HAXD 3G6EF 2I6DA 1VQKF 3J7AR 3SIVA 1VQMF 1Q7YH 5GANK 1QVFF 3CCSF 3LFOA 1W2BF 3CC7F 1Q86H 2OTJF 3RA6A 3NVKE 3N4ZA 1VQPF 5G4VC 1KC8H 2QA4F 2CZWA 1DT9A 3HJWC 2AIFA 1YITF 4C4WC 3G4SF
chains in the Genus database with same CATH superfamily
2CSLA 3ESJA 1JFFA 5BMVB 4BT3A 5IJ9A 2CVLA 1E7KA 1VQ6F 3E20B 1SA0A 3CPWF 3JASA 3LDTA 3OBWA 4X3MA 3WGLA 1T0KB 1K8AH 2ZVYA 1H47A 3P0ZA 2Z1FA 4I50A 5HY1A 4NWOB 2I6RA 3KJJA 5EB0A 4DXDA 2RHJA 2R6R1 3FPIA 4I4TA 2P6YA 3RYIB 4F6RB 1FFXB 1ODEA 2UYNA 4BT7A 5EAZA 3RA5A 3NK7A 1VQNF 5HXZA 5GONA 3JARB 3K12A 4I4TB 5CA1A 5FNVB 4G88A 3VIUA 3JAMM 3C9TA 4KWEA 5LYJA 1VQ5F 4M8IA 3CD6F 3U0OA 4EI9A 1TVKB 3PAFA 2ALEA 3VOBA 2UYPA 1NQ3A 3I3FA 3VYTC 2ZVZA 3C8LA 5FJ4C 1X52A 1GO0A 3HKEA 5CA1B 3CCVF 1VQLF 3HWUA 4FFBB 4TV9B 1UI9A 5ITZB 5BMVA 5GINC 3JARA 3VMFB 3WPXA 3CYQA 1W3EX 3KJKA 2HP3A 3RYFA 2AMTA 2JNBA 3LWOC 2UYJA 1CLIA 2G9IA 1T0AA 2ZOVA 4I50B 1NJIH 1KQSF 3J80M 5EO3A 2QEXF 2BTUA 3RYHB 3F0GA 1VK3A 3ELCA 1NMUB 3CPQA 4TV8A 1CK2A 4HNAB 5AVMA 3HKDB 1SZQA 4TUYA 4B5CA 5LP6B 3K14A 1YHQF 3M84A 4BW0B 4BVTA 1K73H 4LCKA 1JFFB 5HY4A 3HKEB 1Q81H 1CN7A 5HWEA 3KHNA 3C9RA 3QHDA 1XHOA 4RQOA 4O2BB 3N2GA 4C8GA 1Q7YH 4G4XA 2Z1TA 5LOVA 3QUWA 1KNKA 3NVKE 5FNVA 3N4ZA 2CZWA 5KX5B 3HJWC 2AIFA 4C4WC 4O4HB 2NMUA 1XRGA 3LWPC 5EZYA 3D54A 5JQGA 3VCZA 2IAFA 4DRXB 5JH7A 4IIJA 5KMGA 2VGMA 3VYSC 1OAPA 3VTIC 2H6LA 1Q8RA 4O4JA 1YJNF 4BT5A 4O4LA 3JASB 1SA0B 2BO1A 4I55B 4X1KA 4WBNA 2HS3A 4ZHQA 3S0HA 4O2AB 5EWRA 5C8YA 3CCQF 5JVDB 1W40A 5DCVA 2YXZA 4X1YA 2IG8A 4BT2A 1VQ7F 3NMUC 3JALB 3F0EA 4WBNB 4B62A 3QTYA 1FNJA 3MCAB 1H7MA 2LBXA 5LA6A 4ZK7A 4O4JB 3WJQA 3C9SA 3AGKA 3JAWA 1X25A 3CCLF 3IEWA 3G71F 3CCRF 3CCEF 1Q82H 5JQGB 5GAPK 3K0TA 3P4EA 1W59A 4C81A 4ZI7A 5IYZB 4YJ2A 4BVQA 1W5EA 3JCMM 1TUBB 2QTPA 2KG4A 2HVYD 2PHNA 5IJ0A 5ITZA 3V7EA 2RB9A 1YJ9F 2Q1YA 3MDOA 5IT9M 3D00A 3JATB 5CB4A 3CB2A 4X3LA 4O4LB 3E22A 1QU9A 3FBAA 4X1IB 1COMA 3ZO8A 4RHAA 4E6EA 5IJ0B 2LBTA 2ZODA 3IKEA 3TD3A 1VH8A 1VQVA 4TUYB 1KD1H 5GONB 2ZF8A 2YYEA 5EIBD 3JAKA 3WGNA 3IKFA 3ZP4A 2OHWA 4TV8B 1RLGA 3HAXD 2DT4A 3UT5A 2KGWA 2LCAA 3JAWB 1W55A 3LFOA 3CC7F 1Q86H 2OTJF 3V3TA 3HKBA 2HS0A 3GTZA 1FNKA 4ZHYB 3R0PA 3RYFB 1JD1A 1YITF 1QD9A 3HKCA 1IV4A 1ONIA 3CCJF 1M90H 3S0WA 5JVDA 1DBFA 2PMPA 3F0DA 3OBYA 1K9MH 3ZP7A 2W8BC 4HNAA 4R40B 2HRYA 3PLAC 1H48A 2HQSC 3CCMF 5HP8A 1YJWF 3S02A 1U3LA 2UYKA 3ERNA 4IHJA 4IIJB 5KMGB 5J2TB 5J2UB 2KTUA 5JH7B 3FD5A 1RQ7A 1W5FA 2CWJA 4B45A 5MN6A 5HY0A 3O85A 5LXTB 2UYNB 4ZHWA 4F6RA 2HS4A 4U39A 3M4SA 4G4ZA 1N8RH 2VAMA 5KX5A 3GYQA 3OONA 2HP0A 2N48A 2L26A 4U3JA 1RA4A 2MQEA 4IHJB 1YIJF 1W57A 3TD4A 4BVSA 4C8EA 2KTVA 3CC2F 4TZZA 3BYQA 2Z1UA 5A2QM 1W42A 1TVKA 3WGKA 1X7PA 1Z5VA 3B6NA 3JATA 5LYJB 1GX1A 2Q1XA 2FGYA 3DDNA 2QI2A 3LMEA 4BT4A 4ERHA 3HKDA 3KIZA 1TUBA 2Z1EA 3HKCB 3CC4F 1FFXA 1VQ8F 2VAPA 3F6MA 2BTOA 3IMPA 3P10A 1QVGF 4ZI7B 5IYZA 2GLZA 3KE1A 5FLXM 5JCOC 2DYYA 1SDSA 5HXUA 2R751 4G4YA 3MQWA 3NVIB 4BVRA 4G4WA 1IV1A 1VQ4F 5JCOA 4C8IA 2GZLA 1UFYA 5LA6B 3ON1A 2Z01A 3CMEF 3J81M 1JY8A 1XV2A 1KNJA 3WJRA 3MBMA 3LWVC 4FFBA 4B46A 3IR9A 5MN5A 4NUTA 2RHHA 5EB1B 3G6EF 2I6DA 1VQKF 4BT6A 5EYPB 3J7AR 4X1IA 4O2AA 4ZHQB 3HTNA 3SIVA 4EI8A 1VQMF 4O4IA 5GANK 2H8CA 1JN1A 1W2BF 2V9YA 5G4VC 3C9UA 3M1XA 3VOAA 1DT9A 2OTMA 5EIBC 3UT5B 3G4SF 1OFUA 3ZOPA 4DRXA 2LBWA 3LWRC 2RHLA 3FD6A 5EZYB 5HP7A 1W41A 1YQNA 3V7QA 3VYUC 5LXTA 3JVHA 3EORA 3S0YA 4O4HA 5J2UA 3T80A 3FFMA 3Q8HA 3CG6A 5GIPC 4X20A 1W5BA 2HRUA 2VXYA 3WGJA 5HY2A 1X7OA 1YGYA 1VQOF 4G4VA 3I56F 3N4YA 2WALA 5LOVB 3I55F 1ZWZA 3N2KA 5MN4A 4LNUA 1R1MA 1Z5WA 3CCUF 2FC3A 4ZHVA 3JALA 5IJ9B 5EYPA 4EB6A 3DC2A 3E1YA 5LP6C 4X1YB 3WXMB 3RYCA 4BY9D 3VI6A 5C8YB 3CYPB 1U3PA 4LNUB 1IPAA 3HKBB 2OZBA 1VQ9F 4ZOLA 2HX0A 3MCQA 2VGNA 1S72F 3D01A 4X20B 1IV2A 2RHOA 3F0FA 1IV3A 3CMAF 1YI2F 1M1KH 2GVIA 3JAKB 3OW2F 1PXWA 3NK6A 4YJ3B 2K1SA 2CW4A 2UZHA 2F9ZC 3CXCF 3RE3A 3RYCB 3SIUA 3LYBA 1FSZA 4NQ3A 5CA0B 4EB6B 3I7TA 4TV9A 3S03A 2B33A 3E22B 4I55A 4X1KB 3LWQC 3N2KB 3TD5A 3L7QA 5CB4B 1U40A 4C82A 4O4IB 3WJPA 1XBIA 4O2BA 5B8FA 1JJ2F 1GO1A 1VHAA 5CA0A 2IQQA 4PWTA 5G4UC 2H8EA 3VO8A 1GZ0A 2HP0B 4U3JB 2OTLF 4EI7A 1RLUA 1QAHA 5LP6A 1U43A 1J7HA 4YJ3A 4YJ2B 3IEQA 5GIOC 3RYIA 2ZAUA 3GHZA 3S06A 1PF5A 3K2XA 3V4DA 1W5AA 1RQ2A 2AIZP 3RYHA 4XCQA 1QVFF 3CCSF 5J2TA 2CHTA 2CHSA 3RA6A 3WGMA 2BTQB 2EWCA 2VAWA 1W581 4ZOLB 1VQPF 3WPWA 1KC8H 2QA4F 3N2GB
chains in the Genus database with same CATH topology
2LBWA 3CCJF 3LWRC 1M90H 1W41A 3V7QA 3LWPC 3OBYA 1K9MH 1E7KA 1VQ6F 3E20B 3CPWF 2VGMA 3FFMA 3PLAC 3CCMF 3OBWA 3CG6A 4X3MA 5GIPC 1T0KB 1K8AH 1YJWF 1YJNF 5HY2A 1X7OA 1VQOF 5HY1A 3I56F 3N4YA 2WALA 3I55F 1ZWZA 2KTUA 2BO1A 3CCUF 2FC3A 3CCQF 5HY0A 5EWRA 3O85A 1W40A 5DCVA 3E1YA 1VQ7F 3NMUC 3WXMB 4BY9D 3RA5A 3NK7A 3VI6A 1VQNF 5HXZA 1N8RH 3GYQA 3MCAB 1IPAA 1YIJF 1H7MA 2LBXA 1RA4A 2OZBA 1VQ9F 4BVSA 3JAMM 2KTVA 3CC2F 2VGNA 4TZZA 1VQ5F 3CD6F 3AGKA 1S72F 5A2QM 1W42A 4EI9A 3PAFA 1X7PA 2ALEA 3CCLF 3G71F 3CMAF 3CCRF 1YI2F 1M1KH 3CCEF 5FJ4C 1X52A 1Q82H 1GO0A 3CCVF 1VQLF 2FGYA 5GAPK 3OW2F 1PXWA 3NK6A 5GINC 2QI2A 4BVQA 3VMFB 2F9ZC 3CXCF 3JCMM 3CC4F 1W3EX 3SIUA 2KG4A 1VQ8F 2HVYD 1QVGF 2JNBA 4NQ3A 2GLZA 3LWOC 5FLXM 3V7EA 1SDSA 3LWQC 5HXUA 1YJ9F 5IT9M 3D00A 1NJIH 4X3LA 1KQSF 3J80M 5EO3A 2QEXF 1XBIA 3NVIB 1JJ2F 1GO1A 4BVRA 1NMUB 3CPQA 1VQ4F 5G4UC 1GZ0A 1CK2A 3ON1A 2OTLF 4EI7A 3CMEF 3J81M 1KD1H 1YHQF 4BW0B 4BVTA 1K73H 5GIOC 4LCKA 3LWVC 5HY4A 3IR9A 1Q81H 2OHWA 4NUTA 1CN7A 5HWEA 1RLGA 3G6EF 3HAXD 2I6DA 1VQKF 3J7AR 3SIVA 4EI8A 4XCQA 1VQMF 1Q7YH 5GANK 1QVFF 3CCSF 3LFOA 1W2BF 3CC7F 1Q86H 2OTJF 3RA6A 3V3TA 3NVKE 3N4ZA 1VQPF 5G4VC 1KC8H 2QA4F 2CZWA 1DT9A 3HJWC 2AIFA 1YITF 4C4WC 3G4SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  3CCJ F;  3LWR C;  1M90 H;  1W41 A;  3V7Q A;  3LWP C;  3OBY A;  1K9M H;  1E7K A;  1VQ6 F;  3E20 B;  3CPW F;  2VGM A;  3FFM A;  3PLA C;  3CCM F;  3OBW A;  3CG6 A;  4X3M A;  5GIP C;  1T0K B;  1K8A H;  1YJW F;  1YJN F;  1X7O A;  1VQO F;  3I56 F;  3N4Y A;  2WAL A;  3I55 F;  1ZWZ A;  2KTU A;  2BO1 A;  3CCU F;  2FC3 A;  3CCQ F;  5EWR A;  3O85 A;  1W40 A;  5DCV A;  3E1Y A;  1VQ7 F;  3NMU C;  3WXM B;  4BY9 D;  3RA5 A;  3NK7 A;  3VI6 A;  1VQN F;  1N8R H;  3GYQ A;  3MCA B;  1IPA A;  1YIJ F;  1H7M A;  2LBX A;  1RA4 A;  2OZB A;  1VQ9 F;  3JAM M;  2KTV A;  3CC2 F;  2VGN A;  4TZZ A;  1VQ5 F;  3CD6 F;  3AGK A;  1S72 F;  5A2Q M;  1W42 A;  3PAF A;  1X7P A;  2ALE A;  3CCL F;  3G71 F;  3CMA F;  3CCR F;  1YI2 F;  1M1K H;  3CCE F;  5FJ4 C;  1X52 A;  1Q82 H;  1GO0 A;  3CCV F;  1VQL F;  5GAP K;  3OW2 F;  1PXW A;  3NK6 A;  5GIN C;  2QI2 A;  3VMF B;  3CXC F;  3JCM M;  3CC4 F;  1W3E X;  3SIU A;  2KG4 A;  1VQ8 F;  2HVY D;  1QVG F;  2JNB A;  3LWO C;  5FLX M;  3V7E A;  1SDS A;  3LWQ C;  1YJ9 F;  5IT9 M;  1NJI H;  4X3L A;  1KQS F;  3J80 M;  5EO3 A;  2QEX F;  1XBI A;  3NVI B;  1JJ2 F;  1GO1 A;  1NMU B;  3CPQ A;  1VQ4 F;  5G4U C;  1GZ0 A;  1CK2 A;  3ON1 A;  2OTL F;  3CME F;  3J81 M;  1KD1 H;  1YHQ F;  4BW0 B;  4LCK A;  1K73 H;  5GIO C;  3LWV C;  3IR9 A;  1Q81 H;  2OHW A;  4NUT A;  1CN7 A;  1RLG A;  3HAX D;  3G6E F;  2I6D A;  1VQK F;  3J7A R;  3SIV A;  1VQM F;  1Q7Y H;  5GAN K;  1QVF F;  3CCS F;  3LFO A;  1W2B F;  3CC7 F;  1Q86 H;  2OTJ F;  3RA6 A;  3NVK E;  3N4Z A;  1VQP F;  5G4V C;  1KC8 H;  2QA4 F;  2CZW A;  1DT9 A;  3HJW C;  2AIF A;  1YIT F;  4C4W C;  3G4S F; 
#chains in the Genus database with same CATH topology
 2CSL A;  3ESJ A;  1JFF A;  5BMV B;  4BT3 A;  5IJ9 A;  2CVL A;  1E7K A;  1VQ6 F;  3E20 B;  1SA0 A;  3CPW F;  3JAS A;  3LDT A;  3OBW A;  4X3M A;  3WGL A;  1T0K B;  1K8A H;  2ZVY A;  1H47 A;  3P0Z A;  2Z1F A;  4I50 A;  5HY1 A;  4NWO B;  2I6R A;  3KJJ A;  5EB0 A;  4DXD A;  2RHJ A;  2R6R 1;  3FPI A;  4I4T A;  2P6Y A;  3RYI B;  4F6R B;  1FFX B;  1ODE A;  2UYN A;  4BT7 A;  5EAZ A;  3RA5 A;  3NK7 A;  1VQN F;  5HXZ A;  5GON A;  3JAR B;  3K12 A;  4I4T B;  5CA1 A;  5FNV B;  4G88 A;  3VIU A;  3JAM M;  3C9T A;  4KWE A;  5LYJ A;  1VQ5 F;  4M8I A;  3CD6 F;  3U0O A;  4EI9 A;  1TVK B;  3PAF A;  2ALE A;  3VOB A;  2UYP A;  1NQ3 A;  3I3F A;  3VYT C;  2ZVZ A;  3C8L A;  5FJ4 C;  1X52 A;  1GO0 A;  3HKE A;  5CA1 B;  3CCV F;  1VQL F;  3HWU A;  4FFB B;  4TV9 B;  1UI9 A;  5ITZ B;  5BMV A;  5GIN C;  3JAR A;  3VMF B;  3WPX A;  3CYQ A;  1W3E X;  3KJK A;  2HP3 A;  3RYF A;  2AMT A;  2JNB A;  3LWO C;  2UYJ A;  1CLI A;  2G9I A;  1T0A A;  2ZOV A;  4I50 B;  1NJI H;  1KQS F;  3J80 M;  5EO3 A;  2QEX F;  2BTU A;  3RYH B;  3F0G A;  1VK3 A;  3ELC A;  1NMU B;  3CPQ A;  4TV8 A;  1CK2 A;  4HNA B;  5AVM A;  3HKD B;  1SZQ A;  4TUY A;  4B5C A;  5LP6 B;  3K14 A;  1YHQ F;  3M84 A;  4BW0 B;  4BVT A;  1K73 H;  4LCK A;  1JFF B;  5HY4 A;  3HKE B;  1Q81 H;  1CN7 A;  5HWE A;  3KHN A;  3C9R A;  3QHD A;  1XHO A;  4RQO A;  4O2B B;  3N2G A;  4C8G A;  1Q7Y H;  4G4X A;  2Z1T A;  5LOV A;  3QUW A;  1KNK A;  3NVK E;  5FNV A;  3N4Z A;  2CZW A;  5KX5 B;  3HJW C;  2AIF A;  4C4W C;  4O4H B;  2NMU A;  1XRG A;  3LWP C;  5EZY A;  3D54 A;  5JQG A;  3VCZ A;  2IAF A;  4DRX B;  5JH7 A;  4IIJ A;  5KMG A;  2VGM A;  3VYS C;  1OAP A;  3VTI C;  2H6L A;  1Q8R A;  4O4J A;  1YJN F;  4BT5 A;  4O4L A;  3JAS B;  1SA0 B;  2BO1 A;  4I55 B;  4X1K A;  4WBN A;  2HS3 A;  4ZHQ A;  3S0H A;  4O2A B;  5EWR A;  5C8Y A;  3CCQ F;  5JVD B;  1W40 A;  5DCV A;  2YXZ A;  4X1Y A;  2IG8 A;  4BT2 A;  1VQ7 F;  3NMU C;  3JAL B;  3F0E A;  4WBN B;  4B62 A;  3QTY A;  1FNJ A;  3MCA B;  1H7M A;  2LBX A;  5LA6 A;  4ZK7 A;  4O4J B;  3WJQ A;  3C9S A;  3AGK A;  3JAW A;  1X25 A;  3CCL F;  3IEW A;  3G71 F;  3CCR F;  3CCE F;  1Q82 H;  5JQG B;  5GAP K;  3K0T A;  3P4E A;  1W59 A;  4C81 A;  4ZI7 A;  5IYZ B;  4YJ2 A;  4BVQ A;  1W5E A;  3JCM M;  1TUB B;  2QTP A;  2KG4 A;  2HVY D;  2PHN A;  5IJ0 A;  5ITZ A;  3V7E A;  2RB9 A;  1YJ9 F;  2Q1Y A;  3MDO A;  5IT9 M;  3D00 A;  3JAT B;  5CB4 A;  3CB2 A;  4X3L A;  4O4L B;  3E22 A;  1QU9 A;  3FBA A;  4X1I B;  1COM A;  3ZO8 A;  4RHA A;  4E6E A;  5IJ0 B;  2LBT A;  2ZOD A;  3IKE A;  3TD3 A;  1VH8 A;  1VQV A;  4TUY B;  1KD1 H;  5GON B;  2ZF8 A;  2YYE A;  5EIB D;  3JAK A;  3WGN A;  3IKF A;  3ZP4 A;  2OHW A;  4TV8 B;  1RLG A;  3HAX D;  2DT4 A;  3UT5 A;  2KGW A;  2LCA A;  3JAW B;  1W55 A;  3LFO A;  3CC7 F;  1Q86 H;  2OTJ F;  3V3T A;  3HKB A;  2HS0 A;  3GTZ A;  1FNK A;  4ZHY B;  3R0P A;  3RYF B;  1JD1 A;  1YIT F;  1QD9 A;  3HKC A;  1IV4 A;  1ONI A;  3CCJ F;  1M90 H;  3S0W A;  5JVD A;  1DBF A;  2PMP A;  3F0D A;  3OBY A;  1K9M H;  3ZP7 A;  2W8B C;  4HNA A;  4R40 B;  2HRY A;  3PLA C;  1H48 A;  2HQS C;  3CCM F;  5HP8 A;  1YJW F;  3S02 A;  1U3L A;  2UYK A;  3ERN A;  4IHJ A;  4IIJ B;  5KMG B;  5J2T B;  5J2U B;  2KTU A;  5JH7 B;  3FD5 A;  1RQ7 A;  1W5F A;  2CWJ A;  4B45 A;  5MN6 A;  5HY0 A;  3O85 A;  5LXT B;  2UYN B;  4ZHW A;  4F6R A;  2HS4 A;  4U39 A;  3M4S A;  4G4Z A;  1N8R H;  2VAM A;  5KX5 A;  3GYQ A;  3OON A;  2HP0 A;  2N48 A;  2L26 A;  4U3J A;  1RA4 A;  2MQE A;  4IHJ B;  1YIJ F;  1W57 A;  3TD4 A;  4BVS A;  4C8E A;  2KTV A;  3CC2 F;  4TZZ A;  3BYQ A;  2Z1U A;  5A2Q M;  1W42 A;  1TVK A;  3WGK A;  1X7P A;  1Z5V A;  3B6N A;  3JAT A;  5LYJ B;  1GX1 A;  2Q1X A;  2FGY A;  3DDN A;  2QI2 A;  3LME A;  4BT4 A;  4ERH A;  3HKD A;  3KIZ A;  1TUB A;  2Z1E A;  3HKC B;  3CC4 F;  1FFX A;  1VQ8 F;  2VAP A;  3F6M A;  2BTO A;  3IMP A;  3P10 A;  1QVG F;  4ZI7 B;  5IYZ A;  2GLZ A;  3KE1 A;  5FLX M;  5JCO C;  2DYY A;  1SDS A;  5HXU A;  2R75 1;  4G4Y A;  3MQW A;  3NVI B;  4BVR A;  4G4W A;  1IV1 A;  1VQ4 F;  5JCO A;  4C8I A;  2GZL A;  1UFY A;  5LA6 B;  3ON1 A;  2Z01 A;  3CME F;  3J81 M;  1JY8 A;  1XV2 A;  1KNJ A;  3WJR A;  3MBM A;  3LWV C;  4FFB A;  4B46 A;  3IR9 A;  5MN5 A;  4NUT A;  2RHH A;  5EB1 B;  3G6E F;  2I6D A;  1VQK F;  4BT6 A;  5EYP B;  3J7A R;  4X1I A;  4O2A A;  4ZHQ B;  3HTN A;  3SIV A;  4EI8 A;  1VQM F;  4O4I A;  5GAN K;  2H8C A;  1JN1 A;  1W2B F;  2V9Y A;  5G4V C;  3C9U A;  3M1X A;  3VOA A;  1DT9 A;  2OTM A;  5EIB C;  3UT5 B;  3G4S F;  1OFU A;  3ZOP A;  4DRX A;  2LBW A;  3LWR C;  2RHL A;  3FD6 A;  5EZY B;  5HP7 A;  1W41 A;  1YQN A;  3V7Q A;  3VYU C;  5LXT A;  3JVH A;  3EOR A;  3S0Y A;  4O4H A;  5J2U A;  3T80 A;  3FFM A;  3Q8H A;  3CG6 A;  5GIP C;  4X20 A;  1W5B A;  2HRU A;  2VXY A;  3WGJ A;  5HY2 A;  1X7O A;  1YGY A;  1VQO F;  4G4V A;  3I56 F;  3N4Y A;  2WAL A;  5LOV B;  3I55 F;  1ZWZ A;  3N2K A;  5MN4 A;  4LNU A;  1R1M A;  1Z5W A;  3CCU F;  2FC3 A;  4ZHV A;  3JAL A;  5IJ9 B;  5EYP A;  4EB6 A;  3DC2 A;  3E1Y A;  5LP6 C;  4X1Y B;  3WXM B;  3RYC A;  4BY9 D;  3VI6 A;  5C8Y B;  3CYP B;  1U3P A;  4LNU B;  1IPA A;  3HKB B;  2OZB A;  1VQ9 F;  4ZOL A;  2HX0 A;  3MCQ A;  2VGN A;  1S72 F;  3D01 A;  4X20 B;  1IV2 A;  2RHO A;  3F0F A;  1IV3 A;  3CMA F;  1YI2 F;  1M1K H;  2GVI A;  3JAK B;  3OW2 F;  1PXW A;  3NK6 A;  4YJ3 B;  2K1S A;  2CW4 A;  2UZH A;  2F9Z C;  3CXC F;  3RE3 A;  3RYC B;  3SIU A;  3LYB A;  1FSZ A;  4NQ3 A;  5CA0 B;  4EB6 B;  3I7T A;  4TV9 A;  3S03 A;  2B33 A;  3E22 B;  4I55 A;  4X1K B;  3LWQ C;  3N2K B;  3TD5 A;  3L7Q A;  5CB4 B;  1U40 A;  4C82 A;  4O4I B;  3WJP A;  1XBI A;  4O2B A;  5B8F A;  1JJ2 F;  1GO1 A;  1VHA A;  5CA0 A;  2IQQ A;  4PWT A;  5G4U C;  2H8E A;  3VO8 A;  1GZ0 A;  2HP0 B;  4U3J B;  2OTL F;  4EI7 A;  1RLU A;  1QAH A;  5LP6 A;  1U43 A;  1J7H A;  4YJ3 A;  4YJ2 B;  3IEQ A;  5GIO C;  3RYI A;  2ZAU A;  3GHZ A;  3S06 A;  1PF5 A;  3K2X A;  3V4D A;  1W5A A;  1RQ2 A;  2AIZ P;  3RYH A;  4XCQ A;  1QVF F;  3CCS F;  5J2T A;  2CHT A;  2CHS A;  3RA6 A;  3WGM A;  2BTQ B;  2EWC A;  2VAW A;  1W58 1;  4ZOL B;  1VQP F;  3WPW A;  1KC8 H;  2QA4 F;  3N2G B; 
#chains in the Genus database with same CATH homology
 2LBW A;  3CCJ F;  3LWR C;  1M90 H;  1W41 A;  3V7Q A;  3LWP C;  3OBY A;  1K9M H;  1E7K A;  1VQ6 F;  3E20 B;  3CPW F;  2VGM A;  3FFM A;  3PLA C;  3CCM F;  3OBW A;  3CG6 A;  4X3M A;  5GIP C;  1T0K B;  1K8A H;  1YJW F;  1YJN F;  5HY2 A;  1X7O A;  1VQO F;  5HY1 A;  3I56 F;  3N4Y A;  2WAL A;  3I55 F;  1ZWZ A;  2KTU A;  2BO1 A;  3CCU F;  2FC3 A;  3CCQ F;  5HY0 A;  5EWR A;  3O85 A;  1W40 A;  5DCV A;  3E1Y A;  1VQ7 F;  3NMU C;  3WXM B;  4BY9 D;  3RA5 A;  3NK7 A;  3VI6 A;  1VQN F;  5HXZ A;  1N8R H;  3GYQ A;  3MCA B;  1IPA A;  1YIJ F;  1H7M A;  2LBX A;  1RA4 A;  2OZB A;  1VQ9 F;  4BVS A;  3JAM M;  2KTV A;  3CC2 F;  2VGN A;  4TZZ A;  1VQ5 F;  3CD6 F;  3AGK A;  1S72 F;  5A2Q M;  1W42 A;  4EI9 A;  3PAF A;  1X7P A;  2ALE A;  3CCL F;  3G71 F;  3CMA F;  3CCR F;  1YI2 F;  1M1K H;  3CCE F;  5FJ4 C;  1X52 A;  1Q82 H;  1GO0 A;  3CCV F;  1VQL F;  2FGY A;  5GAP K;  3OW2 F;  1PXW A;  3NK6 A;  5GIN C;  2QI2 A;  4BVQ A;  3VMF B;  2F9Z C;  3CXC F;  3JCM M;  3CC4 F;  1W3E X;  3SIU A;  2KG4 A;  1VQ8 F;  2HVY D;  1QVG F;  2JNB A;  4NQ3 A;  2GLZ A;  3LWO C;  5FLX M;  3V7E A;  1SDS A;  3LWQ C;  5HXU A;  1YJ9 F;  5IT9 M;  3D00 A;  1NJI H;  4X3L A;  1KQS F;  3J80 M;  5EO3 A;  2QEX F;  1XBI A;  3NVI B;  1JJ2 F;  1GO1 A;  4BVR A;  1NMU B;  3CPQ A;  1VQ4 F;  5G4U C;  1GZ0 A;  1CK2 A;  3ON1 A;  2OTL F;  4EI7 A;  3CME F;  3J81 M;  1KD1 H;  1YHQ F;  4BW0 B;  4BVT A;  1K73 H;  5GIO C;  4LCK A;  3LWV C;  5HY4 A;  3IR9 A;  1Q81 H;  2OHW A;  4NUT A;  1CN7 A;  5HWE A;  1RLG A;  3G6E F;  3HAX D;  2I6D A;  1VQK F;  3J7A R;  3SIV A;  4EI8 A;  4XCQ A;  1VQM F;  1Q7Y H;  5GAN K;  1QVF F;  3CCS F;  3LFO A;  1W2B F;  3CC7 F;  1Q86 H;  2OTJ F;  3RA6 A;  3V3T A;  3NVK E;  3N4Z A;  1VQP F;  5G4V C;  1KC8 H;  2QA4 F;  2CZW A;  1DT9 A;  3HJW C;  2AIF A;  1YIT F;  4C4W C;  3G4S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...