1OAPA

Mad structure of the periplasmique domain of the escherichia coli pal protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
QQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords PEPTIDOGLYCAN-ASSOCIATED LIPOPROTEIN
publication title Crystallization and Preliminary Crystallographic Study of the Peptidoglycan-Associated Lipoprotein from Escherichia Coli.
pubmed rcsb
source organism Escherichia coli
total genus 40
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1oapA00
1R1MA 3OONA 4G4ZA 4PWTA 1OAPA 2ZF8A 4G4YA 3IMPA 4G4XA 3KHNA 2ZOVA 4G88A 2W8BC 2N48A 2ZVZA 3S0WA 3WPWA 2L26A 2MQEA 4ZHWA 3LDTA 3CYQA 4B62A 2HQSC 3CYPB 3WPXA 4ZHVA 3S03A 2AIZP 4ERHA 5EB1B 2K1SA 2KGWA 4G4WA 3S02A 3S0HA 3TD5A 3TD3A 3S06A 3TD4A 4ZHYB 4R40B 2ZVYA 2LBTA 4RHAA 5EAZA 4B5CA 3S0YA 2LCAA 4G4VA 5EB0A
chains in the Genus database with same CATH superfamily
4X1IA 5GAPK 4X20A 1ODEA 3C9RA 5HY4A 3F0GA 3WPWA 3KJJA 2YXZA 3IEWA 3CC7F 3IKFA 3JAKA 4BT3A 4XCQA 3ESJA 1FNJA 4O4HA 2VAWA 2HP0A 1VQ5F 3G6EF 5IJ9B 5CB4A 3TD4A 1UFYA 2CHTA 2RB9A 4EI7A 2Q1YA 5GIOC 1SA0B 3SIUA 3K12A 5GANK 4TUYB 3JARB 3G71F 2KG4A 5HWEA 3HWUA 4BT2A 2PHNA 3N4ZA 1GX1A 1FNKA 1XHOA 2Z1UA 2B33A 3IR9A 3JATA 3KE1A 4BT7A 1U40A 2L26A 5KX5A 1VQKF 3NVIB 3ZOPA 3SIVA 3CYPB 4TV8B 1FFXB 3S02A 1IV4A 3F0EA 5LP6B 5C8YB 1E7KA 1W5EA 3TD5A 2Z1EA 3J81M 2UYJA 5EYPB 3C8LA 2OTMA 3D00A 2LBTA 3CPQA 3RYHB 3U0OA 4X1IB 4PWTA 4X20B 2ZF8A 2OHWA 3C9TA 4G88A 2ZOVA 3JALA 5J2TA 1GZ0A 2VAMA 3VO8A 5IYZA 3NK7A 2HQSC 3WJPA 3LMEA 2RHHA 2FGYA 4ZI7A 1Q81H 3IKEA 5MN4A 4O4HB 2HP0B 2QEXF 3E22A 2ZODA 4X1KA 3C9UA 5CB4B 3VMFB 5GINC 4O2AB 4YJ3A 4R40B 3UT5A 3CCMF 5JH7B 3IEQA 1QU9A 1X7PA 5HP7A 1YQNA 2BTQB 1YIJF 3OONA 3RE3A 1QVFF 3FBAA 1OAPA 1ZWZA 4F6RB 5HY2A 1UI9A 5AVMA 3AGKA 2G9IA 3KIZA 1JJ2F 3JATB 3LWVC 3GTZA 1Q7YH 5KX5B 3CC2F 3N2GB 1XBIA 3VIUA 3K14A 3CCUF 2H8EA 2CW4A 2P6YA 5EB1B 1U3LA 4IIJB 2K1SA 3VCZA 1NQ3A 5HP8A 4C82A 4O2BA 2IAFA 3J80M 2H8CA 4ZHYB 1KNKA 3O85A 4TUYA 4RHAA 2V9YA 3S0YA 1PXWA 3I56F 3PLAC 3WJQA 4ZOLA 3ZP4A 3JAWA 4ZK7A 1QAHA 1W40A 2MQEA 2UYNA 3T80A 3HKEA 1RQ2A 5IYZB 1FSZA 2HS0A 4BT6A 4ERHA 3C9SA 3E22B 3CCRF 1RQ7A 4IHJB 1N8RH 1VQLF 4X1KB 2H6LA 1COMA 3P0ZA 3WGNA 5BMVA 3UT5B 1W42A 1Z5VA 3ZO8A 2HRUA 4NUTA 3HKBB 3PAFA 2NMUA 1TVKA 4LNUB 3HKCA 5FNVB 1VHAA 1VQ7F 3CB2A 4RQOA 2I6DA 3N4YA 3VOBA 4U39A 1YITF 3CCJF 3VYSC 4ZHVA 1VK3A 4G4WA 5DCVA 3FD5A 4BVSA 2HRYA 2RHJA 1W2BF 3FPIA 2YYEA 3TD3A 5KMGB 5JCOA 4O2BB 2IQQA 3JVHA 1TUBA 5MN5A 1W41A 2DYYA 4O2AA 4BT4A 2QTPA 3KJKA 4C8GA 1VQPF 3R0PA 2OZBA 5JH7A 3QHDA 1W5AA 2WALA 1S72F 5LA6A 2ALEA 1KNJA 4ZOLB 5G4VC 4F6RA 2I6RA 3JAWB 1YJWF 2LBXA 4LCKA 2UYNB 3HKEB 4I55B 1VQ8F 3N2GA 4IIJA 5HXZA 3M1XA 2F9ZC 5G4UC 1M90H 1SZQA 1QD9A 5LYJB 5LOVA 2ZVYA 5EAZA 5BMVB 5HY1A 2UYKA 4G4VA 5EB0A 2HS4A 1TVKB 1X52A 3HKCB 1YJNF 1CK2A 4C81A 1W581 3E20B 3ON1A 4C8IA 3CCVF 3P4EA 3RA6A 5CA0B 1Q86H 2AIFA 5EWRA 4IHJA 1CLIA 1PF5A 4B46A 1VH8A 1SDSA 1TUBB 3HAXD 3VOAA 1DT9A 4B5CA 3CMAF 1Z5WA 2LCAA 3WGKA 2OTLF 1K9MH 1VQ9F 5LA6B 3HKBA 4G4ZA 3HKDA 1JN1A 3D54A 2CVLA 4LNUA 5FNVA 1H48A 4YJ2A 2OTJF 5FLXM 3DC2A 1GO1A 3GYQA 3ELCA 4O4IA 3I55F 1VQ4F 2FC3A 1KD1H 1W5BA 2LBWA 1K8AH 1OFUA 3S06A 5KMGA 2GVIA 1IV2A 1X25A 1W57A 3F6MA 5LOVB 5GONA 3CMEF 5FJ4C 4I4TA 1W3EX 4EI8A 3JASA 2R751 2QA4F 3IMPA 3M84A 3KHNA 5MN6A 2N48A 3WXMB 3OBWA 4ZHWA 4HNAA 3BYQA 3MDOA 3QUWA 4I55A 3EORA 2UZHA 2HVYD 4X3MA 4BT5A 1RLGA 3HTNA 1Q8RA 3M4SA 4NQ3A 5LYJA 4WBNA 3G4SF 3I3FA 2HP3A 3MCAB 4O4JA 3F0FA 5ITZA 2BTOA 2CSLA 3RYFB 3HKDB 3LWOC 4KWEA 2IG8A 4I50B 4M8IA 4YJ2B 4X1YA 4BW0B 5JQGB 2VAPA 2VGNA 3LFOA 2EWCA 2VGMA 1KC8H 3CXCF 3LWPC 2BO1A 5EZYA 4O4IB 3I7TA 1T0KB 2Z1FA 5CA0A 2VXYA 4TV9A 3P10A 5HY0A 3MBMA 5GIPC 3VYTC 3V4DA 2JNBA 1QVGF 3Q8HA 5GONB 4ZHQA 4C8EA 4I4TB 1XRGA 3WGLA 3JASB 4G4YA 3OW2F 5CA1A 3CG6A 1X7OA 3WJRA 5JVDB 5LXTA 1RA4A 1VQ6F 3S0WA 4HNAB 1U43A 2R6R1 5IJ0A 5B8FA 1Q82H 1JD1A 3VTIC 1YJ9F 1M1KH 5EIBD 2KGWA 3RYIB 2RHLA 2HS3A 3RYCA 1ONIA 3LWRC 1NMUB 4WBNB 2QI2A 3ERNA 3N2KA 4U3JA 1CN7A 3NMUC 3LWQC 3CC4F 1R1MA 2RHOA 1W55A 2HX0A 4O4JB 5ITZB 2Z1TA 3J7AR 5J2UB 4BVRA 1KQSF 4X1YB 3OBYA 3CYQA 4DRXB 4NWOB 2Q1XA 3F0DA 1IV3A 5EZYB 3S0HA 1YGYA 3CD6F 3CCEF 4DXDA 4TV9B 1T0AA 5EIBC 3E1YA 3CCSF 4ZHQB 4O4LA 1JFFA 1VQNF 3RYFA 5CA1B 4FFBA 2W8BC 4I50A 3CCLF 5LXTB 1W5FA 2GZLA 1U3PA 5JQGA 5IJ0B 3NVKE 1XV2A 3JAKB 3RA5A 3NK6A 3WPXA 3S03A 4C4WC 4BVTA 1IPAA 1VQMF 4EI9A 3CPWF 3V7EA 3RYCB 1J7HA 4EB6A 2DT4A 2ZAUA 1RLUA 3VI6A 5IT9M 1VQVA 4TZZA 1H47A 3ZP7A 1JY8A 5HXUA 3N2KB 4U3JB 5LP6C 3FD6A 2CZWA 4E6EA 1NJIH 4G4XA 3B6NA 3WGJA 3QTYA 2ZVZA 3FFMA 5A2QM 5JVDA 1YI2F 3LDTA 4B62A 2BTUA 2AIZP 1VQOF 2AMTA 2KTUA 3RYIA 5IJ9A 2Z01A 3V7QA 2CWJA 1K73H 3D01A 3MCQA 3V3TA 1SA0A 3DDNA 2KTVA 2PMPA 3JCMM 3JARA 3CCQF 5JCOC 4O4LB 3K2XA 1JFFB 2CHSA 3JAMM 3JALB 5J2TB 4BY9D 1GO0A 4X3LA 4FFBB 5J2UA 1W59A 4B45A 4TV8A 1FFXA 4DRXA 4ZI7B 2UYPA 2GLZA 5C8YA 5LP6A 3HJWC 4BVQA 3VYUC 5EYPA 4EB6B 4YJ3B 5EO3A 3L7QA 1H7MA 1DBFA 1IV1A 1YHQF 3WGMA 3LYBA 3RYHA 3MQWA 3GHZA 3K0TA
chains in the Genus database with same CATH topology
1R1MA 3OONA 4G4ZA 4PWTA 1OAPA 2ZF8A 4G4YA 3IMPA 4G4XA 3KHNA 2ZOVA 4G88A 2W8BC 2N48A 2ZVZA 3S0WA 3WPWA 2L26A 2MQEA 4ZHWA 3LDTA 3CYQA 4B62A 2HQSC 3CYPB 3WPXA 4ZHVA 3S03A 2AIZP 4ERHA 5EB1B 2K1SA 2KGWA 4G4WA 3S02A 3S0HA 3TD5A 3TD3A 3S06A 3TD4A 4ZHYB 4R40B 2ZVYA 2LBTA 4RHAA 5EAZA 4B5CA 3S0YA 2LCAA 4G4VA 5EB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1M A;  3OON A;  4G4Z A;  4PWT A;  1OAP A;  2ZF8 A;  4G4Y A;  3IMP A;  4G4X A;  3KHN A;  2ZOV A;  4G88 A;  2W8B C;  2N48 A;  2ZVZ A;  3S0W A;  3WPW A;  2L26 A;  2MQE A;  4ZHW A;  3LDT A;  3CYQ A;  4B62 A;  2HQS C;  3CYP B;  3WPX A;  4ZHV A;  3S03 A;  2AIZ P;  4ERH A;  5EB1 B;  2K1S A;  2KGW A;  4G4W A;  3S02 A;  3S0H A;  3TD5 A;  3TD3 A;  3S06 A;  3TD4 A;  4ZHY B;  4R40 B;  2ZVY A;  2LBT A;  4RHA A;  5EAZ A;  4B5C A;  3S0Y A;  2LCA A;  4G4V A;  5EB0 A; 
#chains in the Genus database with same CATH topology
 4X1I A;  5GAP K;  4X20 A;  1ODE A;  3C9R A;  5HY4 A;  3F0G A;  3WPW A;  3KJJ A;  2YXZ A;  3IEW A;  3CC7 F;  3IKF A;  3JAK A;  4BT3 A;  4XCQ A;  3ESJ A;  1FNJ A;  4O4H A;  2VAW A;  2HP0 A;  1VQ5 F;  3G6E F;  5IJ9 B;  5CB4 A;  3TD4 A;  1UFY A;  2CHT A;  2RB9 A;  4EI7 A;  2Q1Y A;  5GIO C;  1SA0 B;  3SIU A;  3K12 A;  5GAN K;  4TUY B;  3JAR B;  3G71 F;  2KG4 A;  5HWE A;  3HWU A;  4BT2 A;  2PHN A;  3N4Z A;  1GX1 A;  1FNK A;  1XHO A;  2Z1U A;  2B33 A;  3IR9 A;  3JAT A;  3KE1 A;  4BT7 A;  1U40 A;  2L26 A;  5KX5 A;  1VQK F;  3NVI B;  3ZOP A;  3SIV A;  3CYP B;  4TV8 B;  1FFX B;  3S02 A;  1IV4 A;  3F0E A;  5LP6 B;  5C8Y B;  1E7K A;  1W5E A;  3TD5 A;  2Z1E A;  3J81 M;  2UYJ A;  5EYP B;  3C8L A;  2OTM A;  3D00 A;  2LBT A;  3CPQ A;  3RYH B;  3U0O A;  4X1I B;  4PWT A;  4X20 B;  2ZF8 A;  2OHW A;  3C9T A;  4G88 A;  2ZOV A;  3JAL A;  5J2T A;  1GZ0 A;  2VAM A;  3VO8 A;  5IYZ A;  3NK7 A;  2HQS C;  3WJP A;  3LME A;  2RHH A;  2FGY A;  4ZI7 A;  1Q81 H;  3IKE A;  5MN4 A;  4O4H B;  2HP0 B;  2QEX F;  3E22 A;  2ZOD A;  4X1K A;  3C9U A;  5CB4 B;  3VMF B;  5GIN C;  4O2A B;  4YJ3 A;  4R40 B;  3UT5 A;  3CCM F;  5JH7 B;  3IEQ A;  1QU9 A;  1X7P A;  5HP7 A;  1YQN A;  2BTQ B;  1YIJ F;  3OON A;  3RE3 A;  1QVF F;  3FBA A;  1OAP A;  1ZWZ A;  4F6R B;  5HY2 A;  1UI9 A;  5AVM A;  3AGK A;  2G9I A;  3KIZ A;  1JJ2 F;  3JAT B;  3LWV C;  3GTZ A;  1Q7Y H;  5KX5 B;  3CC2 F;  3N2G B;  1XBI A;  3VIU A;  3K14 A;  3CCU F;  2H8E A;  2CW4 A;  2P6Y A;  5EB1 B;  1U3L A;  4IIJ B;  2K1S A;  3VCZ A;  1NQ3 A;  5HP8 A;  4C82 A;  4O2B A;  2IAF A;  3J80 M;  2H8C A;  4ZHY B;  1KNK A;  3O85 A;  4TUY A;  4RHA A;  2V9Y A;  3S0Y A;  1PXW A;  3I56 F;  3PLA C;  3WJQ A;  4ZOL A;  3ZP4 A;  3JAW A;  4ZK7 A;  1QAH A;  1W40 A;  2MQE A;  2UYN A;  3T80 A;  3HKE A;  1RQ2 A;  5IYZ B;  1FSZ A;  2HS0 A;  4BT6 A;  4ERH A;  3C9S A;  3E22 B;  3CCR F;  1RQ7 A;  4IHJ B;  1N8R H;  1VQL F;  4X1K B;  2H6L A;  1COM A;  3P0Z A;  3WGN A;  5BMV A;  3UT5 B;  1W42 A;  1Z5V A;  3ZO8 A;  2HRU A;  4NUT A;  3HKB B;  3PAF A;  2NMU A;  1TVK A;  4LNU B;  3HKC A;  5FNV B;  1VHA A;  1VQ7 F;  3CB2 A;  4RQO A;  2I6D A;  3N4Y A;  3VOB A;  4U39 A;  1YIT F;  3CCJ F;  3VYS C;  4ZHV A;  1VK3 A;  4G4W A;  5DCV A;  3FD5 A;  4BVS A;  2HRY A;  2RHJ A;  1W2B F;  3FPI A;  2YYE A;  3TD3 A;  5KMG B;  5JCO A;  4O2B B;  2IQQ A;  3JVH A;  1TUB A;  5MN5 A;  1W41 A;  2DYY A;  4O2A A;  4BT4 A;  2QTP A;  3KJK A;  4C8G A;  1VQP F;  3R0P A;  2OZB A;  5JH7 A;  3QHD A;  1W5A A;  2WAL A;  1S72 F;  5LA6 A;  2ALE A;  1KNJ A;  4ZOL B;  5G4V C;  4F6R A;  2I6R A;  3JAW B;  1YJW F;  2LBX A;  4LCK A;  2UYN B;  3HKE B;  4I55 B;  1VQ8 F;  3N2G A;  4IIJ A;  5HXZ A;  3M1X A;  2F9Z C;  5G4U C;  1M90 H;  1SZQ A;  1QD9 A;  5LYJ B;  5LOV A;  2ZVY A;  5EAZ A;  5BMV B;  5HY1 A;  2UYK A;  4G4V A;  5EB0 A;  2HS4 A;  1TVK B;  1X52 A;  3HKC B;  1YJN F;  1CK2 A;  4C81 A;  1W58 1;  3E20 B;  3ON1 A;  4C8I A;  3CCV F;  3P4E A;  3RA6 A;  5CA0 B;  1Q86 H;  2AIF A;  5EWR A;  4IHJ A;  1CLI A;  1PF5 A;  4B46 A;  1VH8 A;  1SDS A;  1TUB B;  3HAX D;  3VOA A;  1DT9 A;  4B5C A;  3CMA F;  1Z5W A;  2LCA A;  3WGK A;  2OTL F;  1K9M H;  1VQ9 F;  5LA6 B;  3HKB A;  4G4Z A;  3HKD A;  1JN1 A;  3D54 A;  2CVL A;  4LNU A;  5FNV A;  1H48 A;  4YJ2 A;  2OTJ F;  5FLX M;  3DC2 A;  1GO1 A;  3GYQ A;  3ELC A;  4O4I A;  3I55 F;  1VQ4 F;  2FC3 A;  1KD1 H;  1W5B A;  2LBW A;  1K8A H;  1OFU A;  3S06 A;  5KMG A;  2GVI A;  1IV2 A;  1X25 A;  1W57 A;  3F6M A;  5LOV B;  5GON A;  3CME F;  5FJ4 C;  4I4T A;  1W3E X;  4EI8 A;  3JAS A;  2R75 1;  2QA4 F;  3IMP A;  3M84 A;  3KHN A;  5MN6 A;  2N48 A;  3WXM B;  3OBW A;  4ZHW A;  4HNA A;  3BYQ A;  3MDO A;  3QUW A;  4I55 A;  3EOR A;  2UZH A;  2HVY D;  4X3M A;  4BT5 A;  1RLG A;  3HTN A;  1Q8R A;  3M4S A;  4NQ3 A;  5LYJ A;  4WBN A;  3G4S F;  3I3F A;  2HP3 A;  3MCA B;  4O4J A;  3F0F A;  5ITZ A;  2BTO A;  2CSL A;  3RYF B;  3HKD B;  3LWO C;  4KWE A;  2IG8 A;  4I50 B;  4M8I A;  4YJ2 B;  4X1Y A;  4BW0 B;  5JQG B;  2VAP A;  2VGN A;  3LFO A;  2EWC A;  2VGM A;  1KC8 H;  3CXC F;  3LWP C;  2BO1 A;  5EZY A;  4O4I B;  3I7T A;  1T0K B;  2Z1F A;  5CA0 A;  2VXY A;  4TV9 A;  3P10 A;  5HY0 A;  3MBM A;  5GIP C;  3VYT C;  3V4D A;  2JNB A;  1QVG F;  3Q8H A;  5GON B;  4ZHQ A;  4C8E A;  4I4T B;  1XRG A;  3WGL A;  3JAS B;  4G4Y A;  3OW2 F;  5CA1 A;  3CG6 A;  1X7O A;  3WJR A;  5JVD B;  5LXT A;  1RA4 A;  1VQ6 F;  3S0W A;  4HNA B;  1U43 A;  2R6R 1;  5IJ0 A;  5B8F A;  1Q82 H;  1JD1 A;  3VTI C;  1YJ9 F;  1M1K H;  5EIB D;  2KGW A;  3RYI B;  2RHL A;  2HS3 A;  3RYC A;  1ONI A;  3LWR C;  1NMU B;  4WBN B;  2QI2 A;  3ERN A;  3N2K A;  4U3J A;  1CN7 A;  3NMU C;  3LWQ C;  3CC4 F;  1R1M A;  2RHO A;  1W55 A;  2HX0 A;  4O4J B;  5ITZ B;  2Z1T A;  3J7A R;  5J2U B;  4BVR A;  1KQS F;  4X1Y B;  3OBY A;  3CYQ A;  4DRX B;  4NWO B;  2Q1X A;  3F0D A;  1IV3 A;  5EZY B;  3S0H A;  1YGY A;  3CD6 F;  3CCE F;  4DXD A;  4TV9 B;  1T0A A;  5EIB C;  3E1Y A;  3CCS F;  4ZHQ B;  4O4L A;  1JFF A;  1VQN F;  3RYF A;  5CA1 B;  4FFB A;  2W8B C;  4I50 A;  3CCL F;  5LXT B;  1W5F A;  2GZL A;  1U3P A;  5JQG A;  5IJ0 B;  3NVK E;  1XV2 A;  3JAK B;  3RA5 A;  3NK6 A;  3WPX A;  3S03 A;  4C4W C;  4BVT A;  1IPA A;  1VQM F;  4EI9 A;  3CPW F;  3V7E A;  3RYC B;  1J7H A;  4EB6 A;  2DT4 A;  2ZAU A;  1RLU A;  3VI6 A;  5IT9 M;  1VQV A;  4TZZ A;  1H47 A;  3ZP7 A;  1JY8 A;  5HXU A;  3N2K B;  4U3J B;  5LP6 C;  3FD6 A;  2CZW A;  4E6E A;  1NJI H;  4G4X A;  3B6N A;  3WGJ A;  3QTY A;  2ZVZ A;  3FFM A;  5A2Q M;  5JVD A;  1YI2 F;  3LDT A;  4B62 A;  2BTU A;  2AIZ P;  1VQO F;  2AMT A;  2KTU A;  3RYI A;  5IJ9 A;  2Z01 A;  3V7Q A;  2CWJ A;  1K73 H;  3D01 A;  3MCQ A;  3V3T A;  1SA0 A;  3DDN A;  2KTV A;  2PMP A;  3JCM M;  3JAR A;  3CCQ F;  5JCO C;  4O4L B;  3K2X A;  1JFF B;  2CHS A;  3JAM M;  3JAL B;  5J2T B;  4BY9 D;  1GO0 A;  4X3L A;  4FFB B;  5J2U A;  1W59 A;  4B45 A;  4TV8 A;  1FFX A;  4DRX A;  4ZI7 B;  2UYP A;  2GLZ A;  5C8Y A;  5LP6 A;  3HJW C;  4BVQ A;  3VYU C;  5EYP A;  4EB6 B;  4YJ3 B;  5EO3 A;  3L7Q A;  1H7M A;  1DBF A;  1IV1 A;  1YHQ F;  3WGM A;  3LYB A;  3RYH A;  3MQW A;  3GHZ A;  3K0T A; 
#chains in the Genus database with same CATH homology
 1R1M A;  3OON A;  4G4Z A;  4PWT A;  1OAP A;  2ZF8 A;  4G4Y A;  3IMP A;  4G4X A;  3KHN A;  2ZOV A;  4G88 A;  2W8B C;  2N48 A;  2ZVZ A;  3S0W A;  3WPW A;  2L26 A;  2MQE A;  4ZHW A;  3LDT A;  3CYQ A;  4B62 A;  2HQS C;  3CYP B;  3WPX A;  4ZHV A;  3S03 A;  2AIZ P;  4ERH A;  5EB1 B;  2K1S A;  2KGW A;  4G4W A;  3S02 A;  3S0H A;  3TD5 A;  3TD3 A;  3S06 A;  3TD4 A;  4ZHY B;  4R40 B;  2ZVY A;  2LBT A;  4RHA A;  5EAZ A;  4B5C A;  3S0Y A;  2LCA A;  4G4V A;  5EB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...