2BO1A

Crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MVDIAFELRKVIDSGKYTLGYRKTVQSLKMGGSKLIIIARNTRPDRKEDLEYYARLSGTPVYEFEGTNVELGTAVGKPHTVSVVSILDAGESRILALGGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Contribution of Hydrophobic Core and Electrostatic Surface to the Thermodyanmic Stability of Ribosomal Protein L30E
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2bo1A00
5EWRA 2HVYD 1VQ9F 3NMUC 2OZBA 3SIVA 3HJWC 1VQ5F 3V7QA 3CCMF 1JJ2F 3SIUA 3VMFB 5A2QM 2ALEA 3CC7F 3PLAC 1CN7A 3G4SF 3LWPC 1YIJF 2AIFA 3CC4F 1VQ7F 1X7PA 2QI2A 1VQ4F 3JCMM 3PAFA 1E7KA 3CCQF 3VI6A 4LCKA 3N4ZA 3JAMM 1YJWF 1W42A 3CPQA 4BW0B 1YJ9F 1YI2F 3HAXD 1QVFF 1NMUB 1S72F 2FC3A 1VQKF 1M1KH 2CZWA 1W2BF 3NK7A 3CCUF 2LBXA 5EO3A 1VQ6F 3I56F 2QEXF 1N8RH 3CCLF 1VQPF 1K9MH 3OW2F 3GYQA 1VQMF 1DT9A 1W3EX 3N4YA 2VGNA 1X7OA 1Q81H 1VQ8F 5FLXM 3J80M 2OTJF 1M90H 3I55F 4X3LA 1Q82H 3IR9A 3LWVC 3CCRF 4TZZA 1K8AH 3OBWA 3CG6A 1CK2A 3RA5A 1GZ0A 2I6DA 2KTUA 3CCSF 3G71F 1YJNF 1T0KB 3V7EA 1GO1A 1GO0A 1VQLF 3LFOA 4NUTA 1KQSF 3CXCF 3CC2F 3CCVF 1IPAA 1ZWZA 2OHWA 2KTVA 1X52A 5GIPC 3CCJF 5DCVA 2JNBA 1XBIA 1YHQF 3G6EF 3CD6F 1Q86H 3LWRC 1QVGF 1K73H 3CPWF 4X3MA 1NJIH 1YITF 2QA4F 1SDSA 3LWQC 3CMAF 1KD1H 2BO1A 4C4WC 1PXWA 5FJ4C 3RA6A 3CCEF 3NK6A 3FFMA 5GANK 5G4UC 3NVIB 5G4VC 1RA4A 3J7AR 2LBWA 1H7MA 5GIOC 1KC8H 3MCAB 3O85A 5GINC 2WALA 3ON1A 3LWOC 1RLGA 5IT9M 1VQNF 1W41A 3E1YA 1VQOF 3WXMB 5GAPK 3CMEF 2OTLF 3J81M 2VGMA 3NVKE 2KG4A 3E20B 4BY9D 1Q7YH 3AGKA 1W40A 3OBYA
chains in the Genus database with same CATH superfamily
4IHJA 4NQ3A 5CB4B 3SIVA 2K1SA 3KHNA 3CCMF 3CYQA 1JN1A 4C8EA 2UYJA 1JD1A 1KNKA 3HKBA 1CN7A 1TUBB 1UFYA 3WPXA 1W5EA 3WJQA 4ZI7B 4BVSA 3CC4F 1X7PA 3KE1A 3JCMM 5CB4A 2PHNA 4YJ3A 3CCQF 4ZOLB 5EB1B 4LCKA 3JAMM 5JQGB 2ZODA 3JALB 1YI2F 5EYPB 1TUBA 4XCQA 5ITZB 3JAWA 1FFXB 3UT5B 2CZWA 3ZOPA 2MQEA 1W2BF 1VQ6F 3I56F 3P10A 3RYIB 5JH7A 5FNVB 1N8RH 5JQGA 1SA0B 4C8IA 3FPIA 5EYPA 3KIZA 1FFXA 4E6EA 1YGYA 3JVHA 4BT4A 5FLXM 4G4ZA 5EZYB 3MBMA 3RYIA 3LWVC 3CCRF 4BT3A 3CYPB 4PWTA 2LCAA 5C8YA 1T0KB 3V7EA 3JARB 1KQSF 3FD5A 1VQLF 3CCVF 5IYZB 5HXZA 3HKCB 4WBNA 1IPAA 2UYKA 5HY1A 2KTVA 5EZYA 5GIPC 5CA0B 4G4YA 3S0HA 3G6EF 3D00A 5BMVB 4U3JA 3JARA 4TUYB 3N2KA 2AIZP 5IYZA 3C9RA 1IV1A 1NJIH 1PF5A 2ZVYA 4ZHQB 2QTPA 4C4WC 1PXWA 5CA0A 4C82A 1VK3A 1FNJA 2CW4A 5G4UC 1FNKA 1COMA 2CVLA 4TUYA 2LBWA 2YYEA 3F0DA 5GIOC 2RHHA 3VYUC 1KC8H 3MCAB 3GTZA 5GINC 1H48A 3LWOC 1RLGA 5IT9M 3JATB 1W41A 3E1YA 3C9TA 2FGYA 4KWEA 1ONIA 3GHZA 3VOAA 5LXTA 1UI9A 1XRGA 2KG4A 3E20B 1DBFA 1Q7YH 1VQVA 3AGKA 4BVTA 2B33A 2GZLA 3ZP7A 5EIBC 4EI8A 5EWRA 3HJWC 4O4LB 4G4WA 4RHAA 3SIUA 3BYQA 1JFFB 2UZHA 2ALEA 4I50B 3QHDA 3D01A 3CC7F 3PLAC 5J2TB 4YJ2B 2VAWA 3LWPC 4B45A 5EAZA 2AIFA 1VHAA 3RYHB 2Z1UA 4IHJB 3F6MA 4BVRA 1IV2A 4DRXB 2IAFA 1VQ4F 4ZHVA 3PAFA 1E7KA 2H6LA 3HKBB 3VI6A 1JFFA 1W5FA 1YJWF 4I50A 5J2TA 4G4VA 2CWJA 3MDOA 2Z1FA 1QVFF 3Q8HA 3RYHA 2HP3A 4M8IA 1W57A 4DRXA 4YJ3B 5EO3A 2HQSC 1SZQA 3IKEA 3JAKB 5AVMA 1FSZA 1JY8A 3JAWB 2W8BC 3RYFA 2VGNA 1X7OA 3S0WA 4BVQA 4R40B 5JH7B 1M90H 3I55F 2PMPA 1Q82H 2ZF8A 3IR9A 3JAKA 4HNAA 3CCSF 1QU9A 2OTMA 4NUTA 3D54A 1IV4A 3MQWA 2BTOA 5EIBD 4EB6B 2HS0A 1X52A 2G9IA 3CCJF 4DXDA 5C8YB 5IJ9A 4B5CA 4O4IB 4X1IB 1YHQF 4FFBB 4WBNB 3LWRC 1K73H 4X3MA 2QA4F 1X25A 4EB6A 4X20A 3CMAF 1KD1H 1U3LA 1W59A 1VH8A 5EB0A 1CLIA 2GVIA 3CCEF 1R1MA 2RHJA 3M4SA 4O4IA 4U3JB 4X1IA 3NVIB 2R751 3N2KB 2ZAUA 4FFBA 3J7AR 3CB2A 1OAPA 3O85A 4BT7A 2V9YA 5HY4A 2HRUA 2HRYA 3KJJA 3CMEF 3ZO8A 2OTLF 4X1KA 2HP0B 5HP7A 3V4DA 2KGWA 4ERHA 3N2GB 1NQ3A 1TVKA 3B6NA 2HVYD 1ODEA 1VQ5F 3V7QA 4EI9A 3VMFB 5LXTB 3WGLA 2HP0A 5GONA 3N2GA 5HP8A 2L26A 3G4SF 5JVDB 3WGMA 4O4HB 5CA1B 3ERNA 1YIJF 1VQ7F 4X1YB 2QI2A 3RYCA 3HKEB 4C81A 2HS3A 3N4ZA 1Q8RA 2CHSA 4BW0B 1RQ2A 3KJKA 3HAXD 3E22A 5JVDA 4O4HA 5CA1A 1XHOA 3WPWA 2FC3A 1VQKF 4X1YA 1M1KH 3NK7A 3CCUF 2LBXA 3HKEA 5MN6A 2QEXF 2VAPA 1K9MH 3OW2F 3GYQA 1DT9A 2ZVZA 3P4EA 3TD3A 3WGJA 3N4YA 3VOBA 2Q1YA 3K14A 1Q81H 1Z5VA 4F6RB 1VQ8F 1KNJA 1RQ7A 4X3LA 4TZZA 4I4TB 3CG6A 4B62A 3RA5A 1GZ0A 2I6DA 5JCOC 1YJNF 3S0YA 3G71F 3S02A 3RYFB 2CSLA 3T80A 3IEQA 3DDNA 3ZP4A 2LBTA 2BTQB 1ZWZA 4F6RA 2CHTA 4O2BB 4HNAB 5HY0A 4I4TA 4EI7A 1XBIA 2RB9A 3VTIC 2DT4A 3F0GA 1Q86H 3ESJA 1XV2A 1QVGF 1YITF 5KMGA 1U40A 2R6R1 2H8EA 4O2BA 3LWQC 5IJ9B 3RA6A 5LYJB 5GANK 2YXZA 3L7QA 2NMUA 3IKFA 3IMPA 3C9SA 4X20B 2WALA 2AMTA 1IV3A 3K2XA 2UYNB 3M84A 1VQOF 3WXMB 5GAPK 3WJRA 1QAHA 5LYJA 1W40A 5HY2A 3OBYA 3K12A 4ZI7A 3HKDB 2GLZA 2UYNA 2EWCA 3NMUC 3F0FA 1VQ9F 3JASB 1W581 1T0AA 2OZBA 4X1KB 2IQQA 3I3FA 1JJ2F 5A2QM 3P0ZA 4ZOLA 3VO8A 5MN5A 1TVKB 2Z01A 3JALA 4IIJB 2F9ZC 5MN4A 5ITZA 4ZHWA 3HKDA 3HWUA 3VIUA 3VYSC 5LP6C 3JASA 3K0TA 3UT5A 4TV8B 1J7HA 3WGNA 3LDTA 2VAMA 5GONB 4BT5A 1W42A 3CPQA 5FNVA 3VCZA 1YJ9F 1SA0A 1W5BA 4O2AB 3FBAA 4RQOA 4IIJA 2IG8A 1NMUB 3MCQA 4NWOB 1S72F 3RYCB 1U3PA 4TV8A 3EORA 2Z1EA 3V3TA 5JCOA 3S03A 1W5AA 3CCLF 1VQPF 1RLUA 3E22B 5IJ0B 1VQMF 4O2AA 3LYBA 5J2UB 1W3EX 3WGKA 3HKCA 3J80M 4LNUB 3TD4A 5HXUA 5LOVB 1OFUA 3RE3A 2OTJF 2VXYA 3FD6A 3S06A 2ZOVA 1K8AH 3OBWA 1CK2A 4B46A 2KTUA 3M1XA 4C8GA 2RHLA 5IJ0A 1GO1A 5J2UA 2P6YA 1GO0A 3LFOA 3CXCF 3CC2F 3LMEA 5BMVA 5KX5B 3C9UA 2OHWA 4LNUA 4ZHYB 2Z1TA 5LOVA 1H47A 5DCVA 2JNBA 3OONA 4ZHQA 4TV9B 3IEWA 4U39A 1YQNA 3VYTC 2Q1XA 2H8CA 3CD6F 1Z5WA 5LA6B 2I6RA 4I55B 1QD9A 3CPWF 5KX5A 3R0PA 2HS4A 4BT2A 1SDSA 2BO1A 5HWEA 5FJ4C 2UYPA 3JATA 4TV9A 3NK6A 3FFMA 3I7TA 1GX1A 4G88A 5G4VC 2DYYA 1RA4A 4I55A 5LA6A 1H7MA 3QUWA 3U0OA 5KMGB 5B8FA 5LP6B 4O4JB 3ON1A 1U43A 1VQNF 3WJPA 3C8LA 3DC2A 4G4XA 1W55A 3F0EA 3J81M 2N48A 2VGMA 4O4LA 3TD5A 3NVKE 4BT6A 3QTYA 2RHOA 4BY9D 3ELCA 4ZK7A 2HX0A 2BTUA 5LP6A 4YJ2A 4O4JA 3HTNA
chains in the Genus database with same CATH topology
5EWRA 2HVYD 1VQ9F 3NMUC 4NQ3A 2OZBA 3SIVA 3HJWC 1VQ5F 3V7QA 3CCMF 4EI9A 1JJ2F 3SIUA 3VMFB 5A2QM 2ALEA 3CC7F 3PLAC 1CN7A 3G4SF 3LWPC 2F9ZC 1YIJF 2AIFA 4BVSA 1VQ7F 3CC4F 4BVRA 1X7PA 2QI2A 1VQ4F 3JCMM 3PAFA 1E7KA 3CCQF 3VI6A 4LCKA 3N4ZA 3JAMM 1YJWF 1W42A 3CPQA 4BW0B 1YJ9F 1YI2F 3HAXD 4XCQA 1QVFF 1NMUB 1S72F 2FC3A 1VQKF 1M1KH 2CZWA 1W2BF 3NK7A 3CCUF 2LBXA 5EO3A 1VQ6F 3I56F 2QEXF 3V3TA 1N8RH 3CCLF 1VQPF 1K9MH 3OW2F 3GYQA 1VQMF 1DT9A 1W3EX 3N4YA 2VGNA 1X7OA 1Q81H 1VQ8F 5FLXM 3J80M 4BVQA 5HXUA 2OTJF 1M90H 3I55F 4X3LA 1Q82H 3IR9A 3LWVC 3CCRF 4TZZA 1K8AH 3OBWA 3CG6A 1CK2A 3RA5A 1GZ0A 2I6DA 2KTUA 3CCSF 3G71F 1YJNF 1T0KB 3V7EA 1GO1A 1GO0A 1VQLF 3LFOA 4NUTA 1KQSF 3CXCF 3CC2F 3CCVF 5HXZA 1IPAA 1ZWZA 2OHWA 5HY1A 2KTVA 1X52A 5GIPC 3CCJF 5HY0A 5DCVA 2JNBA 4EI7A 1XBIA 1YHQF 3G6EF 3CD6F 1Q86H 3D00A 3LWRC 1QVGF 1K73H 3CPWF 4X3MA 1NJIH 1YITF 2QA4F 1SDSA 3LWQC 3CMAF 1KD1H 2BO1A 5HWEA 4C4WC 1PXWA 5FJ4C 3RA6A 3CCEF 3NK6A 3FFMA 5GANK 5G4UC 3NVIB 5G4VC 1RA4A 3J7AR 2LBWA 1H7MA 5GIOC 1KC8H 3MCAB 3O85A 5GINC 2WALA 3ON1A 3LWOC 5HY4A 1RLGA 5IT9M 1VQNF 1W41A 3E1YA 1VQOF 3WXMB 2FGYA 5GAPK 3CMEF 2OTLF 3J81M 2VGMA 3NVKE 2KG4A 3E20B 4BY9D 1Q7YH 3AGKA 4BVTA 1W40A 5HY2A 3OBYA 2GLZA 4EI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWR A;  2HVY D;  1VQ9 F;  3NMU C;  2OZB A;  3SIV A;  3HJW C;  1VQ5 F;  3V7Q A;  3CCM F;  1JJ2 F;  3SIU A;  3VMF B;  5A2Q M;  2ALE A;  3CC7 F;  3PLA C;  1CN7 A;  3G4S F;  3LWP C;  1YIJ F;  2AIF A;  3CC4 F;  1VQ7 F;  1X7P A;  2QI2 A;  1VQ4 F;  3JCM M;  3PAF A;  1E7K A;  3CCQ F;  3VI6 A;  4LCK A;  3N4Z A;  3JAM M;  1YJW F;  1W42 A;  3CPQ A;  4BW0 B;  1YJ9 F;  1YI2 F;  3HAX D;  1QVF F;  1NMU B;  1S72 F;  2FC3 A;  1VQK F;  1M1K H;  2CZW A;  1W2B F;  3NK7 A;  3CCU F;  2LBX A;  5EO3 A;  1VQ6 F;  3I56 F;  2QEX F;  1N8R H;  3CCL F;  1VQP F;  1K9M H;  3OW2 F;  3GYQ A;  1VQM F;  1DT9 A;  1W3E X;  3N4Y A;  2VGN A;  1X7O A;  1Q81 H;  1VQ8 F;  5FLX M;  3J80 M;  2OTJ F;  1M90 H;  3I55 F;  4X3L A;  1Q82 H;  3IR9 A;  3LWV C;  3CCR F;  4TZZ A;  1K8A H;  3OBW A;  3CG6 A;  1CK2 A;  3RA5 A;  1GZ0 A;  2I6D A;  2KTU A;  3CCS F;  3G71 F;  1YJN F;  1T0K B;  3V7E A;  1GO1 A;  1GO0 A;  1VQL F;  3LFO A;  4NUT A;  1KQS F;  3CXC F;  3CC2 F;  3CCV F;  1IPA A;  1ZWZ A;  2OHW A;  2KTV A;  1X52 A;  5GIP C;  3CCJ F;  5DCV A;  2JNB A;  1XBI A;  1YHQ F;  3G6E F;  3CD6 F;  1Q86 H;  3LWR C;  1QVG F;  1K73 H;  3CPW F;  4X3M A;  1NJI H;  1YIT F;  2QA4 F;  1SDS A;  3LWQ C;  3CMA F;  1KD1 H;  2BO1 A;  4C4W C;  1PXW A;  5FJ4 C;  3RA6 A;  3CCE F;  3NK6 A;  3FFM A;  5GAN K;  5G4U C;  3NVI B;  5G4V C;  1RA4 A;  3J7A R;  2LBW A;  1H7M A;  5GIO C;  1KC8 H;  3MCA B;  3O85 A;  5GIN C;  2WAL A;  3ON1 A;  3LWO C;  1RLG A;  5IT9 M;  1VQN F;  1W41 A;  3E1Y A;  1VQO F;  3WXM B;  5GAP K;  3CME F;  2OTL F;  3J81 M;  2VGM A;  3NVK E;  2KG4 A;  3E20 B;  4BY9 D;  1Q7Y H;  3AGK A;  1W40 A;  3OBY A; 
#chains in the Genus database with same CATH topology
 4IHJ A;  4NQ3 A;  5CB4 B;  3SIV A;  2K1S A;  3KHN A;  3CCM F;  3CYQ A;  1JN1 A;  4C8E A;  2UYJ A;  1JD1 A;  1KNK A;  3HKB A;  1CN7 A;  1TUB B;  1UFY A;  3WPX A;  1W5E A;  3WJQ A;  4ZI7 B;  4BVS A;  3CC4 F;  1X7P A;  3KE1 A;  3JCM M;  5CB4 A;  2PHN A;  4YJ3 A;  3CCQ F;  4ZOL B;  5EB1 B;  4LCK A;  3JAM M;  5JQG B;  2ZOD A;  3JAL B;  1YI2 F;  5EYP B;  1TUB A;  4XCQ A;  5ITZ B;  3JAW A;  1FFX B;  3UT5 B;  2CZW A;  3ZOP A;  2MQE A;  1W2B F;  1VQ6 F;  3I56 F;  3P10 A;  3RYI B;  5JH7 A;  5FNV B;  1N8R H;  5JQG A;  1SA0 B;  4C8I A;  3FPI A;  5EYP A;  3KIZ A;  1FFX A;  4E6E A;  1YGY A;  3JVH A;  4BT4 A;  5FLX M;  4G4Z A;  5EZY B;  3MBM A;  3RYI A;  3LWV C;  3CCR F;  4BT3 A;  3CYP B;  4PWT A;  2LCA A;  5C8Y A;  1T0K B;  3V7E A;  3JAR B;  1KQS F;  3FD5 A;  1VQL F;  3CCV F;  5IYZ B;  5HXZ A;  3HKC B;  4WBN A;  1IPA A;  2UYK A;  5HY1 A;  2KTV A;  5EZY A;  5GIP C;  5CA0 B;  4G4Y A;  3S0H A;  3G6E F;  3D00 A;  5BMV B;  4U3J A;  3JAR A;  4TUY B;  3N2K A;  2AIZ P;  5IYZ A;  3C9R A;  1IV1 A;  1NJI H;  1PF5 A;  2ZVY A;  4ZHQ B;  2QTP A;  4C4W C;  1PXW A;  5CA0 A;  4C82 A;  1VK3 A;  1FNJ A;  2CW4 A;  5G4U C;  1FNK A;  1COM A;  2CVL A;  4TUY A;  2LBW A;  2YYE A;  3F0D A;  5GIO C;  2RHH A;  3VYU C;  1KC8 H;  3MCA B;  3GTZ A;  5GIN C;  1H48 A;  3LWO C;  1RLG A;  5IT9 M;  3JAT B;  1W41 A;  3E1Y A;  3C9T A;  2FGY A;  4KWE A;  1ONI A;  3GHZ A;  3VOA A;  5LXT A;  1UI9 A;  1XRG A;  2KG4 A;  3E20 B;  1DBF A;  1Q7Y H;  1VQV A;  3AGK A;  4BVT A;  2B33 A;  2GZL A;  3ZP7 A;  5EIB C;  4EI8 A;  5EWR A;  3HJW C;  4O4L B;  4G4W A;  4RHA A;  3SIU A;  3BYQ A;  1JFF B;  2UZH A;  2ALE A;  4I50 B;  3QHD A;  3D01 A;  3CC7 F;  3PLA C;  5J2T B;  4YJ2 B;  2VAW A;  3LWP C;  4B45 A;  5EAZ A;  2AIF A;  1VHA A;  3RYH B;  2Z1U A;  4IHJ B;  3F6M A;  4BVR A;  1IV2 A;  4DRX B;  2IAF A;  1VQ4 F;  4ZHV A;  3PAF A;  1E7K A;  2H6L A;  3HKB B;  3VI6 A;  1JFF A;  1W5F A;  1YJW F;  4I50 A;  5J2T A;  4G4V A;  2CWJ A;  3MDO A;  2Z1F A;  1QVF F;  3Q8H A;  3RYH A;  2HP3 A;  4M8I A;  1W57 A;  4DRX A;  4YJ3 B;  5EO3 A;  2HQS C;  1SZQ A;  3IKE A;  3JAK B;  5AVM A;  1FSZ A;  1JY8 A;  3JAW B;  2W8B C;  3RYF A;  2VGN A;  1X7O A;  3S0W A;  4BVQ A;  4R40 B;  5JH7 B;  1M90 H;  3I55 F;  2PMP A;  1Q82 H;  2ZF8 A;  3IR9 A;  3JAK A;  4HNA A;  3CCS F;  1QU9 A;  2OTM A;  4NUT A;  3D54 A;  1IV4 A;  3MQW A;  2BTO A;  5EIB D;  4EB6 B;  2HS0 A;  1X52 A;  2G9I A;  3CCJ F;  4DXD A;  5C8Y B;  5IJ9 A;  4B5C A;  4O4I B;  4X1I B;  1YHQ F;  4FFB B;  4WBN B;  3LWR C;  1K73 H;  4X3M A;  2QA4 F;  1X25 A;  4EB6 A;  4X20 A;  3CMA F;  1KD1 H;  1U3L A;  1W59 A;  1VH8 A;  5EB0 A;  1CLI A;  2GVI A;  3CCE F;  1R1M A;  2RHJ A;  3M4S A;  4O4I A;  4U3J B;  4X1I A;  3NVI B;  2R75 1;  3N2K B;  2ZAU A;  4FFB A;  3J7A R;  3CB2 A;  1OAP A;  3O85 A;  4BT7 A;  2V9Y A;  5HY4 A;  2HRU A;  2HRY A;  3KJJ A;  3CME F;  3ZO8 A;  2OTL F;  4X1K A;  2HP0 B;  5HP7 A;  3V4D A;  2KGW A;  4ERH A;  3N2G B;  1NQ3 A;  1TVK A;  3B6N A;  2HVY D;  1ODE A;  1VQ5 F;  3V7Q A;  4EI9 A;  3VMF B;  5LXT B;  3WGL A;  2HP0 A;  5GON A;  3N2G A;  5HP8 A;  2L26 A;  3G4S F;  5JVD B;  3WGM A;  4O4H B;  5CA1 B;  3ERN A;  1YIJ F;  1VQ7 F;  4X1Y B;  2QI2 A;  3RYC A;  3HKE B;  4C81 A;  2HS3 A;  3N4Z A;  1Q8R A;  2CHS A;  4BW0 B;  1RQ2 A;  3KJK A;  3HAX D;  3E22 A;  5JVD A;  4O4H A;  5CA1 A;  1XHO A;  3WPW A;  2FC3 A;  1VQK F;  4X1Y A;  1M1K H;  3NK7 A;  3CCU F;  2LBX A;  3HKE A;  5MN6 A;  2QEX F;  2VAP A;  1K9M H;  3OW2 F;  3GYQ A;  1DT9 A;  2ZVZ A;  3P4E A;  3TD3 A;  3WGJ A;  3N4Y A;  3VOB A;  2Q1Y A;  3K14 A;  1Q81 H;  1Z5V A;  4F6R B;  1VQ8 F;  1KNJ A;  1RQ7 A;  4X3L A;  4TZZ A;  4I4T B;  3CG6 A;  4B62 A;  3RA5 A;  1GZ0 A;  2I6D A;  5JCO C;  1YJN F;  3S0Y A;  3G71 F;  3S02 A;  3RYF B;  2CSL A;  3T80 A;  3IEQ A;  3DDN A;  3ZP4 A;  2LBT A;  2BTQ B;  1ZWZ A;  4F6R A;  2CHT A;  4O2B B;  4HNA B;  5HY0 A;  4I4T A;  4EI7 A;  1XBI A;  2RB9 A;  3VTI C;  2DT4 A;  3F0G A;  1Q86 H;  3ESJ A;  1XV2 A;  1QVG F;  1YIT F;  5KMG A;  1U40 A;  2R6R 1;  2H8E A;  4O2B A;  3LWQ C;  5IJ9 B;  3RA6 A;  5LYJ B;  5GAN K;  2YXZ A;  3L7Q A;  2NMU A;  3IKF A;  3IMP A;  3C9S A;  4X20 B;  2WAL A;  2AMT A;  1IV3 A;  3K2X A;  2UYN B;  3M84 A;  1VQO F;  3WXM B;  5GAP K;  3WJR A;  1QAH A;  5LYJ A;  1W40 A;  5HY2 A;  3OBY A;  3K12 A;  4ZI7 A;  3HKD B;  2GLZ A;  2UYN A;  2EWC A;  3NMU C;  3F0F A;  1VQ9 F;  3JAS B;  1W58 1;  1T0A A;  2OZB A;  4X1K B;  2IQQ A;  3I3F A;  1JJ2 F;  5A2Q M;  3P0Z A;  4ZOL A;  3VO8 A;  5MN5 A;  1TVK B;  2Z01 A;  3JAL A;  4IIJ B;  2F9Z C;  5MN4 A;  5ITZ A;  4ZHW A;  3HKD A;  3HWU A;  3VIU A;  3VYS C;  5LP6 C;  3JAS A;  3K0T A;  3UT5 A;  4TV8 B;  1J7H A;  3WGN A;  3LDT A;  2VAM A;  5GON B;  4BT5 A;  1W42 A;  3CPQ A;  5FNV A;  3VCZ A;  1YJ9 F;  1SA0 A;  1W5B A;  4O2A B;  3FBA A;  4RQO A;  4IIJ A;  2IG8 A;  1NMU B;  3MCQ A;  4NWO B;  1S72 F;  3RYC B;  1U3P A;  4TV8 A;  3EOR A;  2Z1E A;  3V3T A;  5JCO A;  3S03 A;  1W5A A;  3CCL F;  1VQP F;  1RLU A;  3E22 B;  5IJ0 B;  1VQM F;  4O2A A;  3LYB A;  5J2U B;  1W3E X;  3WGK A;  3HKC A;  3J80 M;  4LNU B;  3TD4 A;  5HXU A;  5LOV B;  1OFU A;  3RE3 A;  2OTJ F;  2VXY A;  3FD6 A;  3S06 A;  2ZOV A;  1K8A H;  3OBW A;  1CK2 A;  4B46 A;  2KTU A;  3M1X A;  4C8G A;  2RHL A;  5IJ0 A;  1GO1 A;  5J2U A;  2P6Y A;  1GO0 A;  3LFO A;  3CXC F;  3CC2 F;  3LME A;  5BMV A;  5KX5 B;  3C9U A;  2OHW A;  4LNU A;  4ZHY B;  2Z1T A;  5LOV A;  1H47 A;  5DCV A;  2JNB A;  3OON A;  4ZHQ A;  4TV9 B;  3IEW A;  4U39 A;  1YQN A;  3VYT C;  2Q1X A;  2H8C A;  3CD6 F;  1Z5W A;  5LA6 B;  2I6R A;  4I55 B;  1QD9 A;  3CPW F;  5KX5 A;  3R0P A;  2HS4 A;  4BT2 A;  1SDS A;  2BO1 A;  5HWE A;  5FJ4 C;  2UYP A;  3JAT A;  4TV9 A;  3NK6 A;  3FFM A;  3I7T A;  1GX1 A;  4G88 A;  5G4V C;  2DYY A;  1RA4 A;  4I55 A;  5LA6 A;  1H7M A;  3QUW A;  3U0O A;  5KMG B;  5B8F A;  5LP6 B;  4O4J B;  3ON1 A;  1U43 A;  1VQN F;  3WJP A;  3C8L A;  3DC2 A;  4G4X A;  1W55 A;  3F0E A;  3J81 M;  2N48 A;  2VGM A;  4O4L A;  3TD5 A;  3NVK E;  4BT6 A;  3QTY A;  2RHO A;  4BY9 D;  3ELC A;  4ZK7 A;  2HX0 A;  2BTU A;  5LP6 A;  4YJ2 A;  4O4J A;  3HTN A; 
#chains in the Genus database with same CATH homology
 5EWR A;  2HVY D;  1VQ9 F;  3NMU C;  4NQ3 A;  2OZB A;  3SIV A;  3HJW C;  1VQ5 F;  3V7Q A;  3CCM F;  4EI9 A;  1JJ2 F;  3SIU A;  3VMF B;  5A2Q M;  2ALE A;  3CC7 F;  3PLA C;  1CN7 A;  3G4S F;  3LWP C;  2F9Z C;  1YIJ F;  2AIF A;  4BVS A;  1VQ7 F;  3CC4 F;  4BVR A;  1X7P A;  2QI2 A;  1VQ4 F;  3JCM M;  3PAF A;  1E7K A;  3CCQ F;  3VI6 A;  4LCK A;  3N4Z A;  3JAM M;  1YJW F;  1W42 A;  3CPQ A;  4BW0 B;  1YJ9 F;  1YI2 F;  3HAX D;  4XCQ A;  1QVF F;  1NMU B;  1S72 F;  2FC3 A;  1VQK F;  1M1K H;  2CZW A;  1W2B F;  3NK7 A;  3CCU F;  2LBX A;  5EO3 A;  1VQ6 F;  3I56 F;  2QEX F;  3V3T A;  1N8R H;  3CCL F;  1VQP F;  1K9M H;  3OW2 F;  3GYQ A;  1VQM F;  1DT9 A;  1W3E X;  3N4Y A;  2VGN A;  1X7O A;  1Q81 H;  1VQ8 F;  5FLX M;  3J80 M;  4BVQ A;  5HXU A;  2OTJ F;  1M90 H;  3I55 F;  4X3L A;  1Q82 H;  3IR9 A;  3LWV C;  3CCR F;  4TZZ A;  1K8A H;  3OBW A;  3CG6 A;  1CK2 A;  3RA5 A;  1GZ0 A;  2I6D A;  2KTU A;  3CCS F;  3G71 F;  1YJN F;  1T0K B;  3V7E A;  1GO1 A;  1GO0 A;  1VQL F;  3LFO A;  4NUT A;  1KQS F;  3CXC F;  3CC2 F;  3CCV F;  5HXZ A;  1IPA A;  1ZWZ A;  2OHW A;  5HY1 A;  2KTV A;  1X52 A;  5GIP C;  3CCJ F;  5HY0 A;  5DCV A;  2JNB A;  4EI7 A;  1XBI A;  1YHQ F;  3G6E F;  3CD6 F;  1Q86 H;  3D00 A;  3LWR C;  1QVG F;  1K73 H;  3CPW F;  4X3M A;  1NJI H;  1YIT F;  2QA4 F;  1SDS A;  3LWQ C;  3CMA F;  1KD1 H;  2BO1 A;  5HWE A;  4C4W C;  1PXW A;  5FJ4 C;  3RA6 A;  3CCE F;  3NK6 A;  3FFM A;  5GAN K;  5G4U C;  3NVI B;  5G4V C;  1RA4 A;  3J7A R;  2LBW A;  1H7M A;  5GIO C;  1KC8 H;  3MCA B;  3O85 A;  5GIN C;  2WAL A;  3ON1 A;  3LWO C;  5HY4 A;  1RLG A;  5IT9 M;  1VQN F;  1W41 A;  3E1Y A;  1VQO F;  3WXM B;  2FGY A;  5GAP K;  3CME F;  2OTL F;  3J81 M;  2VGM A;  3NVK E;  2KG4 A;  3E20 B;  4BY9 D;  1Q7Y H;  3AGK A;  4BVT A;  1W40 A;  5HY2 A;  3OBY A;  2GLZ A;  4EI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...