2BO1A

Crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MVDIAFELRKVIDSGKYTLGYRKTVQSLKMGGSKLIIIARNTRPDRKEDLEYYARLSGTPVYEFEGTNVELGTAVGKPHTVSVVSILDAGESRILALGGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Hydrophobic Core and Electrostatic Surface to the Thermodyanmic Stability of Ribosomal Protein L30E
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2bo1A00
3CCRF 3RA5A 1DT9A 1X52A 3V7EA 2QI2A 1S72F 1E7KA 1KC8H 1VQ8F 1M90H 1IPAA 1ZWZA 4BW0B 5FJ4C 2BO1A 3VMFB 2QA4F 3CD6F 3E1YA 1H7MA 3G71F 3JAMM 3SIUA 1PXWA 1W41A 1YHQF 3LWOC 1Q82H 3RA6A 1QVGF 3I55F 1YJ9F 1KD1H 1SDSA 2I6DA 4LCKA 1KQSF 5IT9M 1NJIH 2ALEA 1VQNF 3AGKA 3CC4F 4X3MA 3N4ZA 2VGNA 3I56F 4NUTA 1VQ7F 1XBIA 3CCJF 1VQKF 4BY9D 1YJWF 1N8RH 3CPQA 3CCQF 3WXMB 2FC3A 3V7QA 1CN7A 3CCVF 1VQMF 3OBWA 1Q7YH 2KTVA 3J80M 2OTJF 5GAPK 1VQPF 1VQOF 1GZ0A 2OTLF 4C4WC 2AIFA 3MCAB 2VGMA 3HJWC 2OHWA 3CMAF 3NK7A 1GO0A 3CCMF 1W3EX 3CG6A 1NMUB 3LFOA 1JJ2F 4X3LA 5A2QM 2QEXF 3SIVA 2WALA 3FFMA 3GYQA 3NK6A 3NVKE 2KG4A 5GANK 1RLGA 1RA4A 3NVIB 2LBXA 1YJNF 1QVFF 3J7AR 3LWRC 1W42A 3CPWF 3CCEF 5G4UC 2KTUA 1YIJF 5GIPC 1YITF 3J81M 3G4SF 3N4YA 5DCVA 5GIOC 1Q81H 3OBYA 1K8AH 3LWPC 3HAXD 1VQ9F 2CZWA 3CXCF 1W40A 5EWRA 1M1KH 3CMEF 5FLXM 3CC2F 3LWVC 2HVYD 1YI2F 1GO1A 2LBWA 1K9MH 5G4VC 3PLAC 1X7OA 1X7PA 3JCMM 3IR9A 3G6EF 3OW2F 1VQ6F 2JNBA 1W2BF 3PAFA 3CCSF 5GINC 3CC7F 5EO3A 4TZZA 1Q86H 1CK2A 3VI6A 3E20B 3ON1A 3NMUC 3CCUF 3LWQC 1VQ5F 3O85A 1VQ4F 3CCLF 2OZBA 1T0KB 1VQLF 1K73H
chains in the Genus database with same CATH superfamily
3CCRF 3S03A 5LP6C 3JAKB 2GZLA 2UYNA 2VAWA 2V9YA 4XCQA 4BVRA 5FJ4C 4BW0B 4BT7A 2VXYA 3VMFB 2QA4F 2VAPA 3FBAA 3I7TA 4G4WA 4O4JB 3UT5A 2B33A 3LWOC 1T0AA 3K2XA 1YGYA 3VYSC 5EB1B 5HP7A 2Z01A 4LCKA 1KNJA 5KMGA 1U40A 2HS3A 1KQSF 4EI9A 4ZHQA 4U39A 3ESJA 3DC2A 4X1KA 1XHOA 5LXTA 1TVKB 2VGNA 3I56F 2AIZP 4C8GA 3CCJF 4BY9D 2F9ZC 3WGLA 1U3PA 1XRGA 2ZOVA 1VH8A 2FC3A 3IKFA 5LYJA 2G9IA 3RE3A 2MQEA 4BVTA 2KTVA 2YYEA 3JASA 2OTJF 4EI8A 1VQOF 1VQPF 5LP6A 3P0ZA 2ZVYA 2P6YA 2OTLF 5KX5A 5IJ0A 3JARA 3MCAB 2ZAUA 3RYIB 5IJ9B 3ZO8A 4BT6A 3LDTA 3R0PA 1JD1A 5JVDA 1W3EX 3CCMF 1NMUB 3C9TA 5LA6B 3SIVA 3FFMA 3NK6A 5IYZB 4YJ2A 3I3FA 3K12A 1NQ3A 1FNKA 1YJNF 4WBNB 1QVFF 3J7AR 3P4EA 5KX5B 3FD5A 2K1SA 2KTUA 1Z5VA 1W55A 2Z1FA 4RHAA 4EB6B 3S0YA 3ELCA 2Z1EA 4M8IA 1FFXB 3J81M 5GONB 3N4YA 5LYJB 5GIOC 1Q81H 1UI9A 4FFBB 4HNAB 4U3JA 3CYQA 3VYUC 3M4SA 3CMEF 1TVKA 5HXUA 1X25A 2L26A 3ERNA 4X1KB 1W5BA 2LBWA 3PLAC 4X20B 5EB0A 2HP3A 3IR9A 3OW2F 5KMGB 5EZYA 3PAFA 3CCSF 1FSZA 5EO3A 1Q86H 4NWOB 3ON1A 3NMUC 3CCUF 5CA0A 3LWQC 2NMUA 1VQLF 2RHHA 2HRUA 3RA5A 5CA1A 2QI2A 3MCQA 3ZP4A 1S72F 2UYNB 1KC8H 4RQOA 2Z1UA 1ZWZA 2HQSC 4I50A 2HRYA 2CHSA 3G71F 1FFXA 2ZVZA 5BMVB 3JAMM 4YJ3A 3KJJA 1SDSA 3MDOA 2HS4A 3HKCB 4WBNA 1IV4A 3HWUA 2PHNA 4TV8B 2Z1TA 4YJ2B 5IYZA 4X3MA 4NUTA 5HY4A 3B6NA 1XBIA 1VQKF 3FD6A 4O4IA 3JATA 3DDNA 3CPQA 2H6LA 4BT2A 1U3LA 3V7QA 2HP0B 3TD3A 3OBWA 3JARB 5FNVA 1XV2A 5IJ0B 5GAPK 3JALA 2CSLA 1GZ0A 4PWTA 2EWCA 2H8EA 4O2AA 1YQNA 3IEQA 5LP6B 5HY2A 3S02A 5JH7A 3HJWC 4X1YB 2KGWA 4ZHWA 3CG6A 3HKEA 3MBMA 3LFOA 5AVMA 1JJ2F 1H47A 5JQGA 3N2KA 4IIJA 2WALA 1IV3A 3FPIA 1Z5WA 3D00A 3WGMA 5GANK 5J2UB 1RLGA 4ZHQB 1JFFB 4DRXB 5LOVB 3L7QA 1W42A 3HKDA 1CLIA 4TV9A 5HWEA 2IQQA 4ERHA 3F6MA 4TUYA 4O4JA 3UT5B 1VHAA 3WPXA 2UYJA 3IKEA 1W581 3GHZA 4E6EA 2IAFA 5J2TA 3HAXD 3WJPA 4R40B 3WJRA 5C8YA 4ZHYB 3V3TA 3JAKA 1Q8RA 3CB2A 5J2TB 1YI2F 5G4VC 5JCOA 1X7OA 1X7PA 2CWJA 2YXZA 3EORA 1VQVA 4LNUB 2W8BC 3IMPA 1OFUA 4X1IB 2UYKA 3CC7F 4TV9B 3WJQA 3HKBA 1W57A 3JAWB 3RYHB 4BVSA 3WGJA 4I55B 5LOVA 1SA0A 5J2UA 3E22A 2BTUA 4C82A 1K73H 4O4HA 1DT9A 2HX0A 3V7EA 3N2KB 4IIJB 3RYFA 5JQGB 4F6RB 1VQ8F 1M90H 2ZF8A 1IPAA 5EYPA 2GLZA 5HXZA 3N2GB 2BO1A 5MN5A 3CD6F 3E1YA 5JH7B 3RYCB 1GX1A 1H7MA 2R6R1 2Q1XA 3SIUA 1PXWA 1W41A 2DYYA 3RA6A 1QVGF 3I55F 2BTQB 1J7HA 4O2AB 2RHJA 3S0WA 1W5AA 3T80A 3C8LA 2ZODA 4NQ3A 5FNVB 3RYCA 2HP0A 5IT9M 1NJIH 2ALEA 1IV1A 3N4ZA 4O4IB 5HP8A 4G4ZA 4O4HB 1JY8A 4ZOLA 4I4TB 2GVIA 3E22B 4IHJB 4TV8A 3CCVF 3HTNA 4KWEA 4ZI7B 3J80M 3HKCA 3RYHA 3HKBB 1TUBB 2I6RA 3GTZA 3C9RA 4YJ3B 4C8EA 3C9UA 4G4XA 1SZQA 3OONA 3VIUA 4I50B 1ONIA 3CMAF 2PMPA 3NK7A 1QD9A 4DXDA 5C8YB 4X3LA 5A2QM 5CA1B 1U43A 3GYQA 3U0OA 3NVKE 1KNKA 3M84A 1RA4A 1COMA 3QTYA 4BT4A 2HS0A 1W59A 4ZHVA 3VYTC 5HY0A 3CCEF 5EIBC 4O2BB 2LBTA 3VCZA 1TUBA 5EIBD 1YIJF 3HKDB 3KE1A 4G4VA 5EZYB 4ZI7A 4BT5A 1JFFA 3BYQA 3G4SF 4IHJA 4I4TA 3LYBA 4G4YA 3LWPC 1VQ9F 2CZWA 1W40A 3VTIC 5CB4A 3D54A 3HKEB 2UZHA 2RHLA 2HVYD 1FNJA 4U3JB 4X1YA 1K9MH 1H48A 3P10A 5GONA 5MN4A 1DBFA 2JNBA 3CYPB 3S0HA 1W2BF 2CHTA 4B46A 4EB6A 4TZZA 1CK2A 3ZP7A 3VI6A 4EI7A 3E20B 3JALB 3C9SA 3Q8HA 2VAMA 1VQ5F 3F0EA 4G88A 3LMEA 3O85A 1VQ4F 3CCLF 3N2GA 2OZBA 1T0KB 3M1XA 2LCAA 3KJKA 5EYPB 3F0DA 1X52A 5CB4B 3VOAA 1E7KA 2OTMA 1W5FA 5JVDB 2N48A 3RYIA 5IJ9A 2RHOA 2DT4A 1YHQF 1RQ7A 3JAWA 1Q82H 1W5EA 2AMTA 3KHNA 1YJ9F 3F0GA 4O2BA 3WGKA 1KD1H 4X1IA 2I6DA 4LNUA 3JASB 5BMVA 4B45A 1PF5A 5JCOC 2IG8A 3IEWA 1VQNF 3AGKA 3CC4F 1RQ2A 1R1MA 1VQ7F 3K14A 1IV2A 3K0TA 1YJWF 1N8RH 1VK3A 5LXTB 2RB9A 1JN1A 3CCQF 3WXMB 1CN7A 1VQMF 1Q7YH 4TUYB 5CA0B 3S06A 2CW4A 4BVQA 2BTOA 3TD4A 4ZK7A 4C81A 4C4WC 2UYPA 2AIFA 2VGMA 2H8CA 2FGYA 2OHWA 4DRXA 4X20A 3VOBA 4BT3A 1GO0A 4ZOLB 1OAPA 2QEXF 5MN6A 3V4DA 2KG4A 4FFBA 3KIZA 4HNAA 3NVIB 2LBXA 3LWRC 5ITZB 3CPWF 4O4LA 5G4UC 2R751 5EAZA 3VO8A 4B5CA 3WGNA 5B8FA 5GIPC 1YITF 5DCVA 3OBYA 3JVHA 1K8AH 3JATB 3QHDA 3F0FA 3QUWA 3CXCF 4F6RA 5LA6A 5EWRA 3RYFB 3TD5A 1M1KH 5FLXM 3CC2F 3LWVC 1GO1A 1SA0B 1QU9A 3D01A 2CVLA 3JCMM 3G6EF 1VQ6F 4I55A 4B62A 1QAHA 5GINC 1UFYA 2Q1YA 3MQWA 4O4LB 5ITZA 3ZOPA 1RLUA 5HY1A 1ODEA 4C8IA 2QTPA 3WPWA
chains in the Genus database with same CATH topology
3CCRF 3RA5A 1DT9A 1X52A 3V7EA 2QI2A 1S72F 1E7KA 1KC8H 1VQ8F 4XCQA 4BVRA 1M90H 1IPAA 1ZWZA 2GLZA 4BW0B 5HXZA 5FJ4C 2BO1A 3VMFB 2QA4F 3CD6F 3E1YA 1H7MA 3G71F 3JAMM 3SIUA 1PXWA 1W41A 1YHQF 3LWOC 1Q82H 3RA6A 1QVGF 3I55F 1YJ9F 1KD1H 1SDSA 2I6DA 4LCKA 4NQ3A 1KQSF 4EI9A 5IT9M 1NJIH 2ALEA 1VQNF 3AGKA 3CC4F 4X3MA 3N4ZA 2VGNA 3I56F 4NUTA 5HY4A 1VQ7F 1XBIA 3CCJF 1VQKF 4BY9D 2F9ZC 1YJWF 1N8RH 3CPQA 3CCQF 3WXMB 2FC3A 3V7QA 1CN7A 3CCVF 1VQMF 3OBWA 1Q7YH 4BVTA 2KTVA 3J80M 2OTJF 5GAPK 4EI8A 1VQOF 1VQPF 1GZ0A 4BVQA 2OTLF 5HY2A 4C4WC 2AIFA 3MCAB 2VGMA 3HJWC 2FGYA 2OHWA 3CMAF 3NK7A 1GO0A 3CCMF 1W3EX 3CG6A 1NMUB 3LFOA 1JJ2F 4X3LA 5A2QM 2QEXF 3SIVA 2WALA 3FFMA 3GYQA 3NK6A 3NVKE 2KG4A 3D00A 5GANK 1RLGA 1RA4A 3NVIB 2LBXA 1YJNF 1QVFF 3J7AR 3LWRC 1W42A 3CPWF 5HY0A 3CCEF 5G4UC 2KTUA 1YIJF 5HWEA 5GIPC 1YITF 3J81M 3G4SF 3N4YA 5DCVA 5GIOC 1Q81H 3OBYA 1K8AH 3LWPC 3HAXD 1VQ9F 2CZWA 3CXCF 1W40A 5EWRA 3V3TA 1M1KH 3CMEF 5FLXM 5HXUA 3LWVC 3CC2F 2HVYD 1YI2F 1GO1A 2LBWA 1K9MH 5G4VC 3PLAC 1X7OA 1X7PA 3JCMM 3IR9A 3G6EF 3OW2F 1VQ6F 2JNBA 1W2BF 3PAFA 3CCSF 5GINC 3CC7F 5EO3A 4TZZA 1Q86H 1CK2A 4EI7A 3VI6A 3E20B 3ON1A 3NMUC 3CCUF 3LWQC 4BVSA 1VQ5F 5HY1A 3O85A 1VQ4F 3CCLF 2OZBA 1T0KB 1VQLF 1K73H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR F;  3RA5 A;  1DT9 A;  1X52 A;  3V7E A;  2QI2 A;  1S72 F;  1E7K A;  1KC8 H;  1VQ8 F;  1M90 H;  1IPA A;  1ZWZ A;  4BW0 B;  5FJ4 C;  2BO1 A;  3VMF B;  2QA4 F;  3CD6 F;  3E1Y A;  1H7M A;  3G71 F;  3JAM M;  3SIU A;  1PXW A;  1W41 A;  1YHQ F;  3LWO C;  1Q82 H;  3RA6 A;  1QVG F;  3I55 F;  1YJ9 F;  1KD1 H;  1SDS A;  2I6D A;  4LCK A;  1KQS F;  5IT9 M;  1NJI H;  2ALE A;  1VQN F;  3AGK A;  3CC4 F;  4X3M A;  3N4Z A;  2VGN A;  3I56 F;  4NUT A;  1VQ7 F;  1XBI A;  3CCJ F;  1VQK F;  4BY9 D;  1YJW F;  1N8R H;  3CPQ A;  3CCQ F;  3WXM B;  2FC3 A;  3V7Q A;  1CN7 A;  3CCV F;  1VQM F;  3OBW A;  1Q7Y H;  2KTV A;  3J80 M;  2OTJ F;  5GAP K;  1VQP F;  1VQO F;  1GZ0 A;  2OTL F;  4C4W C;  2AIF A;  3MCA B;  2VGM A;  3HJW C;  2OHW A;  3CMA F;  3NK7 A;  1GO0 A;  3CCM F;  1W3E X;  3CG6 A;  1NMU B;  3LFO A;  1JJ2 F;  4X3L A;  5A2Q M;  2QEX F;  3SIV A;  2WAL A;  3FFM A;  3GYQ A;  3NK6 A;  3NVK E;  2KG4 A;  5GAN K;  1RLG A;  1RA4 A;  3NVI B;  2LBX A;  1YJN F;  1QVF F;  3J7A R;  3LWR C;  1W42 A;  3CPW F;  3CCE F;  5G4U C;  2KTU A;  1YIJ F;  5GIP C;  1YIT F;  3J81 M;  3G4S F;  3N4Y A;  5DCV A;  5GIO C;  1Q81 H;  3OBY A;  1K8A H;  3LWP C;  3HAX D;  1VQ9 F;  2CZW A;  3CXC F;  1W40 A;  5EWR A;  1M1K H;  3CME F;  5FLX M;  3CC2 F;  3LWV C;  2HVY D;  1YI2 F;  1GO1 A;  2LBW A;  1K9M H;  5G4V C;  3PLA C;  1X7O A;  1X7P A;  3JCM M;  3IR9 A;  3G6E F;  3OW2 F;  1VQ6 F;  2JNB A;  1W2B F;  3PAF A;  3CCS F;  5GIN C;  3CC7 F;  5EO3 A;  4TZZ A;  1Q86 H;  1CK2 A;  3VI6 A;  3E20 B;  3ON1 A;  3NMU C;  3CCU F;  3LWQ C;  1VQ5 F;  3O85 A;  1VQ4 F;  3CCL F;  2OZB A;  1T0K B;  1VQL F;  1K73 H; 
#chains in the Genus database with same CATH topology
 3CCR F;  3S03 A;  5LP6 C;  3JAK B;  2GZL A;  2UYN A;  2VAW A;  2V9Y A;  4XCQ A;  4BVR A;  5FJ4 C;  4BW0 B;  4BT7 A;  2VXY A;  3VMF B;  2QA4 F;  2VAP A;  3FBA A;  3I7T A;  4G4W A;  4O4J B;  3UT5 A;  2B33 A;  3LWO C;  1T0A A;  3K2X A;  1YGY A;  3VYS C;  5EB1 B;  5HP7 A;  2Z01 A;  4LCK A;  1KNJ A;  5KMG A;  1U40 A;  2HS3 A;  1KQS F;  4EI9 A;  4ZHQ A;  4U39 A;  3ESJ A;  3DC2 A;  4X1K A;  1XHO A;  5LXT A;  1TVK B;  2VGN A;  3I56 F;  2AIZ P;  4C8G A;  3CCJ F;  4BY9 D;  2F9Z C;  3WGL A;  1U3P A;  1XRG A;  2ZOV A;  1VH8 A;  2FC3 A;  3IKF A;  5LYJ A;  2G9I A;  3RE3 A;  2MQE A;  4BVT A;  2KTV A;  2YYE A;  3JAS A;  2OTJ F;  4EI8 A;  1VQO F;  1VQP F;  5LP6 A;  3P0Z A;  2ZVY A;  2P6Y A;  2OTL F;  5KX5 A;  5IJ0 A;  3JAR A;  3MCA B;  2ZAU A;  3RYI B;  5IJ9 B;  3ZO8 A;  4BT6 A;  3LDT A;  3R0P A;  1JD1 A;  5JVD A;  1W3E X;  3CCM F;  1NMU B;  3C9T A;  5LA6 B;  3SIV A;  3FFM A;  3NK6 A;  5IYZ B;  4YJ2 A;  3I3F A;  3K12 A;  1NQ3 A;  1FNK A;  1YJN F;  4WBN B;  1QVF F;  3J7A R;  3P4E A;  5KX5 B;  3FD5 A;  2K1S A;  2KTU A;  1Z5V A;  1W55 A;  2Z1F A;  4RHA A;  4EB6 B;  3S0Y A;  3ELC A;  2Z1E A;  4M8I A;  1FFX B;  3J81 M;  5GON B;  3N4Y A;  5LYJ B;  5GIO C;  1Q81 H;  1UI9 A;  4FFB B;  4HNA B;  4U3J A;  3CYQ A;  3VYU C;  3M4S A;  3CME F;  1TVK A;  5HXU A;  1X25 A;  2L26 A;  3ERN A;  4X1K B;  1W5B A;  2LBW A;  3PLA C;  4X20 B;  5EB0 A;  2HP3 A;  3IR9 A;  3OW2 F;  5KMG B;  5EZY A;  3PAF A;  3CCS F;  1FSZ A;  5EO3 A;  1Q86 H;  4NWO B;  3ON1 A;  3NMU C;  3CCU F;  5CA0 A;  3LWQ C;  2NMU A;  1VQL F;  2RHH A;  2HRU A;  3RA5 A;  5CA1 A;  2QI2 A;  3MCQ A;  3ZP4 A;  1S72 F;  2UYN B;  1KC8 H;  4RQO A;  2Z1U A;  1ZWZ A;  2HQS C;  4I50 A;  2HRY A;  2CHS A;  3G71 F;  1FFX A;  2ZVZ A;  5BMV B;  3JAM M;  4YJ3 A;  3KJJ A;  1SDS A;  3MDO A;  2HS4 A;  3HKC B;  4WBN A;  1IV4 A;  3HWU A;  2PHN A;  4TV8 B;  2Z1T A;  4YJ2 B;  5IYZ A;  4X3M A;  4NUT A;  5HY4 A;  3B6N A;  1XBI A;  1VQK F;  3FD6 A;  4O4I A;  3JAT A;  3DDN A;  3CPQ A;  2H6L A;  4BT2 A;  1U3L A;  3V7Q A;  2HP0 B;  3TD3 A;  3OBW A;  3JAR B;  5FNV A;  1XV2 A;  5IJ0 B;  5GAP K;  3JAL A;  2CSL A;  1GZ0 A;  4PWT A;  2EWC A;  2H8E A;  4O2A A;  1YQN A;  3IEQ A;  5LP6 B;  5HY2 A;  3S02 A;  5JH7 A;  3HJW C;  4X1Y B;  2KGW A;  4ZHW A;  3CG6 A;  3HKE A;  3MBM A;  3LFO A;  5AVM A;  1JJ2 F;  1H47 A;  5JQG A;  3N2K A;  4IIJ A;  2WAL A;  1IV3 A;  3FPI A;  1Z5W A;  3D00 A;  3WGM A;  5GAN K;  5J2U B;  1RLG A;  4ZHQ B;  1JFF B;  4DRX B;  5LOV B;  3L7Q A;  1W42 A;  3HKD A;  1CLI A;  4TV9 A;  5HWE A;  2IQQ A;  4ERH A;  3F6M A;  4TUY A;  4O4J A;  3UT5 B;  1VHA A;  3WPX A;  2UYJ A;  3IKE A;  1W58 1;  3GHZ A;  4E6E A;  2IAF A;  5J2T A;  3HAX D;  3WJP A;  4R40 B;  3WJR A;  5C8Y A;  4ZHY B;  3V3T A;  3JAK A;  1Q8R A;  3CB2 A;  5J2T B;  1YI2 F;  5G4V C;  5JCO A;  1X7O A;  1X7P A;  2CWJ A;  2YXZ A;  3EOR A;  1VQV A;  4LNU B;  2W8B C;  3IMP A;  1OFU A;  4X1I B;  2UYK A;  3CC7 F;  4TV9 B;  3WJQ A;  3HKB A;  1W57 A;  3JAW B;  3RYH B;  4BVS A;  3WGJ A;  4I55 B;  5LOV A;  1SA0 A;  5J2U A;  3E22 A;  2BTU A;  4C82 A;  1K73 H;  4O4H A;  1DT9 A;  2HX0 A;  3V7E A;  3N2K B;  4IIJ B;  3RYF A;  5JQG B;  4F6R B;  1VQ8 F;  1M90 H;  2ZF8 A;  1IPA A;  5EYP A;  2GLZ A;  5HXZ A;  3N2G B;  2BO1 A;  5MN5 A;  3CD6 F;  3E1Y A;  5JH7 B;  3RYC B;  1GX1 A;  1H7M A;  2R6R 1;  2Q1X A;  3SIU A;  1PXW A;  1W41 A;  2DYY A;  3RA6 A;  1QVG F;  3I55 F;  2BTQ B;  1J7H A;  4O2A B;  2RHJ A;  3S0W A;  1W5A A;  3T80 A;  3C8L A;  2ZOD A;  4NQ3 A;  5FNV B;  3RYC A;  2HP0 A;  5IT9 M;  1NJI H;  2ALE A;  1IV1 A;  3N4Z A;  4O4I B;  5HP8 A;  4G4Z A;  4O4H B;  1JY8 A;  4ZOL A;  4I4T B;  2GVI A;  3E22 B;  4IHJ B;  4TV8 A;  3CCV F;  3HTN A;  4KWE A;  4ZI7 B;  3J80 M;  3HKC A;  3RYH A;  3HKB B;  1TUB B;  2I6R A;  3GTZ A;  3C9R A;  4YJ3 B;  4C8E A;  3C9U A;  4G4X A;  1SZQ A;  3OON A;  3VIU A;  4I50 B;  1ONI A;  3CMA F;  2PMP A;  3NK7 A;  1QD9 A;  4DXD A;  5C8Y B;  4X3L A;  5A2Q M;  5CA1 B;  1U43 A;  3GYQ A;  3U0O A;  3NVK E;  1KNK A;  3M84 A;  1RA4 A;  1COM A;  3QTY A;  4BT4 A;  2HS0 A;  1W59 A;  4ZHV A;  3VYT C;  5HY0 A;  3CCE F;  5EIB C;  4O2B B;  2LBT A;  3VCZ A;  1TUB A;  5EIB D;  1YIJ F;  3HKD B;  3KE1 A;  4G4V A;  5EZY B;  4ZI7 A;  4BT5 A;  1JFF A;  3BYQ A;  3G4S F;  4IHJ A;  4I4T A;  3LYB A;  4G4Y A;  3LWP C;  1VQ9 F;  2CZW A;  1W40 A;  3VTI C;  5CB4 A;  3D54 A;  3HKE B;  2UZH A;  2RHL A;  2HVY D;  1FNJ A;  4U3J B;  4X1Y A;  1K9M H;  1H48 A;  3P10 A;  5GON A;  5MN4 A;  1DBF A;  2JNB A;  3CYP B;  3S0H A;  1W2B F;  2CHT A;  4B46 A;  4EB6 A;  4TZZ A;  1CK2 A;  3ZP7 A;  3VI6 A;  4EI7 A;  3E20 B;  3JAL B;  3C9S A;  3Q8H A;  2VAM A;  1VQ5 F;  3F0E A;  4G88 A;  3LME A;  3O85 A;  1VQ4 F;  3CCL F;  3N2G A;  2OZB A;  1T0K B;  3M1X A;  2LCA A;  3KJK A;  5EYP B;  3F0D A;  1X52 A;  5CB4 B;  3VOA A;  1E7K A;  2OTM A;  1W5F A;  5JVD B;  2N48 A;  3RYI A;  5IJ9 A;  2RHO A;  2DT4 A;  1YHQ F;  1RQ7 A;  3JAW A;  1Q82 H;  1W5E A;  2AMT A;  3KHN A;  1YJ9 F;  3F0G A;  4O2B A;  3WGK A;  1KD1 H;  4X1I A;  2I6D A;  4LNU A;  3JAS B;  5BMV A;  4B45 A;  1PF5 A;  5JCO C;  2IG8 A;  3IEW A;  1VQN F;  3AGK A;  3CC4 F;  1RQ2 A;  1R1M A;  1VQ7 F;  3K14 A;  1IV2 A;  3K0T A;  1YJW F;  1N8R H;  1VK3 A;  5LXT B;  2RB9 A;  1JN1 A;  3CCQ F;  3WXM B;  1CN7 A;  1VQM F;  1Q7Y H;  4TUY B;  5CA0 B;  3S06 A;  2CW4 A;  4BVQ A;  2BTO A;  3TD4 A;  4ZK7 A;  4C81 A;  4C4W C;  2UYP A;  2AIF A;  2VGM A;  2H8C A;  2FGY A;  2OHW A;  4DRX A;  4X20 A;  3VOB A;  4BT3 A;  1GO0 A;  4ZOL B;  1OAP A;  2QEX F;  5MN6 A;  3V4D A;  2KG4 A;  4FFB A;  3KIZ A;  4HNA A;  3NVI B;  2LBX A;  3LWR C;  5ITZ B;  3CPW F;  4O4L A;  5G4U C;  2R75 1;  5EAZ A;  3VO8 A;  4B5C A;  3WGN A;  5B8F A;  5GIP C;  1YIT F;  5DCV A;  3OBY A;  3JVH A;  1K8A H;  3JAT B;  3QHD A;  3F0F A;  3QUW A;  3CXC F;  4F6R A;  5LA6 A;  5EWR A;  3RYF B;  3TD5 A;  1M1K H;  5FLX M;  3CC2 F;  3LWV C;  1GO1 A;  1SA0 B;  1QU9 A;  3D01 A;  2CVL A;  3JCM M;  3G6E F;  1VQ6 F;  4I55 A;  4B62 A;  1QAH A;  5GIN C;  1UFY A;  2Q1Y A;  3MQW A;  4O4L B;  5ITZ A;  3ZOP A;  1RLU A;  5HY1 A;  1ODE A;  4C8I A;  2QTP A;  3WPW A; 
#chains in the Genus database with same CATH homology
 3CCR F;  3RA5 A;  1DT9 A;  1X52 A;  3V7E A;  2QI2 A;  1S72 F;  1E7K A;  1KC8 H;  1VQ8 F;  4XCQ A;  4BVR A;  1M90 H;  1IPA A;  1ZWZ A;  2GLZ A;  4BW0 B;  5HXZ A;  5FJ4 C;  2BO1 A;  3VMF B;  2QA4 F;  3CD6 F;  3E1Y A;  1H7M A;  3G71 F;  3JAM M;  3SIU A;  1PXW A;  1W41 A;  1YHQ F;  3LWO C;  1Q82 H;  3RA6 A;  1QVG F;  3I55 F;  1YJ9 F;  1KD1 H;  1SDS A;  2I6D A;  4LCK A;  4NQ3 A;  1KQS F;  4EI9 A;  5IT9 M;  1NJI H;  2ALE A;  1VQN F;  3AGK A;  3CC4 F;  4X3M A;  3N4Z A;  2VGN A;  3I56 F;  4NUT A;  5HY4 A;  1VQ7 F;  1XBI A;  3CCJ F;  1VQK F;  4BY9 D;  2F9Z C;  1YJW F;  1N8R H;  3CPQ A;  3CCQ F;  3WXM B;  2FC3 A;  3V7Q A;  1CN7 A;  3CCV F;  1VQM F;  3OBW A;  1Q7Y H;  4BVT A;  2KTV A;  3J80 M;  2OTJ F;  5GAP K;  4EI8 A;  1VQO F;  1VQP F;  1GZ0 A;  4BVQ A;  2OTL F;  5HY2 A;  4C4W C;  2AIF A;  3MCA B;  2VGM A;  3HJW C;  2FGY A;  2OHW A;  3CMA F;  3NK7 A;  1GO0 A;  3CCM F;  1W3E X;  3CG6 A;  1NMU B;  3LFO A;  1JJ2 F;  4X3L A;  5A2Q M;  2QEX F;  3SIV A;  2WAL A;  3FFM A;  3GYQ A;  3NK6 A;  3NVK E;  2KG4 A;  3D00 A;  5GAN K;  1RLG A;  1RA4 A;  3NVI B;  2LBX A;  1YJN F;  1QVF F;  3J7A R;  3LWR C;  1W42 A;  3CPW F;  5HY0 A;  3CCE F;  5G4U C;  2KTU A;  1YIJ F;  5HWE A;  5GIP C;  1YIT F;  3J81 M;  3G4S F;  3N4Y A;  5DCV A;  5GIO C;  1Q81 H;  3OBY A;  1K8A H;  3LWP C;  3HAX D;  1VQ9 F;  2CZW A;  3CXC F;  1W40 A;  5EWR A;  3V3T A;  1M1K H;  3CME F;  5FLX M;  5HXU A;  3LWV C;  3CC2 F;  2HVY D;  1YI2 F;  1GO1 A;  2LBW A;  1K9M H;  5G4V C;  3PLA C;  1X7O A;  1X7P A;  3JCM M;  3IR9 A;  3G6E F;  3OW2 F;  1VQ6 F;  2JNB A;  1W2B F;  3PAF A;  3CCS F;  5GIN C;  3CC7 F;  5EO3 A;  4TZZ A;  1Q86 H;  1CK2 A;  4EI7 A;  3VI6 A;  3E20 B;  3ON1 A;  3NMU C;  3CCU F;  3LWQ C;  4BVS A;  1VQ5 F;  5HY1 A;  3O85 A;  1VQ4 F;  3CCL F;  2OZB A;  1T0K B;  1VQL F;  1K73 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...