1VQ5F

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq5F00
1W40A 1E7KA 3OBWA 1W41A 1Q7YH 4C4WC 1VQOF 3E20B 3CMEF 1GZ0A 1VQLF 3OBYA 4X3MA 5GANK 3E1YA 3CCQF 2AIFA 1K8AH 1KC8H 3NVIB 2CZWA 3J81M 2KTVA 3J80M 1VQNF 1N8RH 1QVGF 2OTLF 3CCLF 1CN7A 3VI6A 3CCSF 2ALEA 3LWRC 2JNBA 2LBXA 4LCKA 3N4ZA 3LWQC 2OHWA 3VMFB 3V7EA 5FLXM 3G71F 3CCVF 3V7QA 5DCVA 1GO0A 3HAXD 4BY9D 1PXWA 5FJ4C 3NMUC 3CG6A 1KD1H 5EO3A 2KTUA 1VQ8F 1W42A 2I6DA 1S72F 1Q86H 5IT9M 3AGKA 3WXMB 5GIOC 3CCMF 3HJWC 2OTJF 4BW0B 3CC4F 1T0KB 1RLGA 4NUTA 2QEXF 3OW2F 1Q82H 1GO1A 1DT9A 5G4UC 3RA5A 3G6EF 3CMAF 1VQ9F 1VQ6F 2BO1A 3LWOC 2QI2A 1CK2A 3LFOA 1YHQF 1SDSA 3JAMM 1KQSF 1YIJF 1W2BF 4X3LA 4TZZA 5A2QM 3CCJF 3G4SF 1H7MA 3CXCF 3CD6F 1IPAA 2VGNA 5G4VC 3NVKE 3CC2F 3CC7F 1NMUB 3CCEF 3I55F 1YJNF 3PLAC 3LWPC 1VQ5F 3GYQA 2QA4F 5EWRA 1M90H 5GAPK 1YI2F 3JCMM 1JJ2F 3O85A 1VQKF 2VGMA 3NK7A 1NJIH 3FFMA 3N4YA 3SIUA 1Q81H 1YITF 1VQ7F 3ON1A 1VQ4F 3RA6A 1YJ9F 3J7AR 1YJWF 3CCRF 1W3EX 1RA4A 1K9MH 2OZBA 3NK6A 3LWVC 2LBWA 5GINC 2WALA 1VQMF 3I56F 3CPWF 2FC3A 3CPQA 3PAFA 1ZWZA 1X7OA 2KG4A 1XBIA 1VQPF 1QVFF 1X7PA 3MCAB 2HVYD 3IR9A 5GIPC 3CCUF 1K73H 3SIVA 1X52A 1M1KH
chains in the Genus database with same CATH superfamily
4X1YB 3FBAA 3KIZA 5EIBC 5JVDB 3OBWA 1W41A 1TUBA 4YJ2B 3TD3A 3K12A 5LP6C 1VQOF 4X3MA 3E1YA 1K8AH 3P10A 4XCQA 3JASB 5CA1A 4DRXA 5GONA 4X1YA 3F0EA 3HKDB 5MN5A 1CN7A 1TVKB 3ZP4A 5JVDA 5LA6A 3RYIB 4YJ2A 3F0GA 2ALEA 4LCKA 2LBXA 3JAWA 5HXUA 2H8EA 2QTPA 1W581 2VAPA 4ZHWA 2OHWA 5J2TB 3JASA 3CCVF 3HTNA 3VO8A 4BY9D 4B46A 1TVKA 2MQEA 1KD1H 2GVIA 2KTUA 3QHDA 3S0WA 3HKCA 1W42A 1VQVA 3JALA 3HKEB 3VCZA 3WXMB 2OTJF 3VTIC 1QAHA 1T0KB 3HKBA 1U3LA 1VK3A 4HNAA 5KMGB 5HY2A 1GO1A 1W5EA 3RA5A 2UYJA 4NWOB 5HXZA 4EB6B 3HKEA 1UFYA 2L26A 3B6NA 1SDSA 3JAMM 5B8FA 5J2UA 1YIJF 4G4VA 5LXTB 3D01A 5FNVB 4BT6A 2HP3A 4X3LA 5LP6A 1JFFA 2RHLA 4TZZA 4EB6A 1IPAA 1W55A 3BYQA 1T0AA 2UYNB 3KJJA 1YJNF 2FGYA 3CB2A 5LXTA 3WGKA 5FNVA 3FPIA 3GYQA 5EWRA 3QTYA 2CHSA 4C8GA 2PHNA 4G4YA 5EZYB 4BT3A 2BTOA 2R6R1 3U0OA 2V9YA 2ZVYA 1XRGA 2UYNA 3ON1A 1VQ4F 4LNUB 4O4IB 3J7AR 1YJWF 3MDOA 1FNKA 2DT4A 2IG8A 4X1IA 5HY4A 1K9MH 4BT4A 2OZBA 3NK6A 3JARB 3GHZA 2WALA 4I50A 2CW4A 3JVHA 3WPWA 3CPWF 3C8LA 1X7OA 3N2KB 5CB4B 5HY0A 5LOVA 1X7PA 4O4IA 2HVYD 5EB0A 2YXZA 1CLIA 5GIPC 3CYQA 4X1KA 1M1KH 2LCAA 2IQQA 2UYPA 3F0FA 2UYKA 1OFUA 3N2GB 2GZLA 4O4HB 4C4WC 3ERNA 3CMEF 3IMPA 2UZHA 5MN4A 3P0ZA 5GANK 2AIFA 1KC8H 4C82A 2CZWA 3NVIB 1J7HA 2YYEA 5ITZB 3J81M 5CA0A 5JQGB 3LMEA 1N8RH 3K2XA 2OTLF 3CCLF 3V3TA 4O4JB 2Q1YA 2HP0B 4O2BB 2ZAUA 4G88A 3IKFA 5EB1B 3RYFA 3LWQC 3VMFB 1UI9A 5FLXM 1ODEA 1GO0A 2GLZA 5AVMA 1PXWA 4F6RB 1U43A 4G4XA 2CWJA 5FJ4C 3S06A 5IJ0A 2LBTA 2HP0A 2G9IA 4O2BA 1VQ8F 2EWCA 1XV2A 3RYHB 4EI7A 1S72F 3MQWA 4G4ZA 2B33A 4R40B 5GIOC 2Z1EA 3CC4F 1DBFA 4FFBB 4F6RA 3C9UA 2AMTA 3KJKA 1DT9A 3D54A 1JY8A 3G6EF 3UT5B 3RYHA 1VQ6F 1YQNA 3LFOA 2F9ZC 2P6YA 4YJ3B 3VIUA 4FFBA 3ZP7A 3HKDA 5EIBD 3RYIA 1COMA 5A2QM 3IEQA 3UT5A 5J2TA 2ZVZA 2VGNA 3WGLA 2Z1FA 3M4SA 2CHTA 5MN6A 3PLAC 3DC2A 5KX5B 1VQ5F 2Z1UA 2ZF8A 3M84A 2QA4F 4U3JB 5GAPK 3P4EA 2ZOVA 1Z5WA 3O85A 3LYBA 4BT2A 5LYJB 2R751 3NK7A 3Q8HA 4B62A 3FFMA 3I3FA 3SIUA 2HX0A 4TV8B 1GX1A 1FNJA 1VHAA 1YITF 1JN1A 2HRYA 4ZHQB 5KX5A 3WGMA 5KMGA 3CCRF 3KHNA 1RA4A 2LBWA 3VOBA 3WGJA 2Z01A 1VH8A 3FD6A 1W5BA 4BVQA 1QVFF 3LDTA 4G4WA 1NQ3A 2HS4A 3CYPB 5IJ9B 1Q7YH 3R0PA 3E22B 2NMUA 3IEWA 3CCQF 4ZHYB 5HWEA 4U39A 3C9TA 2KTVA 1JD1A 4EI9A 3J80M 4TUYB 4EI8A 1H47A 3KE1A 5EZYA 3VI6A 2IAFA 3E22A 3LWRC 5C8YB 4LNUA 3N4ZA 3G71F 3WJQA 3V7QA 3HAXD 1QD9A 4I55B 4TUYA 4KWEA 5HP7A 4ZHVA 3NMUC 3JARA 3K0TA 4BVRA 5EO3A 5BMVB 2VXYA 3EORA 2I6DA 3N2KA 5CB4A 5C8YA 1Q86H 3AGKA 4WBNB 4ZK7A 5EYPB 2VAWA 3CCMF 2HS3A 3VOAA 5HY1A 4NUTA 2QEXF 3N2GA 4O4HA 1Q82H 2KGWA 4RQOA 4B45A 4IIJB 5G4UC 2ZODA 4DXDA 3CMAF 2AIZP 1FSZA 4WBNA 2QI2A 1CK2A 5ITZA 1YHQF 5JQGA 4O2AB 2HRUA 1W2BF 4O4JA 1W57A 4ZI7B 3CCJF 3VYSC 3G4SF 1H7MA 1TUBB 1X25A 1RLUA 3NVKE 3CC2F 3CC7F 3I55F 5CA1B 3LWPC 4DRXB 5GONB 4ZI7A 1ONIA 1U40A 1IV3A 4O4LB 3JCMM 2BTQB 3F6MA 3ZOPA 2VGMA 2CVLA 5LA6B 2HS0A 1Q81H 3JAWB 3T80A 1IV2A 1VQ7F 3RA6A 3ELCA 5HP8A 4E6EA 3WJPA 5EAZA 4O4LA 3LWVC 3C9SA 5JCOC 1R1MA 4M8IA 2H6LA 3K14A 3HKCB 4YJ3A 1ZWZA 3HWUA 2KG4A 3JALB 1VQPF 2CSLA 3IR9A 3CCUF 1RQ2A 3M1XA 3F0DA 3HKBB 1W40A 3ESJA 1E7KA 1OAPA 1FFXB 4HNAB 3ZO8A 1XHOA 2N48A 2W8BC 3E20B 1GZ0A 1VQLF 3OBYA 3JAKB 1SA0B 2VAMA 4RHAA 3OONA 3GTZA 1Z5VA 4U3JA 1VQNF 1QVGF 2RB9A 5J2UB 5LYJA 1FFXA 3IKEA 4C8IA 1W5FA 5LP6B 3CCSF 1JFFB 2JNBA 4TV8A 1KNKA 4TV9B 4C81A 4ZHQA 3JAKA 1SA0A 3V7EA 4PWTA 3S02A 5DCVA 3WGNA 4X20B 3S03A 2BTUA 2RHJA 2H8CA 3CG6A 1QU9A 3I7TA 4I4TB 2HQSC 3VYUC 5IYZB 4IHJB 1RQ7A 4TV9A 5IT9M 3HJWC 3RE3A 1U3PA 3MBMA 4BW0B 4X20A 1RLGA 1Q8RA 1H48A 5JCOA 3VYTC 5IJ9A 3OW2F 4I4TA 2K1SA 4X1IB 5IYZA 1KNJA 3TD4A 3QUWA 1SZQA 1VQ9F 2PMPA 2BO1A 4IHJA 4ZOLB 3LWOC 3WPXA 4I50B 1PF5A 1KQSF 2DYYA 5LOVB 5JH7B 3FD5A 1W5AA 1IV4A 3C9RA 3S0YA 3RYCB 4X1KB 4BVSA 4ZOLA 2I6RA 3CXCF 3WJRA 3CD6F 1IV1A 5G4VC 2Q1XA 4I55A 1NMUB 3TD5A 3CCEF 5JH7A 3D00A 5CA0B 3S0HA 5BMVA 3RYCA 1M90H 2RHHA 2Z1TA 1W59A 3JATB 1YI2F 1JJ2F 4C8EA 3L7QA 1VQKF 5EYPA 1NJIH 3N4YA 3DDNA 3RYFB 1YJ9F 1YGYA 4BT5A 3V4DA 4BVTA 2OTMA 1W3EX 3MCQA 4IIJA 3JATA 4B5CA 5IJ0B 5GINC 4ERHA 2RHOA 1VQMF 3I56F 2FC3A 3CPQA 3PAFA 4BT7A 4O2AA 4NQ3A 1XBIA 3MCAB 1K73H 3SIVA 1X52A
chains in the Genus database with same CATH topology
1W40A 1E7KA 3OBWA 1W41A 1Q7YH 4C4WC 1VQOF 3E20B 3CMEF 1GZ0A 1VQLF 3OBYA 4X3MA 5GANK 3E1YA 3CCQF 2AIFA 1K8AH 1KC8H 4XCQA 3NVIB 2CZWA 5HWEA 3J81M 2KTVA 4EI9A 3J80M 1VQNF 1N8RH 1QVGF 2OTLF 3CCLF 4EI8A 3V3TA 1CN7A 3VI6A 3CCSF 2ALEA 3LWRC 2JNBA 2LBXA 4LCKA 5HXUA 3N4ZA 3LWQC 2OHWA 3VMFB 3V7EA 5FLXM 3G71F 3CCVF 3V7QA 5DCVA 1GO0A 2GLZA 3HAXD 4BY9D 1PXWA 5FJ4C 3NMUC 3CG6A 4BVRA 1KD1H 5EO3A 2KTUA 1VQ8F 1W42A 2I6DA 4EI7A 1S72F 1Q86H 5IT9M 3AGKA 3WXMB 5GIOC 3CCMF 3HJWC 2OTJF 4BW0B 3CC4F 1T0KB 1RLGA 5HY1A 4NUTA 2QEXF 3OW2F 1Q82H 5HY2A 1GO1A 1DT9A 5G4UC 3RA5A 3G6EF 3CMAF 1VQ9F 1VQ6F 5HXZA 2BO1A 3LWOC 2QI2A 1CK2A 3LFOA 1YHQF 1SDSA 2F9ZC 3JAMM 1KQSF 1YIJF 1W2BF 4X3LA 4TZZA 5A2QM 3CCJF 3G4SF 4BVSA 1H7MA 3CXCF 3CD6F 1IPAA 2VGNA 5G4VC 3NVKE 3CC2F 3CC7F 1NMUB 3CCEF 3I55F 1YJNF 3PLAC 2FGYA 3LWPC 1VQ5F 3D00A 3GYQA 2QA4F 5EWRA 1M90H 5GAPK 1YI2F 3JCMM 1JJ2F 3O85A 1VQKF 2VGMA 3NK7A 1NJIH 3FFMA 3N4YA 3SIUA 1Q81H 1YITF 1VQ7F 3ON1A 1VQ4F 3RA6A 1YJ9F 3J7AR 1YJWF 4BVTA 3CCRF 5HY4A 1W3EX 1RA4A 1K9MH 2OZBA 3NK6A 3LWVC 2LBWA 5GINC 2WALA 1VQMF 3I56F 3CPWF 2FC3A 3CPQA 3PAFA 1ZWZA 4NQ3A 1X7OA 5HY0A 2KG4A 1XBIA 4BVQA 1VQPF 1QVFF 1X7PA 3MCAB 2HVYD 3IR9A 5GIPC 3CCUF 1K73H 3SIVA 1X52A 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W40 A;  1E7K A;  3OBW A;  1W41 A;  1Q7Y H;  4C4W C;  1VQO F;  3E20 B;  3CME F;  1GZ0 A;  1VQL F;  3OBY A;  4X3M A;  5GAN K;  3E1Y A;  3CCQ F;  2AIF A;  1K8A H;  1KC8 H;  3NVI B;  2CZW A;  3J81 M;  2KTV A;  3J80 M;  1VQN F;  1N8R H;  1QVG F;  2OTL F;  3CCL F;  1CN7 A;  3VI6 A;  3CCS F;  2ALE A;  3LWR C;  2JNB A;  2LBX A;  4LCK A;  3N4Z A;  3LWQ C;  2OHW A;  3VMF B;  3V7E A;  5FLX M;  3G71 F;  3CCV F;  3V7Q A;  5DCV A;  1GO0 A;  3HAX D;  4BY9 D;  1PXW A;  5FJ4 C;  3NMU C;  3CG6 A;  1KD1 H;  5EO3 A;  2KTU A;  1VQ8 F;  1W42 A;  2I6D A;  1S72 F;  1Q86 H;  5IT9 M;  3AGK A;  3WXM B;  5GIO C;  3CCM F;  3HJW C;  2OTJ F;  4BW0 B;  3CC4 F;  1T0K B;  1RLG A;  4NUT A;  2QEX F;  3OW2 F;  1Q82 H;  1GO1 A;  1DT9 A;  5G4U C;  3RA5 A;  3G6E F;  3CMA F;  1VQ9 F;  1VQ6 F;  2BO1 A;  3LWO C;  2QI2 A;  1CK2 A;  3LFO A;  1YHQ F;  1SDS A;  3JAM M;  1KQS F;  1YIJ F;  1W2B F;  4X3L A;  4TZZ A;  5A2Q M;  3CCJ F;  3G4S F;  1H7M A;  3CXC F;  3CD6 F;  1IPA A;  2VGN A;  5G4V C;  3NVK E;  3CC2 F;  3CC7 F;  1NMU B;  3CCE F;  3I55 F;  1YJN F;  3PLA C;  3LWP C;  1VQ5 F;  3GYQ A;  2QA4 F;  5EWR A;  1M90 H;  5GAP K;  1YI2 F;  3JCM M;  1JJ2 F;  3O85 A;  1VQK F;  2VGM A;  3NK7 A;  1NJI H;  3FFM A;  3N4Y A;  3SIU A;  1Q81 H;  1YIT F;  1VQ7 F;  3ON1 A;  1VQ4 F;  3RA6 A;  1YJ9 F;  3J7A R;  1YJW F;  3CCR F;  1W3E X;  1RA4 A;  1K9M H;  2OZB A;  3NK6 A;  3LWV C;  2LBW A;  5GIN C;  2WAL A;  1VQM F;  3I56 F;  3CPW F;  2FC3 A;  3CPQ A;  3PAF A;  1ZWZ A;  1X7O A;  2KG4 A;  1XBI A;  1VQP F;  1QVF F;  1X7P A;  3MCA B;  2HVY D;  3IR9 A;  5GIP C;  3CCU F;  1K73 H;  3SIV A;  1X52 A;  1M1K H; 
#chains in the Genus database with same CATH topology
 4X1Y B;  3FBA A;  3KIZ A;  5EIB C;  5JVD B;  3OBW A;  1W41 A;  1TUB A;  4YJ2 B;  3TD3 A;  3K12 A;  5LP6 C;  1VQO F;  4X3M A;  3E1Y A;  1K8A H;  3P10 A;  4XCQ A;  3JAS B;  5CA1 A;  4DRX A;  5GON A;  4X1Y A;  3F0E A;  3HKD B;  5MN5 A;  1CN7 A;  1TVK B;  3ZP4 A;  5JVD A;  5LA6 A;  3RYI B;  4YJ2 A;  3F0G A;  2ALE A;  4LCK A;  2LBX A;  3JAW A;  5HXU A;  2H8E A;  2QTP A;  1W58 1;  2VAP A;  4ZHW A;  2OHW A;  5J2T B;  3JAS A;  3CCV F;  3HTN A;  3VO8 A;  4BY9 D;  4B46 A;  1TVK A;  2MQE A;  1KD1 H;  2GVI A;  2KTU A;  3QHD A;  3S0W A;  3HKC A;  1W42 A;  1VQV A;  3JAL A;  3HKE B;  3VCZ A;  3WXM B;  2OTJ F;  3VTI C;  1QAH A;  1T0K B;  3HKB A;  1U3L A;  1VK3 A;  4HNA A;  5KMG B;  5HY2 A;  1GO1 A;  1W5E A;  3RA5 A;  2UYJ A;  4NWO B;  5HXZ A;  4EB6 B;  3HKE A;  1UFY A;  2L26 A;  3B6N A;  1SDS A;  3JAM M;  5B8F A;  5J2U A;  1YIJ F;  4G4V A;  5LXT B;  3D01 A;  5FNV B;  4BT6 A;  2HP3 A;  4X3L A;  5LP6 A;  1JFF A;  2RHL A;  4TZZ A;  4EB6 A;  1IPA A;  1W55 A;  3BYQ A;  1T0A A;  2UYN B;  3KJJ A;  1YJN F;  2FGY A;  3CB2 A;  5LXT A;  3WGK A;  5FNV A;  3FPI A;  3GYQ A;  5EWR A;  3QTY A;  2CHS A;  4C8G A;  2PHN A;  4G4Y A;  5EZY B;  4BT3 A;  2BTO A;  2R6R 1;  3U0O A;  2V9Y A;  2ZVY A;  1XRG A;  2UYN A;  3ON1 A;  1VQ4 F;  4LNU B;  4O4I B;  3J7A R;  1YJW F;  3MDO A;  1FNK A;  2DT4 A;  2IG8 A;  4X1I A;  5HY4 A;  1K9M H;  4BT4 A;  2OZB A;  3NK6 A;  3JAR B;  3GHZ A;  2WAL A;  4I50 A;  2CW4 A;  3JVH A;  3WPW A;  3CPW F;  3C8L A;  1X7O A;  3N2K B;  5CB4 B;  5HY0 A;  5LOV A;  1X7P A;  4O4I A;  2HVY D;  5EB0 A;  2YXZ A;  1CLI A;  5GIP C;  3CYQ A;  4X1K A;  1M1K H;  2LCA A;  2IQQ A;  2UYP A;  3F0F A;  2UYK A;  1OFU A;  3N2G B;  2GZL A;  4O4H B;  4C4W C;  3ERN A;  3CME F;  3IMP A;  2UZH A;  5MN4 A;  3P0Z A;  5GAN K;  2AIF A;  1KC8 H;  4C82 A;  2CZW A;  3NVI B;  1J7H A;  2YYE A;  5ITZ B;  3J81 M;  5CA0 A;  5JQG B;  3LME A;  1N8R H;  3K2X A;  2OTL F;  3CCL F;  3V3T A;  4O4J B;  2Q1Y A;  2HP0 B;  4O2B B;  2ZAU A;  4G88 A;  3IKF A;  5EB1 B;  3RYF A;  3LWQ C;  3VMF B;  1UI9 A;  5FLX M;  1ODE A;  1GO0 A;  2GLZ A;  5AVM A;  1PXW A;  4F6R B;  1U43 A;  4G4X A;  2CWJ A;  5FJ4 C;  3S06 A;  5IJ0 A;  2LBT A;  2HP0 A;  2G9I A;  4O2B A;  1VQ8 F;  2EWC A;  1XV2 A;  3RYH B;  4EI7 A;  1S72 F;  3MQW A;  4G4Z A;  2B33 A;  4R40 B;  5GIO C;  2Z1E A;  3CC4 F;  1DBF A;  4FFB B;  4F6R A;  3C9U A;  2AMT A;  3KJK A;  1DT9 A;  3D54 A;  1JY8 A;  3G6E F;  3UT5 B;  3RYH A;  1VQ6 F;  1YQN A;  3LFO A;  2F9Z C;  2P6Y A;  4YJ3 B;  3VIU A;  4FFB A;  3ZP7 A;  3HKD A;  5EIB D;  3RYI A;  1COM A;  5A2Q M;  3IEQ A;  3UT5 A;  5J2T A;  2ZVZ A;  2VGN A;  3WGL A;  2Z1F A;  3M4S A;  2CHT A;  5MN6 A;  3PLA C;  3DC2 A;  5KX5 B;  1VQ5 F;  2Z1U A;  2ZF8 A;  3M84 A;  2QA4 F;  4U3J B;  5GAP K;  3P4E A;  2ZOV A;  1Z5W A;  3O85 A;  3LYB A;  4BT2 A;  5LYJ B;  2R75 1;  3NK7 A;  3Q8H A;  4B62 A;  3FFM A;  3I3F A;  3SIU A;  2HX0 A;  4TV8 B;  1GX1 A;  1FNJ A;  1VHA A;  1YIT F;  1JN1 A;  2HRY A;  4ZHQ B;  5KX5 A;  3WGM A;  5KMG A;  3CCR F;  3KHN A;  1RA4 A;  2LBW A;  3VOB A;  3WGJ A;  2Z01 A;  1VH8 A;  3FD6 A;  1W5B A;  4BVQ A;  1QVF F;  3LDT A;  4G4W A;  1NQ3 A;  2HS4 A;  3CYP B;  5IJ9 B;  1Q7Y H;  3R0P A;  3E22 B;  2NMU A;  3IEW A;  3CCQ F;  4ZHY B;  5HWE A;  4U39 A;  3C9T A;  2KTV A;  1JD1 A;  4EI9 A;  3J80 M;  4TUY B;  4EI8 A;  1H47 A;  3KE1 A;  5EZY A;  3VI6 A;  2IAF A;  3E22 A;  3LWR C;  5C8Y B;  4LNU A;  3N4Z A;  3G71 F;  3WJQ A;  3V7Q A;  3HAX D;  1QD9 A;  4I55 B;  4TUY A;  4KWE A;  5HP7 A;  4ZHV A;  3NMU C;  3JAR A;  3K0T A;  4BVR A;  5EO3 A;  5BMV B;  2VXY A;  3EOR A;  2I6D A;  3N2K A;  5CB4 A;  5C8Y A;  1Q86 H;  3AGK A;  4WBN B;  4ZK7 A;  5EYP B;  2VAW A;  3CCM F;  2HS3 A;  3VOA A;  5HY1 A;  4NUT A;  2QEX F;  3N2G A;  4O4H A;  1Q82 H;  2KGW A;  4RQO A;  4B45 A;  4IIJ B;  5G4U C;  2ZOD A;  4DXD A;  3CMA F;  2AIZ P;  1FSZ A;  4WBN A;  2QI2 A;  1CK2 A;  5ITZ A;  1YHQ F;  5JQG A;  4O2A B;  2HRU A;  1W2B F;  4O4J A;  1W57 A;  4ZI7 B;  3CCJ F;  3VYS C;  3G4S F;  1H7M A;  1TUB B;  1X25 A;  1RLU A;  3NVK E;  3CC2 F;  3CC7 F;  3I55 F;  5CA1 B;  3LWP C;  4DRX B;  5GON B;  4ZI7 A;  1ONI A;  1U40 A;  1IV3 A;  4O4L B;  3JCM M;  2BTQ B;  3F6M A;  3ZOP A;  2VGM A;  2CVL A;  5LA6 B;  2HS0 A;  1Q81 H;  3JAW B;  3T80 A;  1IV2 A;  1VQ7 F;  3RA6 A;  3ELC A;  5HP8 A;  4E6E A;  3WJP A;  5EAZ A;  4O4L A;  3LWV C;  3C9S A;  5JCO C;  1R1M A;  4M8I A;  2H6L A;  3K14 A;  3HKC B;  4YJ3 A;  1ZWZ A;  3HWU A;  2KG4 A;  3JAL B;  1VQP F;  2CSL A;  3IR9 A;  3CCU F;  1RQ2 A;  3M1X A;  3F0D A;  3HKB B;  1W40 A;  3ESJ A;  1E7K A;  1OAP A;  1FFX B;  4HNA B;  3ZO8 A;  1XHO A;  2N48 A;  2W8B C;  3E20 B;  1GZ0 A;  1VQL F;  3OBY A;  3JAK B;  1SA0 B;  2VAM A;  4RHA A;  3OON A;  3GTZ A;  1Z5V A;  4U3J A;  1VQN F;  1QVG F;  2RB9 A;  5J2U B;  5LYJ A;  1FFX A;  3IKE A;  4C8I A;  1W5F A;  5LP6 B;  3CCS F;  1JFF B;  2JNB A;  4TV8 A;  1KNK A;  4TV9 B;  4C81 A;  4ZHQ A;  3JAK A;  1SA0 A;  3V7E A;  4PWT A;  3S02 A;  5DCV A;  3WGN A;  4X20 B;  3S03 A;  2BTU A;  2RHJ A;  2H8C A;  3CG6 A;  1QU9 A;  3I7T A;  4I4T B;  2HQS C;  3VYU C;  5IYZ B;  4IHJ B;  1RQ7 A;  4TV9 A;  5IT9 M;  3HJW C;  3RE3 A;  1U3P A;  3MBM A;  4BW0 B;  4X20 A;  1RLG A;  1Q8R A;  1H48 A;  5JCO A;  3VYT C;  5IJ9 A;  3OW2 F;  4I4T A;  2K1S A;  4X1I B;  5IYZ A;  1KNJ A;  3TD4 A;  3QUW A;  1SZQ A;  1VQ9 F;  2PMP A;  2BO1 A;  4IHJ A;  4ZOL B;  3LWO C;  3WPX A;  4I50 B;  1PF5 A;  1KQS F;  2DYY A;  5LOV B;  5JH7 B;  3FD5 A;  1W5A A;  1IV4 A;  3C9R A;  3S0Y A;  3RYC B;  4X1K B;  4BVS A;  4ZOL A;  2I6R A;  3CXC F;  3WJR A;  3CD6 F;  1IV1 A;  5G4V C;  2Q1X A;  4I55 A;  1NMU B;  3TD5 A;  3CCE F;  5JH7 A;  3D00 A;  5CA0 B;  3S0H A;  5BMV A;  3RYC A;  1M90 H;  2RHH A;  2Z1T A;  1W59 A;  3JAT B;  1YI2 F;  1JJ2 F;  4C8E A;  3L7Q A;  1VQK F;  5EYP A;  1NJI H;  3N4Y A;  3DDN A;  3RYF B;  1YJ9 F;  1YGY A;  4BT5 A;  3V4D A;  4BVT A;  2OTM A;  1W3E X;  3MCQ A;  4IIJ A;  3JAT A;  4B5C A;  5IJ0 B;  5GIN C;  4ERH A;  2RHO A;  1VQM F;  3I56 F;  2FC3 A;  3CPQ A;  3PAF A;  4BT7 A;  4O2A A;  4NQ3 A;  1XBI A;  3MCA B;  1K73 H;  3SIV A;  1X52 A; 
#chains in the Genus database with same CATH homology
 1W40 A;  1E7K A;  3OBW A;  1W41 A;  1Q7Y H;  4C4W C;  1VQO F;  3E20 B;  3CME F;  1GZ0 A;  1VQL F;  3OBY A;  4X3M A;  5GAN K;  3E1Y A;  3CCQ F;  2AIF A;  1K8A H;  1KC8 H;  4XCQ A;  3NVI B;  2CZW A;  5HWE A;  3J81 M;  2KTV A;  4EI9 A;  3J80 M;  1VQN F;  1N8R H;  1QVG F;  2OTL F;  3CCL F;  4EI8 A;  3V3T A;  1CN7 A;  3VI6 A;  3CCS F;  2ALE A;  3LWR C;  2JNB A;  2LBX A;  4LCK A;  5HXU A;  3N4Z A;  3LWQ C;  2OHW A;  3VMF B;  3V7E A;  5FLX M;  3G71 F;  3CCV F;  3V7Q A;  5DCV A;  1GO0 A;  2GLZ A;  3HAX D;  4BY9 D;  1PXW A;  5FJ4 C;  3NMU C;  3CG6 A;  4BVR A;  1KD1 H;  5EO3 A;  2KTU A;  1VQ8 F;  1W42 A;  2I6D A;  4EI7 A;  1S72 F;  1Q86 H;  5IT9 M;  3AGK A;  3WXM B;  5GIO C;  3CCM F;  3HJW C;  2OTJ F;  4BW0 B;  3CC4 F;  1T0K B;  1RLG A;  5HY1 A;  4NUT A;  2QEX F;  3OW2 F;  1Q82 H;  5HY2 A;  1GO1 A;  1DT9 A;  5G4U C;  3RA5 A;  3G6E F;  3CMA F;  1VQ9 F;  1VQ6 F;  5HXZ A;  2BO1 A;  3LWO C;  2QI2 A;  1CK2 A;  3LFO A;  1YHQ F;  1SDS A;  2F9Z C;  3JAM M;  1KQS F;  1YIJ F;  1W2B F;  4X3L A;  4TZZ A;  5A2Q M;  3CCJ F;  3G4S F;  4BVS A;  1H7M A;  3CXC F;  3CD6 F;  1IPA A;  2VGN A;  5G4V C;  3NVK E;  3CC2 F;  3CC7 F;  1NMU B;  3CCE F;  3I55 F;  1YJN F;  3PLA C;  2FGY A;  3LWP C;  1VQ5 F;  3D00 A;  3GYQ A;  2QA4 F;  5EWR A;  1M90 H;  5GAP K;  1YI2 F;  3JCM M;  1JJ2 F;  3O85 A;  1VQK F;  2VGM A;  3NK7 A;  1NJI H;  3FFM A;  3N4Y A;  3SIU A;  1Q81 H;  1YIT F;  1VQ7 F;  3ON1 A;  1VQ4 F;  3RA6 A;  1YJ9 F;  3J7A R;  1YJW F;  4BVT A;  3CCR F;  5HY4 A;  1W3E X;  1RA4 A;  1K9M H;  2OZB A;  3NK6 A;  3LWV C;  2LBW A;  5GIN C;  2WAL A;  1VQM F;  3I56 F;  3CPW F;  2FC3 A;  3CPQ A;  3PAF A;  1ZWZ A;  4NQ3 A;  1X7O A;  5HY0 A;  2KG4 A;  1XBI A;  4BVQ A;  1VQP F;  1QVF F;  1X7P A;  3MCA B;  2HVY D;  3IR9 A;  5GIP C;  3CCU F;  1K73 H;  3SIV A;  1X52 A;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...