2BO1A

Crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MVDIAFELRKVIDSGKYTLGYRKTVQSLKMGGSKLIIIARNTRPDRKEDLEYYARLSGTPVYEFEGTNVELGTAVGKPHTVSVVSILDAGESRILALGGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Contribution of Hydrophobic Core and Electrostatic Surface to the Thermodyanmic Stability of Ribosomal Protein L30E
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2bo1A00
5GIOC 3CD6F 4C4WC 3WXMB 2VGMA 1RA4A 5GANK 1QVFF 3SIVA 3VMFB 3J80M 1T0KB 1VQ9F 5GAPK 1NMUB 1W2BF 1CN7A 2LBXA 3G6EF 1RLGA 2OTJF 3V7EA 5G4UC 1QVGF 2WALA 1Q82H 1KQSF 3CC7F 1M90H 3LWVC 4TZZA 3CXCF 3JAMM 3CCMF 1Q7YH 1K73H 3NVIB 1YJ9F 1E7KA 4X3LA 3G71F 3J81M 3LWOC 5FJ4C 1H7MA 1KD1H 3E20B 1X52A 3NMUC 2ALEA 1VQLF 1X7OA 5A2QM 3CCEF 3CCVF 1K8AH 2CZWA 3V7QA 3CCUF 3I55F 2KTVA 1GO1A 3PLAC 3N4YA 2HVYD 3IR9A 3JCMM 1VQMF 3ON1A 1IPAA 1KC8H 3HAXD 1X7PA 2I6DA 1PXWA 3CPWF 3FFMA 1YI2F 3LWQC 5GIPC 3O85A 3LWRC 5FLXM 4X3MA 1YJNF 1VQKF 5GINC 1YHQF 1VQ8F 2QI2A 3G4SF 1W3EX 3OW2F 5IT9M 1DT9A 1VQPF 1NJIH 2AIFA 2LBWA 2OZBA 4BW0B 3CMEF 1YIJF 3E1YA 3LWPC 3CCLF 3OBWA 1M1KH 2FC3A 1VQ4F 3NVKE 5DCVA 2OHWA 3J7AR 1VQ5F 1CK2A 1W40A 3SIUA 1VQ6F 3CCRF 1YJWF 3CC4F 5G4VC 2KTUA 1W41A 2QEXF 1Q81H 3CCQF 3GYQA 1S72F 3NK6A 2QA4F 4NUTA 5EO3A 1SDSA 3LFOA 1XBIA 3VI6A 3RA6A 3I56F 1K9MH 3OBYA 2KG4A 3CC2F 2VGNA 4LCKA 1W42A 3CCJF 3CMAF 3CPQA 1VQ7F 3PAFA 3NK7A 4BY9D 1VQNF 3AGKA 1JJ2F 3RA5A 1GZ0A 1ZWZA 3CG6A 2OTLF 1Q86H 3CCSF 3HJWC 1VQOF 1YITF 1N8RH 1GO0A 3N4ZA 3MCAB 2JNBA 5EWRA 2BO1A
chains in the Genus database with same CATH superfamily
3N2GA 3C9SA 3CD6F 4C4WC 1TUBB 1JFFB 5HP8A 1QVFF 3VMFB 3J80M 1JD1A 3S06A 4EI7A 5KMGA 1FFXB 1W5AA 4C8IA 3G6EF 3S0YA 3RYHB 4BT6A 3CC7F 3K2XA 1M90H 5LOVA 1OFUA 5FNVB 2Q1YA 3CCMF 1Q7YH 3NVIB 2Z1FA 5HP7A 4X20A 4TV8B 4C8GA 3VOAA 1Z5VA 5GONB 3LWOC 1X25A 3LDTA 1UI9A 3E20B 1COMA 1X52A 3FD6A 2OTMA 2ALEA 2EWCA 4C82A 1FNKA 1R1MA 3KJKA 1JY8A 2KTVA 3N4YA 3IEWA 1SA0A 2FGYA 1PF5A 2VAPA 4ZHQB 3IR9A 1VQMF 2AMTA 3F0DA 3FD5A 3MDOA 2VAMA 1X7PA 4BT4A 4O4JA 3R0PA 1VK3A 4O4LB 3JALA 3KJJA 4RQOA 1PXWA 1U40A 2VAWA 3CB2A 3HWUA 4RHAA 3V3TA 3WGJA 5HWEA 4BVTA 4BT3A 1YI2F 3LWQC 2H8CA 3JASA 2K1SA 4KWEA 3HKDA 2CWJA 3IKFA 5GINC 3G4SF 1W3EX 3F6MA 2RHOA 1TVKB 3Q8HA 3JAKB 1NJIH 2LBWA 2OZBA 2GLZA 4O4IA 2LBTA 1IV3A 3LYBA 4TV9B 4X1YA 3CCLF 3MCQA 1M1KH 5EZYA 5IJ0A 5DCVA 2OHWA 4BT7A 3D54A 3WPXA 4NQ3A 3SIUA 5EYPA 5EAZA 1VQ6F 3CCRF 2VXYA 3GTZA 5CA1B 4M8IA 3P4EA 2Z1TA 1Q81H 1S72F 1J7HA 4NUTA 3IKEA 1XBIA 3I56F 1ODEA 4BVSA 2CVLA 3QUWA 3CMAF 4ZOLB 2P6YA 5HY4A 3V4DA 4B46A 2CSLA 5HY0A 3PAFA 4BY9D 1W57A 4WBNA 5KX5B 1VQNF 3ZP4A 2OTLF 5LP6B 5JCOC 5JH7A 2JNBA 2AIZP 4ZI7A 2VGMA 5GANK 3K14A 5IJ9B 3SIVA 3VYSC 5JVDA 1T0KB 3F0GA 1VQ9F 2RHJA 3JATB 1W2BF 2F9ZC 4YJ3A 5JQGB 1VH8A 1XHOA 3V7EA 4TUYB 3RE3A 4ZHYB 2R751 1H48A 5LP6C 2H6LA 1K73H 3RYFB 5B8FA 5LA6A 1E7KA 4F6RB 5CA0B 3FBAA 3HKEB 3HKBB 5FJ4C 3BYQA 1RQ2A 4XCQA 4B5CA 1KD1H 3VCZA 1W581 2ZVZA 5EIBD 3C8LA 1X7OA 5A2QM 4ZK7A 3CCVF 2CZWA 3S0HA 3ZOPA 3CCUF 5HXUA 1GO1A 1TUBA 1JFFA 3T80A 4ERHA 3PLAC 5HXZA 2HVYD 1KNJA 5EB1B 5LYJB 1CLIA 4I4TB 3TD3A 1IPAA 3N2GB 1KC8H 1QD9A 3E22B 4X1IB 3RYHA 2I6DA 1U3PA 1RQ7A 2BTQB 5FNVA 4O2BB 3WGLA 5GIPC 3LWRC 4X1KB 4X3MA 2HP0B 1FNJA 4O4HB 4EI8A 1VQ8F 5GONA 3OW2F 2DT4A 2HRUA 5CB4B 2PMPA 3DDNA 2IG8A 3JAWB 1YIJF 3E1YA 1VQ4F 3NVKE 2L26A 3D01A 1CK2A 4U3JB 4ZHQA 3KHNA 3WGNA 4BVRA 2RHLA 5G4VC 2UZHA 1W41A 3UT5B 4LNUA 2DYYA 1JN1A 1XRGA 2CHSA 2HP3A 3N2KB 4O4LA 3LFOA 3VI6A 3RYCB 3RA6A 1K9MH 2UYNB 2VGNA 1Z5WA 4ZHWA 2YYEA 1DBFA 1XV2A 1W5EA 1TVKA 1JJ2F 3JAKA 2Z1UA 3JASB 3IMPA 3S0WA 4NWOB 1ZWZA 3CG6A 4TV9A 5HY1A 3CCSF 2R6R1 1T0AA 1N8RH 1GO0A 4FFBB 3MCAB 5EWRA 4O4IB 1SZQA 5EZYB 5CA1A 5IJ0B 3VYTC 4R40B 1W55A 4IHJB 4G4XA 2LBXA 1RLGA 2Q1XA 3K0TA 2OTJF 3HTNA 5G4UC 3WGKA 2WALA 4I50B 3M84A 1KQSF 3LWVC 4TZZA 3JAMM 5J2UB 2KGWA 4G4ZA 4U39A 4ZOLA 1YJ9F 4X3LA 3GHZA 5MN5A 3G71F 1H7MA 2ZVYA 5LP6A 5C8YB 1VQLF 4BT2A 3CCEF 4DRXB 1QU9A 2G9IA 3VO8A 3JARB 3RYIB 4HNAA 5IJ9A 4EB6B 5JH7B 3JCMM 3JATA 5IYZA 5JQGA 4O2AB 4ZI7B 4TUYA 2H8EA 3CYQA 3FFMA 3RYFA 1KNKA 4E6EA 1W59A 2W8BC 5FLXM 2CW4A 3HKCB 1YJNF 1VQKF 5CA0A 5EIBC 1YHQF 1YQNA 2QI2A 3KIZA 4IIJB 4I55B 3HKEA 4YJ2B 5IT9M 1DT9A 2HS4A 5LXTB 5BMVB 4BW0B 1W5BA 3CYPB 4G4WA 3TD5A 5J2TB 1U3LA 5ITZB 2ZF8A 1YGYA 1FFXA 5LYJA 3VIUA 4BVQA 1VQVA 4I4TA 2B33A 1YJWF 4B45A 3CC4F 1QAHA 2QEXF 4G4VA 5KMGB 3ESJA 3GYQA 2HS3A 3E22A 4X1IA 2QA4F 4TV8A 1SDSA 3I3FA 2GVIA 3OBYA 5LOVB 3CC2F 1IV2A 4O2BA 4DXDA 3F0EA 1IV4A 3FPIA 4X1KA 3D00A 4X20B 2HP0A 4O4HA 1VQ7F 3ZP7A 1UFYA 5CB4A 3C9TA 2LCAA 3NK7A 3RA5A 3JAWA 5MN4A 1NQ3A 3P10A 4PWTA 2YXZA 3HJWC 1YITF 3WJPA 3MQWA 2ZAUA 1W40A 2BO1A 3M1XA 5GIOC 4U3JA 3WXMB 1SA0B 1RA4A 3LMEA 3L7QA 5GAPK 3UT5A 1NMUB 1CN7A 3ZO8A 5AVMA 2Z01A 3N2KA 4O4JB 3RYCA 1Q82H 1QVGF 2GZLA 3JALB 2UYNA 3CXCF 4LNUB 2RB9A 3HKDB 4ZHVA 3U0OA 3J81M 5MN6A 2IQQA 4B62A 1RLUA 3F0FA 3MBMA 3C9RA 1U43A 4X1YB 3NMUC 4FFBA 3EORA 2IAFA 3QHDA 1K8AH 3V7QA 2MQEA 2ZODA 1FSZA 1VHAA 3KE1A 4G88A 5JCOA 3I55F 2I6RA 2V9YA 4G4YA 1Q8RA 5EYPB 4IHJA 2HX0A 3ON1A 3S03A 3HAXD 1ONIA 1W5FA 3DC2A 3P0ZA 3WJRA 4I50A 1OAPA 2HRYA 3JVHA 3CPWF 4BT5A 3OONA 5J2UA 1H47A 5KX5A 3O85A 2UYJA 2CHTA 2PHNA 2BTUA 5EB0A 3ERNA 4WBNB 1VQPF 2AIFA 2N48A 3QTYA 3CMEF 3VOBA 4C81A 3LWPC 2NMUA 3WGMA 2UYPA 3OBWA 5C8YA 2FC3A 1IV1A 4DRXA 3J7AR 3JARA 1VQ5F 5HY2A 3RYIA 3VTIC 4EB6A 5JVDB 3VYUC 2KTUA 3TD4A 2Z1EA 3CCQF 4C8EA 4O2AA 3M4SA 4YJ3B 3NK6A 3K12A 4HNAB 3C9UA 5EO3A 4F6RA 3B6NA 2QTPA 5IYZB 2KG4A 3HKBA 4LCKA 1W42A 3S02A 1GX1A 3CCJF 2ZOVA 3HKCA 3CPQA 5LA6B 4IIJA 4I55A 4YJ2A 3I7TA 2HS0A 5LXTA 4EI9A 3AGKA 3ELCA 5BMVA 3WJQA 1GZ0A 1Q86H 5J2TA 2HQSC 2UYKA 3WPWA 5ITZA 1VQOF 2RHHA 3N4ZA 2BTOA 3IEQA
chains in the Genus database with same CATH topology
5GIOC 3CD6F 4C4WC 3WXMB 2VGMA 1RA4A 5GANK 1QVFF 3SIVA 3VMFB 3J80M 1T0KB 1VQ9F 4EI7A 5GAPK 1NMUB 1W2BF 2F9ZC 1CN7A 2LBXA 3G6EF 1RLGA 2OTJF 3V7EA 5G4UC 1QVGF 2WALA 1Q82H 1KQSF 3CC7F 1M90H 3LWVC 4TZZA 3CXCF 3JAMM 3CCMF 1Q7YH 1K73H 3NVIB 1YJ9F 1E7KA 4X3LA 3G71F 3J81M 3LWOC 5FJ4C 1H7MA 4XCQA 1KD1H 3E20B 1X52A 3NMUC 2ALEA 1VQLF 1X7OA 5A2QM 3CCEF 3CCVF 1K8AH 2CZWA 3V7QA 3CCUF 3I55F 2KTVA 5HXUA 1GO1A 3PLAC 3N4YA 5HXZA 2HVYD 2FGYA 3IR9A 3JCMM 1VQMF 3ON1A 1IPAA 1KC8H 3HAXD 1X7PA 2I6DA 1PXWA 3V3TA 5HWEA 3CPWF 3FFMA 4BVTA 1YI2F 3LWQC 5GIPC 3O85A 3LWRC 5FLXM 4X3MA 1YJNF 1VQKF 5GINC 1YHQF 4EI8A 2QI2A 3G4SF 1VQ8F 1W3EX 3OW2F 5IT9M 1DT9A 1VQPF 1NJIH 2AIFA 2LBWA 2GLZA 4BW0B 3CMEF 2OZBA 1YIJF 3E1YA 3LWPC 3CCLF 3OBWA 1M1KH 2FC3A 1VQ4F 3NVKE 5DCVA 2OHWA 3J7AR 4NQ3A 1VQ5F 5HY2A 1CK2A 1W40A 3SIUA 4BVQA 1VQ6F 3CCRF 1YJWF 4BVRA 5G4VC 3CC4F 2KTUA 1W41A 2QEXF 1Q81H 3CCQF 3GYQA 1S72F 3NK6A 2QA4F 4NUTA 5EO3A 1SDSA 3LFOA 1XBIA 3VI6A 3RA6A 3I56F 1K9MH 3OBYA 2KG4A 3CC2F 2VGNA 4LCKA 1W42A 4BVSA 3D00A 3CCJF 3CMAF 3CPQA 5HY4A 1VQ7F 5HY0A 3PAFA 3NK7A 4BY9D 4EI9A 3AGKA 1JJ2F 1VQNF 3RA5A 1GZ0A 1ZWZA 3CG6A 5HY1A 1Q86H 3CCSF 2OTLF 3HJWC 1VQOF 1YITF 1N8RH 1GO0A 3N4ZA 3MCAB 2JNBA 5EWRA 2BO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIO C;  3CD6 F;  4C4W C;  3WXM B;  2VGM A;  1RA4 A;  5GAN K;  1QVF F;  3SIV A;  3VMF B;  3J80 M;  1T0K B;  1VQ9 F;  5GAP K;  1NMU B;  1W2B F;  1CN7 A;  2LBX A;  3G6E F;  1RLG A;  2OTJ F;  3V7E A;  5G4U C;  1QVG F;  2WAL A;  1Q82 H;  1KQS F;  3CC7 F;  1M90 H;  3LWV C;  4TZZ A;  3CXC F;  3JAM M;  3CCM F;  1Q7Y H;  1K73 H;  3NVI B;  1YJ9 F;  1E7K A;  4X3L A;  3G71 F;  3J81 M;  3LWO C;  5FJ4 C;  1H7M A;  1KD1 H;  3E20 B;  1X52 A;  3NMU C;  2ALE A;  1VQL F;  1X7O A;  5A2Q M;  3CCE F;  3CCV F;  1K8A H;  2CZW A;  3V7Q A;  3CCU F;  3I55 F;  2KTV A;  1GO1 A;  3PLA C;  3N4Y A;  2HVY D;  3IR9 A;  3JCM M;  1VQM F;  3ON1 A;  1IPA A;  1KC8 H;  3HAX D;  1X7P A;  2I6D A;  1PXW A;  3CPW F;  3FFM A;  1YI2 F;  3LWQ C;  5GIP C;  3O85 A;  3LWR C;  5FLX M;  4X3M A;  1YJN F;  1VQK F;  5GIN C;  1YHQ F;  1VQ8 F;  2QI2 A;  3G4S F;  1W3E X;  3OW2 F;  5IT9 M;  1DT9 A;  1VQP F;  1NJI H;  2AIF A;  2LBW A;  2OZB A;  4BW0 B;  3CME F;  1YIJ F;  3E1Y A;  3LWP C;  3CCL F;  3OBW A;  1M1K H;  2FC3 A;  1VQ4 F;  3NVK E;  5DCV A;  2OHW A;  3J7A R;  1VQ5 F;  1CK2 A;  1W40 A;  3SIU A;  1VQ6 F;  3CCR F;  1YJW F;  3CC4 F;  5G4V C;  2KTU A;  1W41 A;  2QEX F;  1Q81 H;  3CCQ F;  3GYQ A;  1S72 F;  3NK6 A;  2QA4 F;  4NUT A;  5EO3 A;  1SDS A;  3LFO A;  1XBI A;  3VI6 A;  3RA6 A;  3I56 F;  1K9M H;  3OBY A;  2KG4 A;  3CC2 F;  2VGN A;  4LCK A;  1W42 A;  3CCJ F;  3CMA F;  3CPQ A;  1VQ7 F;  3PAF A;  3NK7 A;  4BY9 D;  1VQN F;  3AGK A;  1JJ2 F;  3RA5 A;  1GZ0 A;  1ZWZ A;  3CG6 A;  2OTL F;  1Q86 H;  3CCS F;  3HJW C;  1VQO F;  1YIT F;  1N8R H;  1GO0 A;  3N4Z A;  3MCA B;  2JNB A;  5EWR A;  2BO1 A; 
#chains in the Genus database with same CATH topology
 3N2G A;  3C9S A;  3CD6 F;  4C4W C;  1TUB B;  1JFF B;  5HP8 A;  1QVF F;  3VMF B;  3J80 M;  1JD1 A;  3S06 A;  4EI7 A;  5KMG A;  1FFX B;  1W5A A;  4C8I A;  3G6E F;  3S0Y A;  3RYH B;  4BT6 A;  3CC7 F;  3K2X A;  1M90 H;  5LOV A;  1OFU A;  5FNV B;  2Q1Y A;  3CCM F;  1Q7Y H;  3NVI B;  2Z1F A;  5HP7 A;  4X20 A;  4TV8 B;  4C8G A;  3VOA A;  1Z5V A;  5GON B;  3LWO C;  1X25 A;  3LDT A;  1UI9 A;  3E20 B;  1COM A;  1X52 A;  3FD6 A;  2OTM A;  2ALE A;  2EWC A;  4C82 A;  1FNK A;  1R1M A;  3KJK A;  1JY8 A;  2KTV A;  3N4Y A;  3IEW A;  1SA0 A;  2FGY A;  1PF5 A;  2VAP A;  4ZHQ B;  3IR9 A;  1VQM F;  2AMT A;  3F0D A;  3FD5 A;  3MDO A;  2VAM A;  1X7P A;  4BT4 A;  4O4J A;  3R0P A;  1VK3 A;  4O4L B;  3JAL A;  3KJJ A;  4RQO A;  1PXW A;  1U40 A;  2VAW A;  3CB2 A;  3HWU A;  4RHA A;  3V3T A;  3WGJ A;  5HWE A;  4BVT A;  4BT3 A;  1YI2 F;  3LWQ C;  2H8C A;  3JAS A;  2K1S A;  4KWE A;  3HKD A;  2CWJ A;  3IKF A;  5GIN C;  3G4S F;  1W3E X;  3F6M A;  2RHO A;  1TVK B;  3Q8H A;  3JAK B;  1NJI H;  2LBW A;  2OZB A;  2GLZ A;  4O4I A;  2LBT A;  1IV3 A;  3LYB A;  4TV9 B;  4X1Y A;  3CCL F;  3MCQ A;  1M1K H;  5EZY A;  5IJ0 A;  5DCV A;  2OHW A;  4BT7 A;  3D54 A;  3WPX A;  4NQ3 A;  3SIU A;  5EYP A;  5EAZ A;  1VQ6 F;  3CCR F;  2VXY A;  3GTZ A;  5CA1 B;  4M8I A;  3P4E A;  2Z1T A;  1Q81 H;  1S72 F;  1J7H A;  4NUT A;  3IKE A;  1XBI A;  3I56 F;  1ODE A;  4BVS A;  2CVL A;  3QUW A;  3CMA F;  4ZOL B;  2P6Y A;  5HY4 A;  3V4D A;  4B46 A;  2CSL A;  5HY0 A;  3PAF A;  4BY9 D;  1W57 A;  4WBN A;  5KX5 B;  1VQN F;  3ZP4 A;  2OTL F;  5LP6 B;  5JCO C;  5JH7 A;  2JNB A;  2AIZ P;  4ZI7 A;  2VGM A;  5GAN K;  3K14 A;  5IJ9 B;  3SIV A;  3VYS C;  5JVD A;  1T0K B;  3F0G A;  1VQ9 F;  2RHJ A;  3JAT B;  1W2B F;  2F9Z C;  4YJ3 A;  5JQG B;  1VH8 A;  1XHO A;  3V7E A;  4TUY B;  3RE3 A;  4ZHY B;  2R75 1;  1H48 A;  5LP6 C;  2H6L A;  1K73 H;  3RYF B;  5B8F A;  5LA6 A;  1E7K A;  4F6R B;  5CA0 B;  3FBA A;  3HKE B;  3HKB B;  5FJ4 C;  3BYQ A;  1RQ2 A;  4XCQ A;  4B5C A;  1KD1 H;  3VCZ A;  1W58 1;  2ZVZ A;  5EIB D;  3C8L A;  1X7O A;  5A2Q M;  4ZK7 A;  3CCV F;  2CZW A;  3S0H A;  3ZOP A;  3CCU F;  5HXU A;  1GO1 A;  1TUB A;  1JFF A;  3T80 A;  4ERH A;  3PLA C;  5HXZ A;  2HVY D;  1KNJ A;  5EB1 B;  5LYJ B;  1CLI A;  4I4T B;  3TD3 A;  1IPA A;  3N2G B;  1KC8 H;  1QD9 A;  3E22 B;  4X1I B;  3RYH A;  2I6D A;  1U3P A;  1RQ7 A;  2BTQ B;  5FNV A;  4O2B B;  3WGL A;  5GIP C;  3LWR C;  4X1K B;  4X3M A;  2HP0 B;  1FNJ A;  4O4H B;  4EI8 A;  1VQ8 F;  5GON A;  3OW2 F;  2DT4 A;  2HRU A;  5CB4 B;  2PMP A;  3DDN A;  2IG8 A;  3JAW B;  1YIJ F;  3E1Y A;  1VQ4 F;  3NVK E;  2L26 A;  3D01 A;  1CK2 A;  4U3J B;  4ZHQ A;  3KHN A;  3WGN A;  4BVR A;  2RHL A;  5G4V C;  2UZH A;  1W41 A;  3UT5 B;  4LNU A;  2DYY A;  1JN1 A;  1XRG A;  2CHS A;  2HP3 A;  3N2K B;  4O4L A;  3LFO A;  3VI6 A;  3RYC B;  3RA6 A;  1K9M H;  2UYN B;  2VGN A;  1Z5W A;  4ZHW A;  2YYE A;  1DBF A;  1XV2 A;  1W5E A;  1TVK A;  1JJ2 F;  3JAK A;  2Z1U A;  3JAS B;  3IMP A;  3S0W A;  4NWO B;  1ZWZ A;  3CG6 A;  4TV9 A;  5HY1 A;  3CCS F;  2R6R 1;  1T0A A;  1N8R H;  1GO0 A;  4FFB B;  3MCA B;  5EWR A;  4O4I B;  1SZQ A;  5EZY B;  5CA1 A;  5IJ0 B;  3VYT C;  4R40 B;  1W55 A;  4IHJ B;  4G4X A;  2LBX A;  1RLG A;  2Q1X A;  3K0T A;  2OTJ F;  3HTN A;  5G4U C;  3WGK A;  2WAL A;  4I50 B;  3M84 A;  1KQS F;  3LWV C;  4TZZ A;  3JAM M;  5J2U B;  2KGW A;  4G4Z A;  4U39 A;  4ZOL A;  1YJ9 F;  4X3L A;  3GHZ A;  5MN5 A;  3G71 F;  1H7M A;  2ZVY A;  5LP6 A;  5C8Y B;  1VQL F;  4BT2 A;  3CCE F;  4DRX B;  1QU9 A;  2G9I A;  3VO8 A;  3JAR B;  3RYI B;  4HNA A;  5IJ9 A;  4EB6 B;  5JH7 B;  3JCM M;  3JAT A;  5IYZ A;  5JQG A;  4O2A B;  4ZI7 B;  4TUY A;  2H8E A;  3CYQ A;  3FFM A;  3RYF A;  1KNK A;  4E6E A;  1W59 A;  2W8B C;  5FLX M;  2CW4 A;  3HKC B;  1YJN F;  1VQK F;  5CA0 A;  5EIB C;  1YHQ F;  1YQN A;  2QI2 A;  3KIZ A;  4IIJ B;  4I55 B;  3HKE A;  4YJ2 B;  5IT9 M;  1DT9 A;  2HS4 A;  5LXT B;  5BMV B;  4BW0 B;  1W5B A;  3CYP B;  4G4W A;  3TD5 A;  5J2T B;  1U3L A;  5ITZ B;  2ZF8 A;  1YGY A;  1FFX A;  5LYJ A;  3VIU A;  4BVQ A;  1VQV A;  4I4T A;  2B33 A;  1YJW F;  4B45 A;  3CC4 F;  1QAH A;  2QEX F;  4G4V A;  5KMG B;  3ESJ A;  3GYQ A;  2HS3 A;  3E22 A;  4X1I A;  2QA4 F;  4TV8 A;  1SDS A;  3I3F A;  2GVI A;  3OBY A;  5LOV B;  3CC2 F;  1IV2 A;  4O2B A;  4DXD A;  3F0E A;  1IV4 A;  3FPI A;  4X1K A;  3D00 A;  4X20 B;  2HP0 A;  4O4H A;  1VQ7 F;  3ZP7 A;  1UFY A;  5CB4 A;  3C9T A;  2LCA A;  3NK7 A;  3RA5 A;  3JAW A;  5MN4 A;  1NQ3 A;  3P10 A;  4PWT A;  2YXZ A;  3HJW C;  1YIT F;  3WJP A;  3MQW A;  2ZAU A;  1W40 A;  2BO1 A;  3M1X A;  5GIO C;  4U3J A;  3WXM B;  1SA0 B;  1RA4 A;  3LME A;  3L7Q A;  5GAP K;  3UT5 A;  1NMU B;  1CN7 A;  3ZO8 A;  5AVM A;  2Z01 A;  3N2K A;  4O4J B;  3RYC A;  1Q82 H;  1QVG F;  2GZL A;  3JAL B;  2UYN A;  3CXC F;  4LNU B;  2RB9 A;  3HKD B;  4ZHV A;  3U0O A;  3J81 M;  5MN6 A;  2IQQ A;  4B62 A;  1RLU A;  3F0F A;  3MBM A;  3C9R A;  1U43 A;  4X1Y B;  3NMU C;  4FFB A;  3EOR A;  2IAF A;  3QHD A;  1K8A H;  3V7Q A;  2MQE A;  2ZOD A;  1FSZ A;  1VHA A;  3KE1 A;  4G88 A;  5JCO A;  3I55 F;  2I6R A;  2V9Y A;  4G4Y A;  1Q8R A;  5EYP B;  4IHJ A;  2HX0 A;  3ON1 A;  3S03 A;  3HAX D;  1ONI A;  1W5F A;  3DC2 A;  3P0Z A;  3WJR A;  4I50 A;  1OAP A;  2HRY A;  3JVH A;  3CPW F;  4BT5 A;  3OON A;  5J2U A;  1H47 A;  5KX5 A;  3O85 A;  2UYJ A;  2CHT A;  2PHN A;  2BTU A;  5EB0 A;  3ERN A;  4WBN B;  1VQP F;  2AIF A;  2N48 A;  3QTY A;  3CME F;  3VOB A;  4C81 A;  3LWP C;  2NMU A;  3WGM A;  2UYP A;  3OBW A;  5C8Y A;  2FC3 A;  1IV1 A;  4DRX A;  3J7A R;  3JAR A;  1VQ5 F;  5HY2 A;  3RYI A;  3VTI C;  4EB6 A;  5JVD B;  3VYU C;  2KTU A;  3TD4 A;  2Z1E A;  3CCQ F;  4C8E A;  4O2A A;  3M4S A;  4YJ3 B;  3NK6 A;  3K12 A;  4HNA B;  3C9U A;  5EO3 A;  4F6R A;  3B6N A;  2QTP A;  5IYZ B;  2KG4 A;  3HKB A;  4LCK A;  1W42 A;  3S02 A;  1GX1 A;  3CCJ F;  2ZOV A;  3HKC A;  3CPQ A;  5LA6 B;  4IIJ A;  4I55 A;  4YJ2 A;  3I7T A;  2HS0 A;  5LXT A;  4EI9 A;  3AGK A;  3ELC A;  5BMV A;  3WJQ A;  1GZ0 A;  1Q86 H;  5J2T A;  2HQS C;  2UYK A;  3WPW A;  5ITZ A;  1VQO F;  2RHH A;  3N4Z A;  2BTO A;  3IEQ A; 
#chains in the Genus database with same CATH homology
 5GIO C;  3CD6 F;  4C4W C;  3WXM B;  2VGM A;  1RA4 A;  5GAN K;  1QVF F;  3SIV A;  3VMF B;  3J80 M;  1T0K B;  1VQ9 F;  4EI7 A;  5GAP K;  1NMU B;  1W2B F;  2F9Z C;  1CN7 A;  2LBX A;  3G6E F;  1RLG A;  2OTJ F;  3V7E A;  5G4U C;  1QVG F;  2WAL A;  1Q82 H;  1KQS F;  3CC7 F;  1M90 H;  3LWV C;  4TZZ A;  3CXC F;  3JAM M;  3CCM F;  1Q7Y H;  1K73 H;  3NVI B;  1YJ9 F;  1E7K A;  4X3L A;  3G71 F;  3J81 M;  3LWO C;  5FJ4 C;  1H7M A;  4XCQ A;  1KD1 H;  3E20 B;  1X52 A;  3NMU C;  2ALE A;  1VQL F;  1X7O A;  5A2Q M;  3CCE F;  3CCV F;  1K8A H;  2CZW A;  3V7Q A;  3CCU F;  3I55 F;  2KTV A;  5HXU A;  1GO1 A;  3PLA C;  3N4Y A;  5HXZ A;  2HVY D;  2FGY A;  3IR9 A;  3JCM M;  1VQM F;  3ON1 A;  1IPA A;  1KC8 H;  3HAX D;  1X7P A;  2I6D A;  1PXW A;  3V3T A;  5HWE A;  3CPW F;  3FFM A;  4BVT A;  1YI2 F;  3LWQ C;  5GIP C;  3O85 A;  3LWR C;  5FLX M;  4X3M A;  1YJN F;  1VQK F;  5GIN C;  1YHQ F;  4EI8 A;  2QI2 A;  3G4S F;  1VQ8 F;  1W3E X;  3OW2 F;  5IT9 M;  1DT9 A;  1VQP F;  1NJI H;  2AIF A;  2LBW A;  2GLZ A;  4BW0 B;  3CME F;  2OZB A;  1YIJ F;  3E1Y A;  3LWP C;  3CCL F;  3OBW A;  1M1K H;  2FC3 A;  1VQ4 F;  3NVK E;  5DCV A;  2OHW A;  3J7A R;  4NQ3 A;  1VQ5 F;  5HY2 A;  1CK2 A;  1W40 A;  3SIU A;  4BVQ A;  1VQ6 F;  3CCR F;  1YJW F;  4BVR A;  5G4V C;  3CC4 F;  2KTU A;  1W41 A;  2QEX F;  1Q81 H;  3CCQ F;  3GYQ A;  1S72 F;  3NK6 A;  2QA4 F;  4NUT A;  5EO3 A;  1SDS A;  3LFO A;  1XBI A;  3VI6 A;  3RA6 A;  3I56 F;  1K9M H;  3OBY A;  2KG4 A;  3CC2 F;  2VGN A;  4LCK A;  1W42 A;  4BVS A;  3D00 A;  3CCJ F;  3CMA F;  3CPQ A;  5HY4 A;  1VQ7 F;  5HY0 A;  3PAF A;  3NK7 A;  4BY9 D;  4EI9 A;  3AGK A;  1JJ2 F;  1VQN F;  3RA5 A;  1GZ0 A;  1ZWZ A;  3CG6 A;  5HY1 A;  1Q86 H;  3CCS F;  2OTL F;  3HJW C;  1VQO F;  1YIT F;  1N8R H;  1GO0 A;  3N4Z A;  3MCA B;  2JNB A;  5EWR A;  2BO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...