2BO1A

Crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MVDIAFELRKVIDSGKYTLGYRKTVQSLKMGGSKLIIIARNTRPDRKEDLEYYARLSGTPVYEFEGTNVELGTAVGKPHTVSVVSILDAGESRILALGGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Contribution of Hydrophobic Core and Electrostatic Surface to the Thermodyanmic Stability of Ribosomal Protein L30E
rcsb
source organism Thermococcus celer
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2bo1A00
3CG6A 3V7EA 3CCSF 2VGNA 5FJ4C 2WALA 1IPAA 1X7OA 1K8AH 3CXCF 2QEXF 3CCJF 3V7QA 1VQMF 4TZZA 1CK2A 1H7MA 2HVYD 3I55F 2KTVA 1VQ7F 2KTUA 4BW0B 3G6EF 3MCAB 1YI2F 3N4ZA 1W2BF 1DT9A 1YITF 4X3MA 1KC8H 1X7PA 4C4WC 3NVKE 2KG4A 1VQNF 5GINC 3NMUC 2LBWA 2QA4F 1VQLF 1K73H 3LWOC 4BY9D 3G4SF 1YIJF 3LWQC 3VMFB 3CCRF 1CN7A 2CZWA 3CCMF 1PXWA 3LFOA 3IR9A 1E7KA 3JAMM 3J80M 1VQKF 2BO1A 3CCUF 1M1KH 1K9MH 1VQ8F 3CC2F 1S72F 2OTLF 3ON1A 1Q82H 3O85A 1Q7YH 1QVGF 3LWVC 2LBXA 3NK6A 3RA6A 1YJWF 1VQOF 3PAFA 2OHWA 1QVFF 1XBIA 1NJIH 5EO3A 1W42A 3CCVF 2ALEA 3OBWA 3HJWC 5DCVA 5GIOC 5EWRA 4NUTA 5GIPC 3LWRC 3CMAF 1GO1A 3SIVA 5G4VC 3JCMM 3CC4F 5GAPK 3I56F 3CPQA 2VGMA 3FFMA 5A2QM 3CMEF 3N4YA 1YHQF 3CCLF 3VI6A 1Q81H 3HAXD 4LCKA 3CD6F 1GO0A 1KQSF 1W40A 3CCEF 1M90H 1GZ0A 1W41A 5FLXM 3J7AR 5G4UC 2OZBA 1YJNF 3GYQA 1N8RH 3OW2F 2I6DA 1YJ9F 2JNBA 3PLAC 1VQ4F 3CPWF 2QI2A 1NMUB 3AGKA 1JJ2F 2AIFA 3WXMB 1ZWZA 1RLGA 1W3EX 3J81M 1KD1H 1VQ5F 1T0KB 3SIUA 1X52A 1VQ6F 3E20B 3NK7A 3E1YA 2FC3A 1RA4A 3LWPC 3RA5A 3CCQF 3NVIB 1VQPF 1SDSA 3G71F 1VQ9F 1Q86H 5GANK 3OBYA 3CC7F 4X3LA 5IT9M 2OTJF
chains in the Genus database with same CATH superfamily
5LP6B 3V7EA 4XCQA 5IJ9A 4ZI7B 2WALA 4BVQA 1QD9A 1X7OA 1FNJA 4O4LB 3RYHA 3C9UA 3CCJF 3B6NA 4TZZA 3TD5A 1H7MA 3JAKA 4DXDA 3KHNA 4X1YA 5EIBD 4EI9A 5CB4B 1VQ7F 3JARB 4I4TA 1SA0A 5AVMA 5JVDB 2G9IA 3I3FA 1YGYA 1KC8H 1U43A 4ZHYB 1SZQA 3F0DA 3D00A 4I4TB 4ZHQB 3VYUC 3VYSC 5MN6A 2CZWA 5IJ0A 3JALA 1PXWA 1H47A 2Q1XA 3JVHA 1W5EA 2CSLA 1W59A 1FFXB 3VOAA 3CC2F 4LNUA 2OTLF 3WGKA 3LWVC 3VIUA 5HY0A 1TVKA 1IV2A 5BMVA 3Q8HA 4I50B 2ALEA 3N2GA 3HJWC 3FBAA 2H8CA 4O4JB 4IIJB 3IEQA 4G4VA 2IAFA 2Q1YA 5GIPC 3LWRC 3CMAF 2QTPA 3JCMM 4ZHWA 3HKDA 1XHOA 2UYNB 2CHTA 4G4YA 3JAWA 3C8LA 3N2GB 3UT5A 4EI7A 2BTQB 3TD4A 1IV3A 5ITZB 3I56F 4X20B 2HRYA 5B8FA 2VGMA 3L7QA 1TUBA 3FFMA 3HKDB 5A2QM 1J7HA 3CMEF 3N4YA 1PF5A 3UT5B 4RQOA 1Q81H 1QAHA 4X1KA 4I55A 5KX5A 3CD6F 1GO0A 2ZVYA 1TUBB 1W40A 3CYPB 5EZYA 1UI9A 1T0AA 3HKBB 2ZODA 3QTYA 1YJNF 3GYQA 1N8RH 1JN1A 3OW2F 2JNBA 3QUWA 1RQ7A 1VQ4F 3CYQA 4I55B 5C8YA 1VK3A 2QI2A 1NMUB 3AGKA 2F9ZC 3J81M 5JH7A 2IG8A 3F0FA 3WPXA 3N2KA 1VQ6F 3JATA 3MCQA 3HKCB 3E1YA 4TV9B 5C8YB 3P10A 4O4IB 1VQPF 2CWJA 2FGYA 1VQ9F 5EB0A 1Q86H 5EYPA 3N2KB 4X3LA 3JATB 5IT9M 3S02A 2MQEA 3I7TA 2L26A 2VGNA 3RYCA 5FJ4C 3RE3A 5LOVB 2QEXF 1DBFA 5EYPB 4C8GA 2ZOVA 5MN4A 1VQMF 1CK2A 3LYBA 4O2BA 2KGWA 3WGNA 3I55F 5LYJB 3ERNA 1R1MA 4U3JA 2PMPA 4B45A 3WGMA 5LP6A 3ZP4A 4O2BB 1KNKA 3MCAB 4B46A 5CA1B 3P0ZA 4ZI7A 3N4ZA 4C4WC 4O4LA 4NWOB 2P6YA 4TV8B 3WPWA 5GINC 3RYFB 3NMUC 2LBWA 4O4HA 3VCZA 1RLUA 1K73H 2H6LA 3KJJA 4BY9D 1YIJF 5CB4A 2GVIA 3JARA 3CCMF 2ZVZA 2HRUA 2Z01A 3F0GA 3FD5A 2EWCA 3JAMM 3JASB 1JFFB 4O4HB 3J80M 5JVDA 1ONIA 3M1XA 1OFUA 2OTMA 3QHDA 1S72F 2V9YA 5HY1A 1Q7YH 5CA0B 1Z5VA 4ZHQA 1JD1A 3WJQA 3RA6A 5J2UA 1FSZA 1YJWF 1NJIH 3MBMA 4F6RB 3VTIC 3CB2A 3K0TA 2R751 2HP3A 5EWRA 3MDOA 4NUTA 5GIOC 5J2UB 1FFXA 1GO1A 1W55A 2PHNA 5G4VC 3D54A 4C82A 2UYKA 2CW4A 5JCOC 2GLZA 3DDNA 4EB6A 4I50A 4BT2A 4E6EA 4O4JA 3CCLF 3VI6A 5FNVA 2CVLA 4IIJA 1U3PA 5GONA 4LCKA 2UYNA 3CCEF 1IV1A 1FNKA 4EB6B 1GZ0A 2RHLA 5FLXM 5ITZA 4BT7A 5FNVB 5LXTA 4X20A 5GONB 1Q8RA 1RQ2A 2BTOA 3FPIA 3KIZA 1VQVA 4C81A 5IYZA 1ODEA 2ZAUA 4PWTA 1T0KB 2DT4A 2ZF8A 4ZOLB 2GZLA 5LXTB 2CHSA 5EIBC 3P4EA 3LWPC 3RA5A 3C9SA 5IYZB 2VAPA 3HKBA 3G71F 5HP7A 2IQQA 3OBYA 2QA4F 3DC2A 3WJRA 2HP0B 5EAZA 4NQ3A 5KMGB 3VO8A 1IPAA 2K1SA 3CXCF 4TUYA 3HKCA 3M84A 4TV9A 2HVYD 4O4IA 1OAPA 3IMPA 2KTVA 3TD3A 3IKFA 4YJ3B 4TUYB 3C9RA 4ZK7A 3GTZA 4YJ2A 1YI2F 4BVTA 5JQGA 2AIZP 3S0WA 1X7PA 5LOVA 3NVKE 1KNJA 1VQLF 2R6R1 3LWOC 4YJ2B 3LWQC 5LYJA 5JQGB 2HS3A 3IR9A 1E7KA 2Z1UA 3KE1A 4WBNA 5EB1B 2BTUA 3HWUA 5CA1A 3CCUF 1K9MH 4DRXB 4TV8A 4M8IA 3RYFA 2HQSC 4WBNB 4ZHVA 3BYQA 2LBXA 1QVGF 3NK6A 1VQOF 3PAFA 3WGLA 2HS4A 2Z1EA 2LCAA 5EO3A 1W42A 5HWEA 5HXZA 3JASA 1JFFA 4G4ZA 3VYTC 3CC4F 3VOBA 5CA0A 5GAPK 1H48A 2NMUA 1NQ3A 2H8EA 4F6RA 2VXYA 1YHQF 1VH8A 3RYIB 3S0HA 2DYYA 2YYEA 1KQSF 3MQWA 2AMTA 5LA6A 4C8EA 5HXUA 2I6DA 1YJ9F 1W5FA 3PLAC 3K14A 1JJ2F 3WXMB 1ZWZA 5IJ9B 1W3EX 2I6RA 1QU9A 1KD1H 5LA6B 1W5AA 2HS0A 3RYHB 3E20B 4RHAA 5HY2A 4KWEA 1CLIA 4X1IA 2UYPA 2VAMA 3OONA 1RA4A 3JAKB 3CCQF 4BVSA 4X1YB 5GANK 3S0YA 1GX1A 3CG6A 3FD6A 4BT4A 5HY4A 2VAWA 1SA0B 3ZO8A 4X1IB 2UZHA 2RHOA 3CCSF 4ZOLA 2Z1TA 1W57A 1K8AH 2B33A 1X25A 3V7QA 4ERHA 2LBTA 4O2AA 5JCOA 4U39A 3JALB 5IJ0B 3S03A 2KTUA 1VHAA 4BW0B 3ZP7A 3G6EF 4FFBA 2HP0A 4O2AB 3F0EA 3HTNA 2Z1FA 5KMGA 1W2BF 1DT9A 1YITF 4X3MA 1Z5WA 2RB9A 2KG4A 4LNUB 1XV2A 3K2XA 1VQNF 4HNAA 1JY8A 3M4SA 5HP8A 3IKEA 4FFBB 4BT6A 1TVKB 3G4SF 3VMFB 3CCRF 1CN7A 3F6MA 1IV4A 5BMVB 3LFOA 3S06A 4YJ3A 4HNAB 4BT3A 1COMA 1VQKF 1W5BA 2BO1A 3V4DA 1M1KH 1U3LA 1VQ8F 2N48A 3K12A 3ON1A 1Q82H 3O85A 1W581 2YXZA 3JAWB 2HX0A 3HKEA 1YQNA 4IHJA 2OHWA 1QVFF 1XBIA 3CCVF 3OBWA 1XRGA 3T80A 1U40A 5DCVA 3HKEB 3IEWA 4C8IA 4BVRA 3R0PA 2W8BC 4IHJB 4X1KB 3ZOPA 3SIVA 5KX5B 4DRXA 5EZYB 4G4WA 3ESJA 3WJPA 3C9TA 4EI8A 3LDTA 3CPQA 2RHJA 4BT5A 3LMEA 3GHZA 3U0OA 5JH7B 5LP6C 3HAXD 4B5CA 1M90H 3WGJA 1W41A 4G88A 5J2TA 3J7AR 5G4UC 2OZBA 1UFYA 3CPWF 2UYJA 3E22A 4G4XA 2AIFA 5MN5A 3RYCB 2RHHA 1RLGA 5J2TB 1VQ5F 4R40B 3SIUA 4B62A 1X52A 3RYIA 3ELCA 3NK7A 2FC3A 3E22B 3KJKA 3NVIB 3D01A 1SDSA 3V3TA 4U3JB 3CC7F 3EORA 2OTJF
chains in the Genus database with same CATH topology
3CG6A 5HY4A 3V7EA 4XCQA 3CCSF 2VGNA 5FJ4C 4NQ3A 2WALA 1IPAA 4BVQA 1X7OA 1K8AH 3CXCF 2QEXF 3CCJF 3V7QA 1VQMF 4TZZA 1CK2A 1H7MA 2HVYD 3I55F 2KTVA 4EI9A 1VQ7F 2KTUA 4BW0B 3G6EF 3MCAB 1YI2F 4BVTA 3N4ZA 1W2BF 1DT9A 1YITF 4X3MA 1KC8H 1X7PA 4C4WC 3NVKE 2KG4A 1VQNF 5GINC 3D00A 3NMUC 2LBWA 2QA4F 1VQLF 1K73H 3LWOC 4BY9D 3G4SF 1YIJF 3LWQC 3VMFB 3CCRF 1CN7A 2CZWA 3CCMF 1PXWA 3LFOA 3IR9A 1E7KA 3JAMM 3J80M 1VQKF 2BO1A 3CCUF 1M1KH 1K9MH 1VQ8F 3CC2F 1S72F 2OTLF 3ON1A 1Q82H 3O85A 5HY1A 1Q7YH 1QVGF 3LWVC 2LBXA 3NK6A 3RA6A 5HY0A 1YJWF 1VQOF 3PAFA 2OHWA 1QVFF 1XBIA 1NJIH 5EO3A 1W42A 5HWEA 2ALEA 3CCVF 3OBWA 5HXZA 3HJWC 5DCVA 5GIOC 5EWRA 4BVRA 4NUTA 5GIPC 3LWRC 3CMAF 1GO1A 3SIVA 5G4VC 3JCMM 3CC4F 5GAPK 4EI7A 3I56F 4EI8A 3CPQA 2VGMA 2GLZA 3FFMA 5A2QM 3CMEF 3N4YA 1YHQF 3CCLF 3VI6A 1Q81H 3HAXD 4LCKA 3CD6F 1GO0A 1KQSF 1W40A 3CCEF 1M90H 1GZ0A 1W41A 5FLXM 3J7AR 5G4UC 2OZBA 1YJNF 3GYQA 1N8RH 5HXUA 3OW2F 2I6DA 1YJ9F 2JNBA 3PLAC 1VQ4F 3CPWF 2QI2A 1NMUB 3AGKA 1JJ2F 2AIFA 2F9ZC 3WXMB 1ZWZA 1RLGA 1W3EX 3J81M 1KD1H 1VQ5F 1T0KB 3SIUA 1X52A 1VQ6F 3E20B 5HY2A 3NK7A 3E1YA 2FC3A 1RA4A 3LWPC 3RA5A 3CCQF 3NVIB 1VQPF 4BVSA 1SDSA 3V3TA 2FGYA 3G71F 1VQ9F 1Q86H 5GANK 3OBYA 3CC7F 4X3LA 5IT9M 2OTJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CG6 A;  3V7E A;  3CCS F;  2VGN A;  5FJ4 C;  2WAL A;  1IPA A;  1X7O A;  1K8A H;  3CXC F;  2QEX F;  3CCJ F;  3V7Q A;  1VQM F;  4TZZ A;  1CK2 A;  1H7M A;  2HVY D;  3I55 F;  2KTV A;  1VQ7 F;  2KTU A;  4BW0 B;  3G6E F;  3MCA B;  1YI2 F;  3N4Z A;  1W2B F;  1DT9 A;  1YIT F;  4X3M A;  1KC8 H;  1X7P A;  4C4W C;  3NVK E;  2KG4 A;  1VQN F;  5GIN C;  3NMU C;  2LBW A;  2QA4 F;  1VQL F;  1K73 H;  3LWO C;  4BY9 D;  3G4S F;  1YIJ F;  3LWQ C;  3VMF B;  3CCR F;  1CN7 A;  2CZW A;  3CCM F;  1PXW A;  3LFO A;  3IR9 A;  1E7K A;  3JAM M;  3J80 M;  1VQK F;  2BO1 A;  3CCU F;  1M1K H;  1K9M H;  1VQ8 F;  3CC2 F;  1S72 F;  2OTL F;  3ON1 A;  1Q82 H;  3O85 A;  1Q7Y H;  1QVG F;  3LWV C;  2LBX A;  3NK6 A;  3RA6 A;  1YJW F;  1VQO F;  3PAF A;  2OHW A;  1QVF F;  1XBI A;  1NJI H;  5EO3 A;  1W42 A;  3CCV F;  2ALE A;  3OBW A;  3HJW C;  5DCV A;  5GIO C;  5EWR A;  4NUT A;  5GIP C;  3LWR C;  3CMA F;  1GO1 A;  3SIV A;  5G4V C;  3JCM M;  3CC4 F;  5GAP K;  3I56 F;  3CPQ A;  2VGM A;  3FFM A;  5A2Q M;  3CME F;  3N4Y A;  1YHQ F;  3CCL F;  3VI6 A;  1Q81 H;  3HAX D;  4LCK A;  3CD6 F;  1GO0 A;  1KQS F;  1W40 A;  3CCE F;  1M90 H;  1GZ0 A;  1W41 A;  5FLX M;  3J7A R;  5G4U C;  2OZB A;  1YJN F;  3GYQ A;  1N8R H;  3OW2 F;  2I6D A;  1YJ9 F;  2JNB A;  3PLA C;  1VQ4 F;  3CPW F;  2QI2 A;  1NMU B;  3AGK A;  1JJ2 F;  2AIF A;  3WXM B;  1ZWZ A;  1RLG A;  1W3E X;  3J81 M;  1KD1 H;  1VQ5 F;  1T0K B;  3SIU A;  1X52 A;  1VQ6 F;  3E20 B;  3NK7 A;  3E1Y A;  2FC3 A;  1RA4 A;  3LWP C;  3RA5 A;  3CCQ F;  3NVI B;  1VQP F;  1SDS A;  3G71 F;  1VQ9 F;  1Q86 H;  5GAN K;  3OBY A;  3CC7 F;  4X3L A;  5IT9 M;  2OTJ F; 
#chains in the Genus database with same CATH topology
 5LP6 B;  3V7E A;  4XCQ A;  5IJ9 A;  4ZI7 B;  2WAL A;  4BVQ A;  1QD9 A;  1X7O A;  1FNJ A;  4O4L B;  3RYH A;  3C9U A;  3CCJ F;  3B6N A;  4TZZ A;  3TD5 A;  1H7M A;  3JAK A;  4DXD A;  3KHN A;  4X1Y A;  5EIB D;  4EI9 A;  5CB4 B;  1VQ7 F;  3JAR B;  4I4T A;  1SA0 A;  5AVM A;  5JVD B;  2G9I A;  3I3F A;  1YGY A;  1KC8 H;  1U43 A;  4ZHY B;  1SZQ A;  3F0D A;  3D00 A;  4I4T B;  4ZHQ B;  3VYU C;  3VYS C;  5MN6 A;  2CZW A;  5IJ0 A;  3JAL A;  1PXW A;  1H47 A;  2Q1X A;  3JVH A;  1W5E A;  2CSL A;  1W59 A;  1FFX B;  3VOA A;  3CC2 F;  4LNU A;  2OTL F;  3WGK A;  3LWV C;  3VIU A;  5HY0 A;  1TVK A;  1IV2 A;  5BMV A;  3Q8H A;  4I50 B;  2ALE A;  3N2G A;  3HJW C;  3FBA A;  2H8C A;  4O4J B;  4IIJ B;  3IEQ A;  4G4V A;  2IAF A;  2Q1Y A;  5GIP C;  3LWR C;  3CMA F;  2QTP A;  3JCM M;  4ZHW A;  3HKD A;  1XHO A;  2UYN B;  2CHT A;  4G4Y A;  3JAW A;  3C8L A;  3N2G B;  3UT5 A;  4EI7 A;  2BTQ B;  3TD4 A;  1IV3 A;  5ITZ B;  3I56 F;  4X20 B;  2HRY A;  5B8F A;  2VGM A;  3L7Q A;  1TUB A;  3FFM A;  3HKD B;  5A2Q M;  1J7H A;  3CME F;  3N4Y A;  1PF5 A;  3UT5 B;  4RQO A;  1Q81 H;  1QAH A;  4X1K A;  4I55 A;  5KX5 A;  3CD6 F;  1GO0 A;  2ZVY A;  1TUB B;  1W40 A;  3CYP B;  5EZY A;  1UI9 A;  1T0A A;  3HKB B;  2ZOD A;  3QTY A;  1YJN F;  3GYQ A;  1N8R H;  1JN1 A;  3OW2 F;  2JNB A;  3QUW A;  1RQ7 A;  1VQ4 F;  3CYQ A;  4I55 B;  5C8Y A;  1VK3 A;  2QI2 A;  1NMU B;  3AGK A;  2F9Z C;  3J81 M;  5JH7 A;  2IG8 A;  3F0F A;  3WPX A;  3N2K A;  1VQ6 F;  3JAT A;  3MCQ A;  3HKC B;  3E1Y A;  4TV9 B;  5C8Y B;  3P10 A;  4O4I B;  1VQP F;  2CWJ A;  2FGY A;  1VQ9 F;  5EB0 A;  1Q86 H;  5EYP A;  3N2K B;  4X3L A;  3JAT B;  5IT9 M;  3S02 A;  2MQE A;  3I7T A;  2L26 A;  2VGN A;  3RYC A;  5FJ4 C;  3RE3 A;  5LOV B;  2QEX F;  1DBF A;  5EYP B;  4C8G A;  2ZOV A;  5MN4 A;  1VQM F;  1CK2 A;  3LYB A;  4O2B A;  2KGW A;  3WGN A;  3I55 F;  5LYJ B;  3ERN A;  1R1M A;  4U3J A;  2PMP A;  4B45 A;  3WGM A;  5LP6 A;  3ZP4 A;  4O2B B;  1KNK A;  3MCA B;  4B46 A;  5CA1 B;  3P0Z A;  4ZI7 A;  3N4Z A;  4C4W C;  4O4L A;  4NWO B;  2P6Y A;  4TV8 B;  3WPW A;  5GIN C;  3RYF B;  3NMU C;  2LBW A;  4O4H A;  3VCZ A;  1RLU A;  1K73 H;  2H6L A;  3KJJ A;  4BY9 D;  1YIJ F;  5CB4 A;  2GVI A;  3JAR A;  3CCM F;  2ZVZ A;  2HRU A;  2Z01 A;  3F0G A;  3FD5 A;  2EWC A;  3JAM M;  3JAS B;  1JFF B;  4O4H B;  3J80 M;  5JVD A;  1ONI A;  3M1X A;  1OFU A;  2OTM A;  3QHD A;  1S72 F;  2V9Y A;  5HY1 A;  1Q7Y H;  5CA0 B;  1Z5V A;  4ZHQ A;  1JD1 A;  3WJQ A;  3RA6 A;  5J2U A;  1FSZ A;  1YJW F;  1NJI H;  3MBM A;  4F6R B;  3VTI C;  3CB2 A;  3K0T A;  2R75 1;  2HP3 A;  5EWR A;  3MDO A;  4NUT A;  5GIO C;  5J2U B;  1FFX A;  1GO1 A;  1W55 A;  2PHN A;  5G4V C;  3D54 A;  4C82 A;  2UYK A;  2CW4 A;  5JCO C;  2GLZ A;  3DDN A;  4EB6 A;  4I50 A;  4BT2 A;  4E6E A;  4O4J A;  3CCL F;  3VI6 A;  5FNV A;  2CVL A;  4IIJ A;  1U3P A;  5GON A;  4LCK A;  2UYN A;  3CCE F;  1IV1 A;  1FNK A;  4EB6 B;  1GZ0 A;  2RHL A;  5FLX M;  5ITZ A;  4BT7 A;  5FNV B;  5LXT A;  4X20 A;  5GON B;  1Q8R A;  1RQ2 A;  2BTO A;  3FPI A;  3KIZ A;  1VQV A;  4C81 A;  5IYZ A;  1ODE A;  2ZAU A;  4PWT A;  1T0K B;  2DT4 A;  2ZF8 A;  4ZOL B;  2GZL A;  5LXT B;  2CHS A;  5EIB C;  3P4E A;  3LWP C;  3RA5 A;  3C9S A;  5IYZ B;  2VAP A;  3HKB A;  3G71 F;  5HP7 A;  2IQQ A;  3OBY A;  2QA4 F;  3DC2 A;  3WJR A;  2HP0 B;  5EAZ A;  4NQ3 A;  5KMG B;  3VO8 A;  1IPA A;  2K1S A;  3CXC F;  4TUY A;  3HKC A;  3M84 A;  4TV9 A;  2HVY D;  4O4I A;  1OAP A;  3IMP A;  2KTV A;  3TD3 A;  3IKF A;  4YJ3 B;  4TUY B;  3C9R A;  4ZK7 A;  3GTZ A;  4YJ2 A;  1YI2 F;  4BVT A;  5JQG A;  2AIZ P;  3S0W A;  1X7P A;  5LOV A;  3NVK E;  1KNJ A;  1VQL F;  2R6R 1;  3LWO C;  4YJ2 B;  3LWQ C;  5LYJ A;  5JQG B;  2HS3 A;  3IR9 A;  1E7K A;  2Z1U A;  3KE1 A;  4WBN A;  5EB1 B;  2BTU A;  3HWU A;  5CA1 A;  3CCU F;  1K9M H;  4DRX B;  4TV8 A;  4M8I A;  3RYF A;  2HQS C;  4WBN B;  4ZHV A;  3BYQ A;  2LBX A;  1QVG F;  3NK6 A;  1VQO F;  3PAF A;  3WGL A;  2HS4 A;  2Z1E A;  2LCA A;  5EO3 A;  1W42 A;  5HWE A;  5HXZ A;  3JAS A;  1JFF A;  4G4Z A;  3VYT C;  3CC4 F;  3VOB A;  5CA0 A;  5GAP K;  1H48 A;  2NMU A;  1NQ3 A;  2H8E A;  4F6R A;  2VXY A;  1YHQ F;  1VH8 A;  3RYI B;  3S0H A;  2DYY A;  2YYE A;  1KQS F;  3MQW A;  2AMT A;  5LA6 A;  4C8E A;  5HXU A;  2I6D A;  1YJ9 F;  1W5F A;  3PLA C;  3K14 A;  1JJ2 F;  3WXM B;  1ZWZ A;  5IJ9 B;  1W3E X;  2I6R A;  1QU9 A;  1KD1 H;  5LA6 B;  1W5A A;  2HS0 A;  3RYH B;  3E20 B;  4RHA A;  5HY2 A;  4KWE A;  1CLI A;  4X1I A;  2UYP A;  2VAM A;  3OON A;  1RA4 A;  3JAK B;  3CCQ F;  4BVS A;  4X1Y B;  5GAN K;  3S0Y A;  1GX1 A;  3CG6 A;  3FD6 A;  4BT4 A;  5HY4 A;  2VAW A;  1SA0 B;  3ZO8 A;  4X1I B;  2UZH A;  2RHO A;  3CCS F;  4ZOL A;  2Z1T A;  1W57 A;  1K8A H;  2B33 A;  1X25 A;  3V7Q A;  4ERH A;  2LBT A;  4O2A A;  5JCO A;  4U39 A;  3JAL B;  5IJ0 B;  3S03 A;  2KTU A;  1VHA A;  4BW0 B;  3ZP7 A;  3G6E F;  4FFB A;  2HP0 A;  4O2A B;  3F0E A;  3HTN A;  2Z1F A;  5KMG A;  1W2B F;  1DT9 A;  1YIT F;  4X3M A;  1Z5W A;  2RB9 A;  2KG4 A;  4LNU B;  1XV2 A;  3K2X A;  1VQN F;  4HNA A;  1JY8 A;  3M4S A;  5HP8 A;  3IKE A;  4FFB B;  4BT6 A;  1TVK B;  3G4S F;  3VMF B;  3CCR F;  1CN7 A;  3F6M A;  1IV4 A;  5BMV B;  3LFO A;  3S06 A;  4YJ3 A;  4HNA B;  4BT3 A;  1COM A;  1VQK F;  1W5B A;  2BO1 A;  3V4D A;  1M1K H;  1U3L A;  1VQ8 F;  2N48 A;  3K12 A;  3ON1 A;  1Q82 H;  3O85 A;  1W58 1;  2YXZ A;  3JAW B;  2HX0 A;  3HKE A;  1YQN A;  4IHJ A;  2OHW A;  1QVF F;  1XBI A;  3CCV F;  3OBW A;  1XRG A;  3T80 A;  1U40 A;  5DCV A;  3HKE B;  3IEW A;  4C8I A;  4BVR A;  3R0P A;  2W8B C;  4IHJ B;  4X1K B;  3ZOP A;  3SIV A;  5KX5 B;  4DRX A;  5EZY B;  4G4W A;  3ESJ A;  3WJP A;  3C9T A;  4EI8 A;  3LDT A;  3CPQ A;  2RHJ A;  4BT5 A;  3LME A;  3GHZ A;  3U0O A;  5JH7 B;  5LP6 C;  3HAX D;  4B5C A;  1M90 H;  3WGJ A;  1W41 A;  4G88 A;  5J2T A;  3J7A R;  5G4U C;  2OZB A;  1UFY A;  3CPW F;  2UYJ A;  3E22 A;  4G4X A;  2AIF A;  5MN5 A;  3RYC B;  2RHH A;  1RLG A;  5J2T B;  1VQ5 F;  4R40 B;  3SIU A;  4B62 A;  1X52 A;  3RYI A;  3ELC A;  3NK7 A;  2FC3 A;  3E22 B;  3KJK A;  3NVI B;  3D01 A;  1SDS A;  3V3T A;  4U3J B;  3CC7 F;  3EOR A;  2OTJ F; 
#chains in the Genus database with same CATH homology
 3CG6 A;  5HY4 A;  3V7E A;  4XCQ A;  3CCS F;  2VGN A;  5FJ4 C;  4NQ3 A;  2WAL A;  1IPA A;  4BVQ A;  1X7O A;  1K8A H;  3CXC F;  2QEX F;  3CCJ F;  3V7Q A;  1VQM F;  4TZZ A;  1CK2 A;  1H7M A;  2HVY D;  3I55 F;  2KTV A;  4EI9 A;  1VQ7 F;  2KTU A;  4BW0 B;  3G6E F;  3MCA B;  1YI2 F;  4BVT A;  3N4Z A;  1W2B F;  1DT9 A;  1YIT F;  4X3M A;  1KC8 H;  1X7P A;  4C4W C;  3NVK E;  2KG4 A;  1VQN F;  5GIN C;  3D00 A;  3NMU C;  2LBW A;  2QA4 F;  1VQL F;  1K73 H;  3LWO C;  4BY9 D;  3G4S F;  1YIJ F;  3LWQ C;  3VMF B;  3CCR F;  1CN7 A;  2CZW A;  3CCM F;  1PXW A;  3LFO A;  3IR9 A;  1E7K A;  3JAM M;  3J80 M;  1VQK F;  2BO1 A;  3CCU F;  1M1K H;  1K9M H;  1VQ8 F;  3CC2 F;  1S72 F;  2OTL F;  3ON1 A;  1Q82 H;  3O85 A;  5HY1 A;  1Q7Y H;  1QVG F;  3LWV C;  2LBX A;  3NK6 A;  3RA6 A;  5HY0 A;  1YJW F;  1VQO F;  3PAF A;  2OHW A;  1QVF F;  1XBI A;  1NJI H;  5EO3 A;  1W42 A;  5HWE A;  2ALE A;  3CCV F;  3OBW A;  5HXZ A;  3HJW C;  5DCV A;  5GIO C;  5EWR A;  4BVR A;  4NUT A;  5GIP C;  3LWR C;  3CMA F;  1GO1 A;  3SIV A;  5G4V C;  3JCM M;  3CC4 F;  5GAP K;  4EI7 A;  3I56 F;  4EI8 A;  3CPQ A;  2VGM A;  2GLZ A;  3FFM A;  5A2Q M;  3CME F;  3N4Y A;  1YHQ F;  3CCL F;  3VI6 A;  1Q81 H;  3HAX D;  4LCK A;  3CD6 F;  1GO0 A;  1KQS F;  1W40 A;  3CCE F;  1M90 H;  1GZ0 A;  1W41 A;  5FLX M;  3J7A R;  5G4U C;  2OZB A;  1YJN F;  3GYQ A;  1N8R H;  5HXU A;  3OW2 F;  2I6D A;  1YJ9 F;  2JNB A;  3PLA C;  1VQ4 F;  3CPW F;  2QI2 A;  1NMU B;  3AGK A;  1JJ2 F;  2AIF A;  2F9Z C;  3WXM B;  1ZWZ A;  1RLG A;  1W3E X;  3J81 M;  1KD1 H;  1VQ5 F;  1T0K B;  3SIU A;  1X52 A;  1VQ6 F;  3E20 B;  5HY2 A;  3NK7 A;  3E1Y A;  2FC3 A;  1RA4 A;  3LWP C;  3RA5 A;  3CCQ F;  3NVI B;  1VQP F;  4BVS A;  1SDS A;  3V3T A;  2FGY A;  3G71 F;  1VQ9 F;  1Q86 H;  5GAN K;  3OBY A;  3CC7 F;  4X3L A;  5IT9 M;  2OTJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...