1VQ5F

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq5F00
3G6EF 3N4YA 3CCSF 5IT9M 3CCMF 1CK2A 3CCEF 3O85A 1T0KB 3E1YA 3NVKE 3CD6F 5G4VC 3ON1A 1X7OA 1VQ5F 3NMUC 3OBWA 3CCLF 1Q86H 1W42A 5EWRA 3LWRC 3AGKA 3LWQC 3CPQA 1RLGA 1QVFF 1YJWF 3CCVF 1YI2F 4C4WC 2JNBA 3PLAC 3JAMM 3V7EA 1VQLF 3FFMA 1QVGF 2QEXF 1GZ0A 4LCKA 1VQOF 3RA6A 1GO0A 1VQ8F 2FC3A 1YITF 3LWPC 1RA4A 3N4ZA 3PAFA 3J81M 1YHQF 3G4SF 1W2BF 2VGNA 3CC4F 3HAXD 1XBIA 1W40A 1YJ9F 3I56F 1KQSF 1S72F 1CN7A 3CC7F 1K8AH 3JCMM 1Q81H 2HVYD 3IR9A 3CPWF 1VQ4F 1VQ6F 2LBWA 3GYQA 1YIJF 1W41A 5G4UC 4BW0B 1SDSA 2LBXA 2KTUA 1PXWA 1VQMF 3J7AR 3NVIB 3CMEF 3VMFB 5GINC 2BO1A 1YJNF 4X3LA 1IPAA 1N8RH 2AIFA 2KG4A 1KC8H 1ZWZA 4NUTA 1JJ2F 2OTJF 3SIVA 1NMUB 3LWOC 3J80M 3CCQF 1K73H 2VGMA 1VQ7F 3CCJF 3LFOA 5EO3A 3LWVC 1M1KH 3MCAB 4TZZA 3V7QA 1M90H 1VQPF 1W3EX 1VQKF 1Q7YH 3CMAF 3CC2F 3OBYA 5FLXM 5A2QM 1Q82H 3CXCF 5GAPK 3CG6A 1X52A 2WALA 5GIOC 3OW2F 2ALEA 1KD1H 2OTLF 3WXMB 5DCVA 3I55F 3E20B 5GANK 2QA4F 2OHWA 1VQNF 3NK6A 4BY9D 1DT9A 5FJ4C 3HJWC 4X3MA 1H7MA 2CZWA 3SIUA 1NJIH 1K9MH 3RA5A 3CCRF 1VQ9F 2QI2A 2I6DA 1E7KA 1X7PA 3NK7A 3G71F 2KTVA 3CCUF 1GO1A 5GIPC 2OZBA 3VI6A
chains in the Genus database with same CATH superfamily
5AVMA 1SZQA 2HP0B 3N4YA 2HRYA 2I6RA 4M8IA 3O85A 4DRXA 3QTYA 4ZI7A 3HKDB 3E1YA 5G4VC 4C8GA 5CB4A 4RQOA 3NMUC 5HY1A 5KX5A 2CWJA 5HXZA 1IV3A 3LWQC 5IJ9B 4WBNB 3D01A 2B33A 3CPQA 2BTOA 1COMA 1SA0B 3RE3A 1W57A 2UYNB 1JY8A 3UT5B 3S02A 3VYSC 2R6R1 3D54A 2JNBA 3IEQA 3PLAC 2RB9A 3ELCA 3FFMA 5JH7B 3RYIB 4DXDA 4LCKA 2NMUA 5EYPA 1VQ8F 2FC3A 1OFUA 2YXZA 3LWPC 1RA4A 3WJRA 3PAFA 1QD9A 3R0PA 3FPIA 1JFFB 4IHJA 3WJQA 3JATA 4I55B 1TVKA 4I50B 3CC4F 3HAXD 3WGLA 2QTPA 1DBFA 3K12A 4B62A 5J2UA 1CN7A 2CW4A 2RHLA 4I4TB 5C8YB 4TV8B 1Z5WA 3MCQA 3CPWF 4YJ2A 3C9UA 5JQGB 2HP0A 3I7TA 4U3JB 1PXWA 5LXTB 1XV2A 5IYZB 5CA1A 2AIZP 2BO1A 1YJNF 4X20A 4E6EA 5FNVA 3JASA 4ZOLB 4G4VA 5HY4A 2KG4A 1ZWZA 1JJ2F 3FD6A 3SIVA 1Q8RA 3HKCB 2HS0A 2G9IA 3CCQF 3TD4A 1K73H 4B45A 5IJ0A 2UYNA 3CCJF 1VQ7F 3LWVC 4C81A 1M1KH 1FFXB 4XCQA 3KHNA 3V7QA 1M90H 1W3EX 5HXUA 2P6YA 4NQ3A 5FLXM 3KIZA 1Z5VA 1KD1H 2ALEA 3KJJA 3F0GA 4TUYA 4ZI7B 5GANK 2QA4F 3WGMA 5CB4B 5ITZA 5KX5B 3HKBA 4LNUA 3TD5A 4I50A 1UI9A 4BT6A 1K9MH 4G4ZA 2H8CA 4O4IA 5MN4A 4I4TA 2Q1YA 3ESJA 2KTVA 3M4SA 3B6NA 4RHAA 4U3JA 3CCMF 1CK2A 2ZF8A 5EYPB 2Z1EA 2DYYA 3NVKE 5HP7A 3S03A 4PWTA 2OTMA 3JATB 3OBWA 3CCLF 2CHTA 1Q86H 4X1IA 1TVKB 3AGKA 1RLUA 1W59A 1QVFF 5J2UB 3WGJA 1YJWF 2BTQB 4R40B 1YQNA 2RHJA 3ZOPA 4YJ2B 1W5FA 3FD5A 1QU9A 1VQOF 3RA6A 3IEWA 4BVQA 4B46A 2Z1TA 2PHNA 4X1KA 5CA1B 1IV4A 4X20B 5FNVB 3M1XA 5LA6A 3JASB 3CB2A 3J81M 1TUBB 3VO8A 2VGNA 1JN1A 2HRUA 1W40A 1S72F 3CC7F 5IJ0B 4EI9A 3M84A 3VIUA 5J2TA 4BT2A 2LBTA 1VQ4F 1W5EA 2Q1XA 3GYQA 4ZHVA 2DT4A 1RQ7A 5G4UC 2R751 3RYCA 1FNKA 2HP3A 2KTUA 3NVIB 4TUYB 3C9RA 3TD3A 3K0TA 3CYQA 5ITZB 4G88A 3HKBB 5EIBC 2OTJF 4LNUB 1NMUB 3P4EA 3J80M 2UYPA 2HS4A 4O4IB 3QUWA 5EO3A 2CHSA 4ERHA 5BMVB 3MCAB 3F0DA 2YYEA 3C9SA 4C8IA 3IMPA 2W8BC 5GIOC 3IKEA 1XRGA 4O4LB 5JVDA 2HQSC 3F6MA 3VCZA 3MBMA 1VQNF 1PF5A 1IV1A 1DT9A 5FJ4C 1VHAA 3N2GA 1H7MA 1TUBA 2MQEA 4X1IB 3SIUA 2LCAA 5LP6A 1FSZA 2ZODA 1ODEA 1VQ9F 2I6DA 1E7KA 1X7PA 3LDTA 3RYFA 5JCOA 2FGYA 3CCSF 3MQWA 1JD1A 3CCEF 1T0KB 3HTNA 3D00A 2VAWA 4X1KB 1W55A 3S0HA 3ON1A 3ERNA 4C8EA 4F6RA 3P10A 2BTUA 3DC2A 2HS3A 3C9TA 3JALA 4G4WA 2CSLA 3HWUA 5LA6B 4TV9A 2UZHA 1W42A 5EWRA 2GLZA 2EWCA 3WJPA 5MN5A 3WGNA 3U0OA 1QAHA 4O2AA 3L7QA 1H48A 5BMVA 3WPWA 1YI2F 5J2TB 4C4WC 3VTIC 5EZYA 2Z01A 3MDOA 3VYUC 3V7EA 5LOVA 2RHHA 3RYCB 2ZAUA 4O4LA 4EB6B 2ZOVA 1YITF 3V3TA 1R1MA 2H8EA 3N4ZA 2PMPA 1CLIA 2N48A 3G4SF 1W2BF 2UYKA 1U40A 5EB0A 1U43A 1XBIA 5HP8A 3HKEA 4U39A 3IKFA 2GZLA 1K8AH 3N2KA 3IR9A 1FNJA 2LBWA 4YJ3A 1VH8A 3K14A 4BT7A 3S0WA 4BW0B 3C8LA 1SDSA 1VQMF 3CYPB 1NQ3A 5JVDB 2L26A 1ONIA 4X1YB 3VMFB 4ZHQA 4X3LA 3E22A 4O2BB 3DDNA 1N8RH 3RYHA 3JAWA 1T0AA 2Z1UA 3N2GB 3ZO8A 4IIJA 5LP6B 4O4JA 1U3LA 2VGMA 4EI7A 2F9ZC 3F0EA 3RYFB 4EI8A 1VQVA 1VQKF 1Q7YH 1J7HA 3OBYA 5A2QM 1Q82H 5GAPK 3CG6A 1X52A 2WALA 3OW2F 2OTLF 3QHDA 2AMTA 4EB6A 1W581 3E20B 5LYJA 3OONA 2OHWA 4BVSA 4F6RB 1OAPA 4BY9D 3EORA 3S06A 3JALB 5KMGA 5B8FA 4TV9B 4G4YA 3VYTC 5HY0A 3WPXA 3VOAA 3RA5A 2VAMA 2QI2A 4O2AB 4O4HA 3JARA 4HNAA 3V4DA 3NK7A 3G71F 1GO1A 5GIPC 2OZBA 1W5BA 5EZYB 3VI6A 3CCVF 3G6EF 5LOVB 3JAKA 2ZVYA 5IT9M 4KWEA 3F0FA 4FFBA 3Q8HA 2K1SA 3CD6F 4X1YA 4C82A 1X7OA 4O2BA 5CA0A 1UFYA 1VQ5F 1YGYA 5HWEA 3LWRC 2IQQA 5GONA 1H47A 1RLGA 3HKEB 3ZP4A 1XHOA 3N2KB 3I3FA 4BT5A 1W5AA 4NWOB 3JAMM 1VQLF 4YJ3B 3GTZA 4G4XA 5HY2A 1QVGF 2QEXF 1GZ0A 2ZVZA 3ZP7A 1GO0A 3HKDA 1GX1A 2RHOA 4ZHQB 5EIBD 1IV2A 1X25A 3E22B 1YHQF 4BT4A 3RYHB 3JAWB 2IAFA 5IJ9A 3S0YA 4WBNA 4IIJB 1YJ9F 1SA0A 3I56F 1RQ2A 1KQSF 4O4JB 3UT5A 2H6LA 3GHZA 3JCMM 1Q81H 2HVYD 2HX0A 5LP6C 1VQ6F 1YIJF 2CVLA 1W41A 5JH7A 3RYIA 2UYJA 2LBXA 3J7AR 4DRXB 3JVHA 3CMEF 5JCOC 1VK3A 5GINC 5LYJB 2V9YA 1JFFA 1IPAA 4I55A 2AIFA 2VXYA 5KMGB 1U3PA 1KC8H 4NUTA 5EAZA 3VOBA 3LWOC 5MN6A 3BYQA 3LMEA 5C8YA 4ZHYB 4TV8A 4ZK7A 4O4HB 3JARB 3LFOA 4HNAB 4TZZA 3KJKA 1VQPF 3CMAF 3CC2F 5JQGA 3CXCF 4BVRA 3JAKB 5LXTA 2GVIA 3WXMB 5DCVA 3WGKA 5IYZA 3I55F 2Z1FA 3KE1A 4BVTA 4FFBB 3K2XA 3NK6A 4ZOLA 4IHJB 5CA0B 5EB1B 3HJWC 4ZHWA 4X3MA 2VAPA 3P0ZA 1KNJA 2CZWA 4B5CA 1KNKA 1NJIH 3LYBA 3HKCA 2KGWA 3CCRF 5GONB 3FBAA 4BT3A 1FFXA 3T80A 3CCUF 2IG8A
chains in the Genus database with same CATH topology
3G6EF 3N4YA 2FGYA 3CCSF 5IT9M 3CCMF 1CK2A 3CCEF 3O85A 1T0KB 3D00A 3E1YA 3NVKE 3CD6F 5G4VC 3ON1A 1X7OA 1VQ5F 3NMUC 5HY1A 3OBWA 5HWEA 3CCLF 5HXZA 1Q86H 1W42A 5EWRA 2GLZA 3LWRC 3AGKA 3LWQC 3CPQA 1RLGA 1QVFF 1YJWF 3CCVF 1YI2F 4C4WC 2JNBA 3PLAC 3JAMM 3V7EA 1VQLF 3FFMA 5HY2A 1QVGF 2QEXF 1GZ0A 4LCKA 1VQOF 3RA6A 4BVQA 1GO0A 1VQ8F 2FC3A 1YITF 3V3TA 3LWPC 1RA4A 3N4ZA 3PAFA 3J81M 1YHQF 3G4SF 1W2BF 2VGNA 3CC4F 3HAXD 1XBIA 1W40A 1YJ9F 3I56F 1KQSF 1S72F 1CN7A 3CC7F 4EI9A 1K8AH 3JCMM 1Q81H 2HVYD 3IR9A 3CPWF 1VQ4F 1VQ6F 2LBWA 3GYQA 1YIJF 1W41A 5G4UC 4BW0B 1SDSA 2LBXA 2KTUA 1PXWA 1VQMF 3J7AR 3NVIB 3CMEF 3VMFB 5GINC 2BO1A 1YJNF 4X3LA 1IPAA 5HY4A 1N8RH 2AIFA 2KG4A 1KC8H 1ZWZA 4NUTA 1JJ2F 2OTJF 3SIVA 1NMUB 3LWOC 3J80M 3CCQF 1K73H 2VGMA 4EI7A 2F9ZC 1VQ7F 3CCJF 3LFOA 5EO3A 3LWVC 1M1KH 3MCAB 4XCQA 4TZZA 3V7QA 1M90H 4EI8A 1VQPF 1W3EX 1VQKF 1Q7YH 5HXUA 3CMAF 3CC2F 4NQ3A 3OBYA 5FLXM 5A2QM 1Q82H 3CXCF 5GAPK 3CG6A 4BVRA 1X52A 2WALA 5GIOC 3OW2F 2ALEA 1KD1H 2OTLF 3WXMB 5DCVA 3I55F 3E20B 4BVTA 5GANK 2QA4F 2OHWA 4BVSA 3NK6A 1VQNF 4BY9D 1DT9A 5FJ4C 3HJWC 4X3MA 1H7MA 2CZWA 3SIUA 1NJIH 5HY0A 1K9MH 3RA5A 3CCRF 1VQ9F 2QI2A 2I6DA 1E7KA 1X7PA 3NK7A 3G71F 2KTVA 3CCUF 1GO1A 5GIPC 2OZBA 3VI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E F;  3N4Y A;  3CCS F;  5IT9 M;  3CCM F;  1CK2 A;  3CCE F;  3O85 A;  1T0K B;  3E1Y A;  3NVK E;  3CD6 F;  5G4V C;  3ON1 A;  1X7O A;  1VQ5 F;  3NMU C;  3OBW A;  3CCL F;  1Q86 H;  1W42 A;  5EWR A;  3LWR C;  3AGK A;  3LWQ C;  3CPQ A;  1RLG A;  1QVF F;  1YJW F;  3CCV F;  1YI2 F;  4C4W C;  2JNB A;  3PLA C;  3JAM M;  3V7E A;  1VQL F;  3FFM A;  1QVG F;  2QEX F;  1GZ0 A;  4LCK A;  1VQO F;  3RA6 A;  1GO0 A;  1VQ8 F;  2FC3 A;  1YIT F;  3LWP C;  1RA4 A;  3N4Z A;  3PAF A;  3J81 M;  1YHQ F;  3G4S F;  1W2B F;  2VGN A;  3CC4 F;  3HAX D;  1XBI A;  1W40 A;  1YJ9 F;  3I56 F;  1KQS F;  1S72 F;  1CN7 A;  3CC7 F;  1K8A H;  3JCM M;  1Q81 H;  2HVY D;  3IR9 A;  3CPW F;  1VQ4 F;  1VQ6 F;  2LBW A;  3GYQ A;  1YIJ F;  1W41 A;  5G4U C;  4BW0 B;  1SDS A;  2LBX A;  2KTU A;  1PXW A;  1VQM F;  3J7A R;  3NVI B;  3CME F;  3VMF B;  5GIN C;  2BO1 A;  1YJN F;  4X3L A;  1IPA A;  1N8R H;  2AIF A;  2KG4 A;  1KC8 H;  1ZWZ A;  4NUT A;  1JJ2 F;  2OTJ F;  3SIV A;  1NMU B;  3LWO C;  3J80 M;  3CCQ F;  1K73 H;  2VGM A;  1VQ7 F;  3CCJ F;  3LFO A;  5EO3 A;  3LWV C;  1M1K H;  3MCA B;  4TZZ A;  3V7Q A;  1M90 H;  1VQP F;  1W3E X;  1VQK F;  1Q7Y H;  3CMA F;  3CC2 F;  3OBY A;  5FLX M;  5A2Q M;  1Q82 H;  3CXC F;  5GAP K;  3CG6 A;  1X52 A;  2WAL A;  5GIO C;  3OW2 F;  2ALE A;  1KD1 H;  2OTL F;  3WXM B;  5DCV A;  3I55 F;  3E20 B;  5GAN K;  2QA4 F;  2OHW A;  1VQN F;  3NK6 A;  4BY9 D;  1DT9 A;  5FJ4 C;  3HJW C;  4X3M A;  1H7M A;  2CZW A;  3SIU A;  1NJI H;  1K9M H;  3RA5 A;  3CCR F;  1VQ9 F;  2QI2 A;  2I6D A;  1E7K A;  1X7P A;  3NK7 A;  3G71 F;  2KTV A;  3CCU F;  1GO1 A;  5GIP C;  2OZB A;  3VI6 A; 
#chains in the Genus database with same CATH topology
 5AVM A;  1SZQ A;  2HP0 B;  3N4Y A;  2HRY A;  2I6R A;  4M8I A;  3O85 A;  4DRX A;  3QTY A;  4ZI7 A;  3HKD B;  3E1Y A;  5G4V C;  4C8G A;  5CB4 A;  4RQO A;  3NMU C;  5HY1 A;  5KX5 A;  2CWJ A;  5HXZ A;  1IV3 A;  3LWQ C;  5IJ9 B;  4WBN B;  3D01 A;  2B33 A;  3CPQ A;  2BTO A;  1COM A;  1SA0 B;  3RE3 A;  1W57 A;  2UYN B;  1JY8 A;  3UT5 B;  3S02 A;  3VYS C;  2R6R 1;  3D54 A;  2JNB A;  3IEQ A;  3PLA C;  2RB9 A;  3ELC A;  3FFM A;  5JH7 B;  3RYI B;  4DXD A;  4LCK A;  2NMU A;  5EYP A;  1VQ8 F;  2FC3 A;  1OFU A;  2YXZ A;  3LWP C;  1RA4 A;  3WJR A;  3PAF A;  1QD9 A;  3R0P A;  3FPI A;  1JFF B;  4IHJ A;  3WJQ A;  3JAT A;  4I55 B;  1TVK A;  4I50 B;  3CC4 F;  3HAX D;  3WGL A;  2QTP A;  1DBF A;  3K12 A;  4B62 A;  5J2U A;  1CN7 A;  2CW4 A;  2RHL A;  4I4T B;  5C8Y B;  4TV8 B;  1Z5W A;  3MCQ A;  3CPW F;  4YJ2 A;  3C9U A;  5JQG B;  2HP0 A;  3I7T A;  4U3J B;  1PXW A;  5LXT B;  1XV2 A;  5IYZ B;  5CA1 A;  2AIZ P;  2BO1 A;  1YJN F;  4X20 A;  4E6E A;  5FNV A;  3JAS A;  4ZOL B;  4G4V A;  5HY4 A;  2KG4 A;  1ZWZ A;  1JJ2 F;  3FD6 A;  3SIV A;  1Q8R A;  3HKC B;  2HS0 A;  2G9I A;  3CCQ F;  3TD4 A;  1K73 H;  4B45 A;  5IJ0 A;  2UYN A;  3CCJ F;  1VQ7 F;  3LWV C;  4C81 A;  1M1K H;  1FFX B;  4XCQ A;  3KHN A;  3V7Q A;  1M90 H;  1W3E X;  5HXU A;  2P6Y A;  4NQ3 A;  5FLX M;  3KIZ A;  1Z5V A;  1KD1 H;  2ALE A;  3KJJ A;  3F0G A;  4TUY A;  4ZI7 B;  5GAN K;  2QA4 F;  3WGM A;  5CB4 B;  5ITZ A;  5KX5 B;  3HKB A;  4LNU A;  3TD5 A;  4I50 A;  1UI9 A;  4BT6 A;  1K9M H;  4G4Z A;  2H8C A;  4O4I A;  5MN4 A;  4I4T A;  2Q1Y A;  3ESJ A;  2KTV A;  3M4S A;  3B6N A;  4RHA A;  4U3J A;  3CCM F;  1CK2 A;  2ZF8 A;  5EYP B;  2Z1E A;  2DYY A;  3NVK E;  5HP7 A;  3S03 A;  4PWT A;  2OTM A;  3JAT B;  3OBW A;  3CCL F;  2CHT A;  1Q86 H;  4X1I A;  1TVK B;  3AGK A;  1RLU A;  1W59 A;  1QVF F;  5J2U B;  3WGJ A;  1YJW F;  2BTQ B;  4R40 B;  1YQN A;  2RHJ A;  3ZOP A;  4YJ2 B;  1W5F A;  3FD5 A;  1QU9 A;  1VQO F;  3RA6 A;  3IEW A;  4BVQ A;  4B46 A;  2Z1T A;  2PHN A;  4X1K A;  5CA1 B;  1IV4 A;  4X20 B;  5FNV B;  3M1X A;  5LA6 A;  3JAS B;  3CB2 A;  3J81 M;  1TUB B;  3VO8 A;  2VGN A;  1JN1 A;  2HRU A;  1W40 A;  1S72 F;  3CC7 F;  5IJ0 B;  4EI9 A;  3M84 A;  3VIU A;  5J2T A;  4BT2 A;  2LBT A;  1VQ4 F;  1W5E A;  2Q1X A;  3GYQ A;  4ZHV A;  2DT4 A;  1RQ7 A;  5G4U C;  2R75 1;  3RYC A;  1FNK A;  2HP3 A;  2KTU A;  3NVI B;  4TUY B;  3C9R A;  3TD3 A;  3K0T A;  3CYQ A;  5ITZ B;  4G88 A;  3HKB B;  5EIB C;  2OTJ F;  4LNU B;  1NMU B;  3P4E A;  3J80 M;  2UYP A;  2HS4 A;  4O4I B;  3QUW A;  5EO3 A;  2CHS A;  4ERH A;  5BMV B;  3MCA B;  3F0D A;  2YYE A;  3C9S A;  4C8I A;  3IMP A;  2W8B C;  5GIO C;  3IKE A;  1XRG A;  4O4L B;  5JVD A;  2HQS C;  3F6M A;  3VCZ A;  3MBM A;  1VQN F;  1PF5 A;  1IV1 A;  1DT9 A;  5FJ4 C;  1VHA A;  3N2G A;  1H7M A;  1TUB A;  2MQE A;  4X1I B;  3SIU A;  2LCA A;  5LP6 A;  1FSZ A;  2ZOD A;  1ODE A;  1VQ9 F;  2I6D A;  1E7K A;  1X7P A;  3LDT A;  3RYF A;  5JCO A;  2FGY A;  3CCS F;  3MQW A;  1JD1 A;  3CCE F;  1T0K B;  3HTN A;  3D00 A;  2VAW A;  4X1K B;  1W55 A;  3S0H A;  3ON1 A;  3ERN A;  4C8E A;  4F6R A;  3P10 A;  2BTU A;  3DC2 A;  2HS3 A;  3C9T A;  3JAL A;  4G4W A;  2CSL A;  3HWU A;  5LA6 B;  4TV9 A;  2UZH A;  1W42 A;  5EWR A;  2GLZ A;  2EWC A;  3WJP A;  5MN5 A;  3WGN A;  3U0O A;  1QAH A;  4O2A A;  3L7Q A;  1H48 A;  5BMV A;  3WPW A;  1YI2 F;  5J2T B;  4C4W C;  3VTI C;  5EZY A;  2Z01 A;  3MDO A;  3VYU C;  3V7E A;  5LOV A;  2RHH A;  3RYC B;  2ZAU A;  4O4L A;  4EB6 B;  2ZOV A;  1YIT F;  3V3T A;  1R1M A;  2H8E A;  3N4Z A;  2PMP A;  1CLI A;  2N48 A;  3G4S F;  1W2B F;  2UYK A;  1U40 A;  5EB0 A;  1U43 A;  1XBI A;  5HP8 A;  3HKE A;  4U39 A;  3IKF A;  2GZL A;  1K8A H;  3N2K A;  3IR9 A;  1FNJ A;  2LBW A;  4YJ3 A;  1VH8 A;  3K14 A;  4BT7 A;  3S0W A;  4BW0 B;  3C8L A;  1SDS A;  1VQM F;  3CYP B;  1NQ3 A;  5JVD B;  2L26 A;  1ONI A;  4X1Y B;  3VMF B;  4ZHQ A;  4X3L A;  3E22 A;  4O2B B;  3DDN A;  1N8R H;  3RYH A;  3JAW A;  1T0A A;  2Z1U A;  3N2G B;  3ZO8 A;  4IIJ A;  5LP6 B;  4O4J A;  1U3L A;  2VGM A;  4EI7 A;  2F9Z C;  3F0E A;  3RYF B;  4EI8 A;  1VQV A;  1VQK F;  1Q7Y H;  1J7H A;  3OBY A;  5A2Q M;  1Q82 H;  5GAP K;  3CG6 A;  1X52 A;  2WAL A;  3OW2 F;  2OTL F;  3QHD A;  2AMT A;  4EB6 A;  1W58 1;  3E20 B;  5LYJ A;  3OON A;  2OHW A;  4BVS A;  4F6R B;  1OAP A;  4BY9 D;  3EOR A;  3S06 A;  3JAL B;  5KMG A;  5B8F A;  4TV9 B;  4G4Y A;  3VYT C;  5HY0 A;  3WPX A;  3VOA A;  3RA5 A;  2VAM A;  2QI2 A;  4O2A B;  4O4H A;  3JAR A;  4HNA A;  3V4D A;  3NK7 A;  3G71 F;  1GO1 A;  5GIP C;  2OZB A;  1W5B A;  5EZY B;  3VI6 A;  3CCV F;  3G6E F;  5LOV B;  3JAK A;  2ZVY A;  5IT9 M;  4KWE A;  3F0F A;  4FFB A;  3Q8H A;  2K1S A;  3CD6 F;  4X1Y A;  4C82 A;  1X7O A;  4O2B A;  5CA0 A;  1UFY A;  1VQ5 F;  1YGY A;  5HWE A;  3LWR C;  2IQQ A;  5GON A;  1H47 A;  1RLG A;  3HKE B;  3ZP4 A;  1XHO A;  3N2K B;  3I3F A;  4BT5 A;  1W5A A;  4NWO B;  3JAM M;  1VQL F;  4YJ3 B;  3GTZ A;  4G4X A;  5HY2 A;  1QVG F;  2QEX F;  1GZ0 A;  2ZVZ A;  3ZP7 A;  1GO0 A;  3HKD A;  1GX1 A;  2RHO A;  4ZHQ B;  5EIB D;  1IV2 A;  1X25 A;  3E22 B;  1YHQ F;  4BT4 A;  3RYH B;  3JAW B;  2IAF A;  5IJ9 A;  3S0Y A;  4WBN A;  4IIJ B;  1YJ9 F;  1SA0 A;  3I56 F;  1RQ2 A;  1KQS F;  4O4J B;  3UT5 A;  2H6L A;  3GHZ A;  3JCM M;  1Q81 H;  2HVY D;  2HX0 A;  5LP6 C;  1VQ6 F;  1YIJ F;  2CVL A;  1W41 A;  5JH7 A;  3RYI A;  2UYJ A;  2LBX A;  3J7A R;  4DRX B;  3JVH A;  3CME F;  5JCO C;  1VK3 A;  5GIN C;  5LYJ B;  2V9Y A;  1JFF A;  1IPA A;  4I55 A;  2AIF A;  2VXY A;  5KMG B;  1U3P A;  1KC8 H;  4NUT A;  5EAZ A;  3VOB A;  3LWO C;  5MN6 A;  3BYQ A;  3LME A;  5C8Y A;  4ZHY B;  4TV8 A;  4ZK7 A;  4O4H B;  3JAR B;  3LFO A;  4HNA B;  4TZZ A;  3KJK A;  1VQP F;  3CMA F;  3CC2 F;  5JQG A;  3CXC F;  4BVR A;  3JAK B;  5LXT A;  2GVI A;  3WXM B;  5DCV A;  3WGK A;  5IYZ A;  3I55 F;  2Z1F A;  3KE1 A;  4BVT A;  4FFB B;  3K2X A;  3NK6 A;  4ZOL A;  4IHJ B;  5CA0 B;  5EB1 B;  3HJW C;  4ZHW A;  4X3M A;  2VAP A;  3P0Z A;  1KNJ A;  2CZW A;  4B5C A;  1KNK A;  1NJI H;  3LYB A;  3HKC A;  2KGW A;  3CCR F;  5GON B;  3FBA A;  4BT3 A;  1FFX A;  3T80 A;  3CCU F;  2IG8 A; 
#chains in the Genus database with same CATH homology
 3G6E F;  3N4Y A;  2FGY A;  3CCS F;  5IT9 M;  3CCM F;  1CK2 A;  3CCE F;  3O85 A;  1T0K B;  3D00 A;  3E1Y A;  3NVK E;  3CD6 F;  5G4V C;  3ON1 A;  1X7O A;  1VQ5 F;  3NMU C;  5HY1 A;  3OBW A;  5HWE A;  3CCL F;  5HXZ A;  1Q86 H;  1W42 A;  5EWR A;  2GLZ A;  3LWR C;  3AGK A;  3LWQ C;  3CPQ A;  1RLG A;  1QVF F;  1YJW F;  3CCV F;  1YI2 F;  4C4W C;  2JNB A;  3PLA C;  3JAM M;  3V7E A;  1VQL F;  3FFM A;  5HY2 A;  1QVG F;  2QEX F;  1GZ0 A;  4LCK A;  1VQO F;  3RA6 A;  4BVQ A;  1GO0 A;  1VQ8 F;  2FC3 A;  1YIT F;  3V3T A;  3LWP C;  1RA4 A;  3N4Z A;  3PAF A;  3J81 M;  1YHQ F;  3G4S F;  1W2B F;  2VGN A;  3CC4 F;  3HAX D;  1XBI A;  1W40 A;  1YJ9 F;  3I56 F;  1KQS F;  1S72 F;  1CN7 A;  3CC7 F;  4EI9 A;  1K8A H;  3JCM M;  1Q81 H;  2HVY D;  3IR9 A;  3CPW F;  1VQ4 F;  1VQ6 F;  2LBW A;  3GYQ A;  1YIJ F;  1W41 A;  5G4U C;  4BW0 B;  1SDS A;  2LBX A;  2KTU A;  1PXW A;  1VQM F;  3J7A R;  3NVI B;  3CME F;  3VMF B;  5GIN C;  2BO1 A;  1YJN F;  4X3L A;  1IPA A;  5HY4 A;  1N8R H;  2AIF A;  2KG4 A;  1KC8 H;  1ZWZ A;  4NUT A;  1JJ2 F;  2OTJ F;  3SIV A;  1NMU B;  3LWO C;  3J80 M;  3CCQ F;  1K73 H;  2VGM A;  4EI7 A;  2F9Z C;  1VQ7 F;  3CCJ F;  3LFO A;  5EO3 A;  3LWV C;  1M1K H;  3MCA B;  4XCQ A;  4TZZ A;  3V7Q A;  1M90 H;  4EI8 A;  1VQP F;  1W3E X;  1VQK F;  1Q7Y H;  5HXU A;  3CMA F;  3CC2 F;  4NQ3 A;  3OBY A;  5FLX M;  5A2Q M;  1Q82 H;  3CXC F;  5GAP K;  3CG6 A;  4BVR A;  1X52 A;  2WAL A;  5GIO C;  3OW2 F;  2ALE A;  1KD1 H;  2OTL F;  3WXM B;  5DCV A;  3I55 F;  3E20 B;  4BVT A;  5GAN K;  2QA4 F;  2OHW A;  4BVS A;  3NK6 A;  1VQN F;  4BY9 D;  1DT9 A;  5FJ4 C;  3HJW C;  4X3M A;  1H7M A;  2CZW A;  3SIU A;  1NJI H;  5HY0 A;  1K9M H;  3RA5 A;  3CCR F;  1VQ9 F;  2QI2 A;  2I6D A;  1E7K A;  1X7P A;  3NK7 A;  3G71 F;  2KTV A;  3CCU F;  1GO1 A;  5GIP C;  2OZB A;  3VI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...