4I4TB

Crystal structure of tubulin-rb3-ttl-zampanolide complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
420
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 158
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i4tB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i4tB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i4tB01
4U3JA 3JARA 3WGNA 4IIJB 3RYCA 3RYIB 3HKDB 5LOVB 3HKCA 2R751 1SA0B 3HKBB 5IJ9B 5LYJB 5MN6A 4HNAA 4IIJA 5JVDB 1OFUA 3RYIA 5LOVA 5ITZB 1FFXB 3HKBA 5LYJA 3RYHA 5JVDA 4ZHQB 4TV9B 5EIBC 4B46A 4I50B 1FFXA 2VAWA 4YJ2A 4ZHQA 4U39A 4O2AB 4FFBB 4O4HB 4X20B 5JCOC 4EI7A 5KMGB 4O2AA 4FFBA 4WBNB 3CB2A 3JAKB 4F6RB 1W5EA 4LNUB 5KMGA 5MN4A 1W5AA 3R4VA 3E22B 4YJ3B 2XKBA 5BMVB 2RHLA 4TUYA 4X1IA 5EYPB 3JAKA 5GONB 4F6RA 3RB8A 4DXDA 2Q1YA 3RYFB 4YJ3A 3N2KB 5BMVA 3VO9A 4I55B 5GONA 3UT5B 3VPAA 2Q1XA 3HKDA 3RYFA 1SA0A 5FNVB 5LP6C 5IJ9A 4I55A 3M89A 3WGKA 5JQGB 5ITZA 2RHOA 4O2BB 4E6EA 5FNVA 3JAWB 4I4TB 4TV9A 5IJ0B 4I50A 5JQGA 3JASB 4X1YB 4O2BA 3C8LA 3ZBQA 1W59A 4I4TA 3V3TA 3JATB 3HKEB 3JASA 5CA0B 4O4HA 4EB6B 4X20A 1RQ7A 1W5FA 1TVKB 5JCOA 5J2UB 3JATA 3HKEA 5KX5B 4XCQA 4WBNA 5EIBD 4O4LB 4O4IB 4EB6A 4DRXB 1TVKA 5J2UA 4X1KB 2BTQB 4LNUA 3WGLA 5LXTB 5KX5A 3ZBPA 3E22A 3N2GB 4O4IA 4O4LA 5EYPA 4X1KA 2BTQA 4TV8B 2R6R1 4M8IA 2RHHA 2VAPA 3N2GA 5M7EA 3N2KA 4IHJB 1Z5WA 5CA1B 3UT5A 5LP6B 3M8KA 4TV8A 2RHJA 5CB4B 5LP6A 2GVIA 5CB4A 5EZYB 1W581 3JAWA 3RYCB 1W5BA 5IJ0A 3HKCB 1RLUA 4X1YA 4B45A 4HNAB 5J2TB 4ZI7B 5CA0A 5JH7B 2BTOA 3WGMA 3RYHB 4KWEA 4ZOLB 5J2TA 3WGJA 3JALB 4ZI7A 3VOBA 4O4JB 5IYZB 5JH7A 4YJ2B 4DRXA 4ZOLA 1TUBB 3VO8A 3JALA 5LXTA 3VOAA 4O4JA 5C8YB 5IYZA 4EI8A 5MN5A 5LA6B 2VXYA 1TUBA 2XKAA 2VAMA 1FSZA 1JFFB 5C8YA 4EI9A 4IHJA 5LA6A 5CA1A 3ZIDA 1JFFA 4U3JB 3JARB 1Z5VA 4TUYB 4X1IB 1RQ2A 5EZYA
chains in the Genus database with same CATH superfamily
3NLLA 2QE7G 4R4JA 2XTMA 3MBIA 4OQLA 2BDUA 3H0CA 3V2HA 5LA6F 5L4SA 5EHNA 1U63A 1PFYA 3TQTA 3DF9A 1S8FA 3CPWF 4G2TA 4UTNA 3SNKA 1B2RA 3FGPA 3K09C 3D0RA 4E4TA 2IY9A 5LMZA 1EB9A 4X63A 1QK3A 2R25B 5CG1A 5KUKA 2Q50A 4KYUA 2ZYRA 3R7WA 5B3KA 4MW0A 3MTEA 1ZH6A 1UJ2A 4JGBA 1SVWA 1M1XB 3FNBA 4L07A 3QELA 3BJIC 4OXQA 1OIVA 2CXQA 3J7AC 4OFBA 5FKJA 1YTLA 1AX9A 1HDJA 4D74A 1IZ0A 3CCVV 1WZEA 3VDNB 2OHOA 2COEA 2XITA 3E6AA 2VHTA 2Q5EA 3HJTA 1JV2B 4RAIA 2C95A 2PAFA 4RZUA 4DLTA 3QE0A 4LA4A 3V33A 5LJIA 3I01A 3REQB 3CO0S 3ETGA 4U02A 1JLLA 2NOAA 4O59O 2PZEA 4FFBA 3PXAA 1O97D 2HPZA 3JV7A 1J8DA 2JEOA 2IZ6A 5EWMB 2FQWA 3G2NA 3OFND 5BR7A 2DLDA 1GZDA 1UBJS 4ZYXA 2CNDA 3CFYA 3WR5A 3CX5F 5I48A 3GJZA 4JNCA 3JQ7A 3FPBA 5NLLA 5KOHA 4I36A 3HA3A 4J3NA 2GFIA 1LPNA 1MXFA 3OPNA 4GLXA 4XLLA 2X3YA 3BFXA 3OOWA 1U11A 1Z2DA 5ENVA 1TMKA 3ISVA 2XUDA 2AZTA 1QK5A 1EK2A 4R0NA 1YH3A 3QA9A 5IW8A 4FDLA 2I7TA 4Q9NA 1YKSA 1NTZH 5FPQA 4OREX 1QRAA 3IHWA 4LOIA 4R0VA 3TXQA 3MJCA 1NVWQ 2HQBA 2OB2A 2P1DA 1Y7IA 2VJKA 1CUCA 3IO3A 3HACA 3M6FA 2QB5A 3MLEA 4NK4A 1YDGA 1D6MA 5AI9A 3WXBA 4GP9A 2YIAA 2GK7A 2QKCA 4FWBA 4Q7LA 4MQLA 3SYAA 4BEJA 3K4QA 3QVVA 3IIEA 1JAZA 4W63A 2DLCX 4JWKA 1TPYA 2HL6A 4F4CA 4QBFA 4MARA 4PO3X 1FVFA 2P8JA 4GOLD 1D03A 2O3SA 1JQ0A 2MIIA 3ABMC 3TJZA 4DV3O 1CEXA 2LCQA 3AEKB 4YCSA 1YR3A 2ECQA 1HDXA 2G17A 2F59A 3TI7A 3L74H 1CULC 1SXHA 2OBLA 1QCZA 1EFTA 2FYUH 2UXNA 3PDIB 1VC2A 4RX1A 3AL2A 2HF2A 1KD1W 2MMCA 4CIAA 3WLQA 2BKLA 3PFIA 4L2IA 3WA6A 1WA8B 2WEKA 1UH5A 4IINA 2ISSD 4H6XA 2OTJF 4N7RA 4EGFA 5AW2A 1GITA 4E4EA 4B40A 3EZNA 1MAWA 3BDVA 1C7QA 1YR7A 1ISGA 5AXBA 1ZIYA 3LSTA 1ISJA 3H2GA 2ZWOA 5TR9A 5EKDA 5CTAA 4XX1A 4E5YA 2FUG6 4EUFA 1KFKB 2WG2A 1YACA 3TD6A 1U5CA 1ADBA 5FBZA 4Y6QA 2VDMB 1V37A 3RYTC 4FQ7A 5IVHA 4QOSA 4CF6A 3L75H 3GFTA 3O8OB 5ALRA 4NATA 3VH1A 4M9UA 3TCNA 3S2IA 2QZZA 4JAAA 1HW7A 2IZZA 1GCAA 2JVJA 2Q67A 2W0FC 2SICE 1DX6A 2CVZA 3I1FA 4D42A 5FL7A 3TLYA 1B15A 4N6OA 4QNNA 4AB1A 5CLJA 5A4MS 4BFZA 1M67A 2COKA 2HGZA 4U7JA 2C94A 4IL6Z 4Y8VA 5TQVA 3KPUA 1WBJB 3ADBA 4RC9A 5JVDF 1JJVA 1UDWA 1OFUA 4HDMA 2A9RA 2PUWA 3THYA 2WLKA 3NJRA 3Q8WA 2Z5FA 4MK4A 1QVAA 5HP8A 4PAOA 1CUZA 2G72A 2YJGA 1EZJA 1UWLA 1R9MA 1P9RA 4X6LA 3ACDA 2I2AA 2Z2IA 4NMXB 3C6KA 3GLIA 2RKOA 2ORWA 5B58C 2X76A 1C3OB 1Y8QB 4MQFA 2ZFUA 1Z47A 3O65A 2VHUA 3LDCA 3CHYA 3KQQA 5G3YA 3E20B 1EX1A 1QO0D 2QV0A 3ZX5A 1I4LD 3UKOA 1BDHA 1KYZA 4DCMA 3CPHA 1BFUA 1N36B 4MEBA 5K6AA 1FYWA 1TUGA 3LPCA 2ZTUA 4IFBA 4WA7A 4OU4A 3E22A 2R4TA 3EMBA 2H5IA 3H5RA 2OYRA 1F51E 3LF2A 1NPDA 2OGWA 4JBNA 1RAAA 3MCQA 4O6VA 4QDJA 1F2VA 3KVRA 5GP1A 1JDBB 2CHGA 2Z1FA 2C7PA 3R7BA 3JALB 2ZIAA 5EOVA 2A78A 5J3JA 3KP1A 2XAJA 5SICE 3AJRA 3KLNA 5EZQA 4PA9A 2Q1UA 1F4NA 3RARA 5AVXA 4ARZA 4H77A 1WNSA 3EVKA 1W57A 2BHRA 4D0SA 3PC3A 4D3SA 4AJKA 2GD1O 1TT5A 4G5QA 2FB5A 2F67A 5CLQA 4NI5A 3GFQA 3PITA 3PEYA 1P81A 1K7XB 1SKQA 5KVAA 3OOSA 5ALLA 2W0MA 4UM7A 1QYRA 2J4DA 4L0DA 2CUTA 1NBWB 2ZEJA 3HEMA 2OMKA 4PD4F 2X4DA 4MLZA 4PHZA 4CQNA 4BP3A 1TCBA 3QWHA 1XAGA 2XGGA 1F48A 1RCUA 3CRMA 5JAMA 1IQRA 3M3DA 4B8ZA 3ETCA 5EO3A 2QN2A 3QUWA 4B33A 4DUZO 3GBPA 4MUBA 5IRCD 4MWOA 4QPZA 1T0IA 3ENKA 2BH2A 5HQTA 4BV3A 2CLMB 3EGXA 3AVWA 2D3WA 1QC5B 3O1LA 4MKGA 3P9IA 5GANK 4JYAB 1VJRA 1T2EA 3HWSA 4KVAA 1FEZA 1U9ZA 2XUMA 4MV0A 2K6GA 2WJPA 5IANA 5E9JA 2VJLA 5T4BA 2FDRA 1WBBA 5CXXA 3UEOA 4XYGA 3J80N 3GLQA 1L0BA 3W5CA 1R0SA 3KTAA 3KQYA 1L7NA 2GZSA 4KGXA 1V1JA 4MYDA 4RD3A 3FMOB 1LNSA 3H5VA 2OCKA 4XX0A 3C6QA 3ZGOA 4LDJA 2IGTA 3G1WA 1U0HC 3LK7A 1XMPA 4GL2A 2WDZA 4B5LA 1FYDA 5F9HA 1VPDA 2I34A 4WJLA 3ND8A 2FR0A 4F5YA 3R0XA 2OT3B 3PS9A 4FDAA 2CDYA 1ZD9A 4E08A 1ZVVA 3RFVA 2CL5A 1A2OA 1JR3D 5FHRA 2BY4A 3GLFE 2GCNA 4K8XA 1RKUA 1BKSB 1A2BA 2I3GA 4LYYA 1US8A 2JBHA 4I1IA 3S1AB 4LJ6A 3CKKA 4IVQA 4JLUA 4GBMA 1HR0O 4CV2A 3D43A 1XEAA 3ZCXA 4IMPA 4IF6A 2ZDIC 2PGAA 3T95A 1Q6YA 2FW0A 3NJ8A 1FU8A 3S2YA 3H84A 3I8XA 2Q1YA 3SHTA 3RUDA 1B93A 5LP6C 4ZDWA 1QHSA 5B7NA 4CQLB 1J23A 2MOKA 2DT8A 2WZQA 4EZIA 1NPTO 1NW4A 1OQAA 4KH0A 1H8ED 4DR3O 2FSPA 1NMQA 2BTQA 4UB8Z 5FFNA 1DJOA 4CF4A 2YY7A 1GNQA 3AFHA 4LF4B 4ZQIA 2PUCA 4REOA 3WLRA 2CHUA 1XEWY 4PFSA 1VZ2A 2BJWA 5LCXA 2A1UB 1W44A 2FHSA 4DMUB 4Y2RA 1XFAA 5DLDA 3HR7A 1VECA 3L6BA 2PTGA 1BX3A 5GJWC 2ZR2A 2NAFA 1FXWA 4BNWA 3HSSA 5J5VA 1RNLA 1ZD5A 2QX8A 1WMDA 1YHNA 3QXHA 4YJ2A 1ACJA 4KMSA 4PIPA 3L0PA 3CPWU 4QULA 1AUOA 3HXPA 3R0JA 1T1IA 1DQNA 5K3OA 1JQAA 1BQZA 2CLHB 2PGLA 3LY8A 4CLRA 3ZX6A 5K0FA 3ED1A 1P62B 1P2UA 2RGUA 3TRHA 2J0UB 2A84A 1RYMA 4QO7A 4MS2A 3HADA 4H7FA 4XSVA 1M1ZA 3RWRD 3FUWA 2Z8ZA 4NVRA 3F5TA 1GZSA 4P9PA 5CK5A 5IDWA 4LXXA 1MCZA 2C92A 5G40A 4ZOAA 4MVQA 4G27B 4FMTA 2VZEA 3UK1A 2XAGA 1MAUA 1Z5ZA 1IPHA 4QPDA 4MINA 3VOBA 4DS3A 4NTZA 4YPOA 4FNAA 4W1QA 4KYIB 2WWIA 4PF1A 2CNBA 3ZNOA 3HI4A 3RVRA 4CMHA 1VKZA 1UC9A 4LJRA 3DEHA 1LWNA 2O06A 2FFAA 4WDRA 1DRKA 1NW3A 5FJJA 1JVBA 2VQ6A 1E63A 3IQGX 5EXEA 5CDFE 4TQDA 1N0NA 4EJSB 1FP2A 3VR3D 4B2YA 3OLVA 3IE0A 3LX6A 1FJHA 1ST2A 5JS8A 2AH5A 1XLTC 1BS1A 3NXSA 4BXOA 1A7UA 1KF0A 5LLTA 1BXRA 1Z38A 3CF0A 1FTGA 4UULA 3CZRA 5BW8A 4G4WA 1FXKC 2YHIA 1PE0A 1CK4A 1ONNA 2V7TA 5HCUA 3I32A 3DL4A 4P4SA 4X8OA 3PKJA 3JQFC 3CUVA 1JIQA 3QU5A 1L4FA 4FNMA 4UHFA 3SX4A 1YQQA 1WUKS 3F4BA 3WJ7A 1WA5A 2J31A 1FFGA 4KR9A 4M99A 3UTDA 5JLAA 1M76A 3IP6A 1JFFB 2JLUA 3GQBB 1JU9A 1OXSC 1SK9A 4IDHA 1B41A 1Y8RB 1LGYA 1PN3A 2C2WA 2CE7A 3HFSA 2ICAA 3PXCX 1XRQA 2A9HA 2WWYA 4BMNA 2HJ9A 2L17A 2RDCA 4D3XA 2JCGA 2Q1SA 1BDIA 1AZSC 5DTEA 4JI5O 3SZOA 5IC6A 1N2CB 3LD9A 2CV1A 3SYMA 3TSOA 2Y4OA 4HMPA 3ZJ5A 3PSAA 3G71V 3A9CA 5H9VA 5K1XA 1Z12A 4YJFA 5DLYA 4DLNA 1CZHA 3VJLA 3I09A 1X70A 4AO6A 3LBNA 4X95A 3SP1A 3SYCA 4R1QA 4IDFA 2VBGA 2YR0A 2D8AA 4MYRA 2EJ7A 2I7CA 3P7MA 1VBFA 5FPSA 3IJ4A 4YH1A 4RFLA 4Y9UA 3RUCA 3S3WA 3FNIA 3S2FA 3A0BZ 1AQ6A 2GAJA 1OR8A 2ZWPA 4OGGA 5HP4A 2FQ1A 1OILA 1QOQB 4L16A 2UYCA 3KUKA 3O31A 2IOHA 4URWR 3CLTC 4HDRB 1F6WA 4A0SA 4UCXA 4JTDB 2XYQA 1WCWA 1EUDB 4LYGA 4E2FA 3HKDA 3VYWA 1ZGJA 5F2EA 3AFOA 3LRXA 4R31A 3AKEA 3KXIA 2PV0A 1ORIA 2NN3C 3TQQA 2QAGB 3EULA 1EINA 2YN4A 3ILSA 3UYKA 3PVZA 2WMYA 5CHEA 4GU5A 2ZJZA 1E9AA 3R20A 3Q4HB 4M83A 2IM9A 5E3IA 3KT0A 4DLYA 1I7DA 2VSNA 3M1LA 1UJCA 3EA4A 5HF6A 3LBFA 3PQ2A 3LC0A 2AOTA 3ZY6A 2R8ZA 3BXGA 4OMFG 1EN5A 4TTAA 2ZU0C 3UENA 4ROSA 4ZGWA 5IDJA 2WU3A 5F51A 4PBTA 5LZ7A 5EKSA 1N5LA 3TGLA 5H2FZ 3DL7A 1E18A 5TIIA 3B7PA 3R74A 3NW9A 1SULA 3IALA 5C31A 1X2BA 2H2DA 4X97A 4DABA 1JAHA 4RYDA 2G8NA 3K0FB 2CHFA 1V2GA 2EZ4A 4PS0A 3EXIB 3FBGA 3K9WA 2BSKA 4E09A 1KP9A 3WQQA 3VHXA 2OK8A 4GLLA 4OCZA 2JEYA 3L71H 1I4OA 4DM7A 1H2RS 3FWYA 1OCRB 2NU7A 2BI8A 4FFWA 3DVQX 1A8PA 4XJVA 3GOQA 3K1JA 4W99A 1SEVA 4X66B 5K03A 4TTRA 1YIAA 1EK0A 3LQKA 4WVFA 1OYYA 3FRIA 1TJ3A 3ZJUA 1PJCA 5D2CA 1D5CA 4RVDA 5D5HA 2YEVA 1GO3F 5FTLA 4LP8A 5IBCA 2EARA 5J4HA 2OD9A 4UCWA 5BR4A 3QKSA 3SSMA 2ZRFA 4MZDA 1YQ9A 1CY4A 2A5JA 4MW3A 1M2KA 3JQ8B 1V8DA 4OAQA 1E7MA 3VPHA 1SKAA 1QHXA 1TJ5A 4PTZA 2Z4RA 2DP4E 3FFXA 4J03A 4XDLA 3FTEA 4UMVA 1DCFA 1FQWA 5ELMA 1N9GA 1U8CB 4EECA 3DPIA 3H1LH 1B76A 5CBPB 8ATCA 5FA8A 3A05A 3DVSX 3TSZA 1H4QA 4AJ9A 1D0IA 3RAPR 4LGCA 1VF7A 3DV0B 1PDVA 5L3FA 2POQX 1K08A 3N2EA 3FHOA 1TEXA 1NMUB 3HJAA 1DZ3A 2R5WA 1UK7A 2UZ4A 4B6RA 3RE1A 2RHTA 2JLCA 2JG3A 5LA6B 1P8AA 2GH1A 5KIAA 1AO3A 3EFOB 3K0KA 3AR3A 3D8SA 4UQLA 2WVAA 1N7GA 2HQ1A 3OEHD 3FFWA 3RFCA 3KQHA 3SMQA 2KQXA 2V55B 1UAYA 4KFTA 1PWZA 2BBOA 2GZRA 2VS1A 3HH8A 4TTQA 2KB1A 4UTPA 1S72V 3WRWA 2PK3A 1J00A 3BF7A 1DAIA 3OURA 2OBNA 1I5EA 2XBUA 5LDDC 1O96A 2VSFA 3NQ41 3D2BA 4I50F 2YBDA 1DDOA 2GJSA 2VKTA 1PKXA 1HWYA 4PONA 2PI4A 4B4DA 2FHPA 5FBVB 4E46A 1PR5A 4G1EB 3M6WA 5IABA 1QHIA 1BC5A 3WXMA 1Y5IA 5FL7G 1OCCC 4EW2A 3M6LA 4CR8A 1Q82W 3C4QA 3BN3A 1XVVA 1J39A 5CDUA 4I1UA 3P4UA 2FPXA 3D4OA 2JKZA 4CKEA 4UASA 3ILVA 4LCKA 2EOAA 3DO6A 5L3CA 2P4SA 4D26A 3GJ6A 3HFRA 3GVCA 1BGYH 1A95A 1AIPA 2VP3A 2E89A 1SUSA 3AFGA 1QH8B 3LX4A 4EO7A 2LBXA 3SQXA 4UCSA 2XTJA 4JXZA 3L05A 3BGWA 1XMQO 2J59A 2RK6A 4PLWA 2Y4NA 4RVGA 3T7SA 2DAPA 3MT7A 1L7EA 1AV6A 4ZVQA 4Q48A 2I65A 4WKBA 1E7SA 1XQ9A 5KDLA 3ABQB 3GARA 4NF2A 1M6WA 2H11A 3QOXA 3AP2A 2V96A 4CR7A 2ZJ3A 4BGUA 1H9AA 3L7KA 2WAXA 2QKSA 3EUEA 1XBTA 2ADPA 1YI8A 2CUGA 3C85A 1F06A 5DBOA 4GZ3A 3MUNA 2OD2A 4PNHA 2HW8A 3BHIA 3D4BA 5LBUA 1DLIA 1VJ1A 1LBIA 1EA7A 1E5TA 1TKRA 4HWTA 1H0SA 4PSVA 4LF9O 4GHWA 4OHPA 4NSNA 5IMSA 5C4IA 4ER6A 1AKNA 2PLWA 2ZSJA 1BD3A 2DTEA 5C18A 4RMIA 3I42A 4RTPA 1TCVA 4EB8A 2QTNA 3DJFA 3K6SA 3I04A 1R2QA 1JDNA 4C5BA 4RD1A 3UAYA 4C0SA 4CTJA 4OG2A 2WJIA 1OI4A 4NCBA 3V6MA 1S2GA 4YT8A 3D3KA 1U2EA 3KKQA 1FXHA 2O48X 5JCXA 1J7HA 5BQXA 1ZD8A 3HN6A 4ISCA 1DTWA 1PGJA 4WN9B 4DXDA 3ER8A 5FOQA 2ORYA 3H4TA 1QDLB 1PSDA 2Q0QA 4NS1A 3ZTWA 3DMHA 2ATVA 4MYSA 1CR4A 4BKRA 3K9BA 4QXAA 4MVYA 3UF0A 4D96A 2II6A 2ERCA 1CK2A 2QL5A 2FX3A 4YUWA 5C9ZA 3A27A 1L3CA 4ZU6X 3OESA 4FKZA 1ZICA 1CJKC 4RVCA 2M6LA 5IBPA 5J43A 1SCDA 2I76A 4KK3A 1ODLA 1AVMA 1YMUA 1TVCA 1R0WA 1B8UA 2JAQA 1H2ZA 1JHAA 3TTUA 2R8EA 3KQNA 4LK3A 4P7BA 2Q3BA 1Z5GA 3NKLA 1Q77A 2JC3A 3QZUA 5CEEA 4ODIA 1A4RA 3RVKA 3RU7A 3FPEA 2NUAB 4U2CA 4JJ4A 1ZN9A 3RVSA 3CVOA 3IC9A 1QR8A 2H07A 5BVGA 4IL5A 1ZUNA 3H9GA 1QF9A 2Y69C 3IPYA 1OW3B 5E9AA 5KTYA 3DE2X 4HDKB 5BQ5A 4YAOA 2OAGA 3S0JA 1M83A 5JSFA 3CJHB 5LPNA 1M74A 2XB8A 1AI7A 2GUWA 3V6LA 4LFBO 4FQ8A 4JT8A 3S3TA 1QOPB 2FWPA 4JSTA 4H3HB 4C6TA 4H59A 4ABYA 4CDRA 2I1LA 3G0HA 3KXKA 2CFOA 2QZJA 3PXBA 3ZCVA 1DC3A 1EVKA 1M6EX 2F62A 4ZYTA 1IY2A 5KI6A 4DADA 2GYWA 1LI7A 4N8DA 5HDBB 4MUYA 3UHAA 1IUOA 3TTTA 1I30A 3MMXA 1UM9A 5KKAA 1UT5A 4XDJA 3B51X 4RPJA 1D09A 4BNUA 5JW6A 3E9RA 2PUBA 3NM5A 3WIOA 4PXAA 3BREA 2A9KA 1ISIA 4F3TA 3VR6A 5TE9A 1O89A 3U4HA 3LWVC 2H2IA 4EUNA 4I55F 2ZZKA 3OICA 5AVRA 3RRNA 3UFXB 4TQGA 2FL4A 4I14A 4XD7A 4HDNB 1M2HA 1Q83A 4B6PA 3GGSA 2ZYAA 4J7JA 3EPPA 2GEDA 1Z56C 1X8KA 2P4UA 3A3KA 4BJ3A 3BXHA 2DHDA 1VXRA 4URYR 2EBOA 1KBOA 3O2QB 1J8YF 1W96A 2RJNA 3NC1C 2ZSIA 4DW0A 5J4KA 3BQNB 2X9GA 1FJXA 3T3HA 3U4CA 3SJQC 4FFNA 5LLSA 1OXXK 1ENYA 1P9WA 4AXBA 4D0NA 2PD6A 3NATA 4GYYA 5DYWA 3SHWA 5DGXA 2GM3A 2IXAA 2K4MA 2IKQA 3I5MA 4PXSA 3O85A 3J81N 1VLMA 3BGIA 1B14A 4P3XA 3PXXA 4NBVA 2FW6A 4BCCA 1KMNA 3LFUA 1H0KA 1GR0A 3SLGA 4UUPA 3C8LA 3OZUA 2NPIA 1T4MA 1TL7C 2DSTA 2V7PA 4QJ5A 2QVXX 2C61A 5C46F 5BOSB 2F9ZC 4JI8O 3BWDD 3UB3A 4MI9A 1C9KA 1RXEA 3KVOA 3CYQA 4KI0A 4JD5A 3LM8A 1YZYA 4QYIA 3H11A 2F1IA 1GPYA 2QTCA 1YFJA 4LHSA 2JVDA 1DQYA 5JD4A 4BTLA 4Q24A 5LUBA 4IG4A 2VUIB 1DC8A 1OY1A 2JFOA 3UAXA 3IL2A 3NHPA 3RCBA 4Z3DA 5JT1A 1O7JA 2WAAA 1GN6A 3FCSB 1HTWA 3DCIA 3W05A 1NQ5A 1ZNZA 3EZ2A 2LP7A 1E0SA 1N0VC 3T7AA 3WRYA 4LXGA 4A7PA 4EYQA 2I6RA 2BFCB 5JANA 4L4UA 4J7CA 4QELA 1G42A 4Y1RA 3E1YA 4RD6A 4B75A 3IUMA 1HBJA 3T4XA 4XE5A 4HGZA 2HRRA 2XUQA 4ARSA 2NXEA 2FJ0A 3RABA 3ROZA 2CHTA 1OD6A 1YRWA 5DJ5A 4KUHA 5I5GA 1ARZA 1QDUA 4UNRA 2V7QA 4FFRA 1K0UA 4MUEA 4JA0A 1QLNA 1GPH1 2DBYA 1K98A 1E4YA 5T4HA 3IDFA 2B37A 2C2OA 1M93A 4W8GA 3DBLB 1R0BA 1SA0B 4B6SA 3NT2A 2Y66A 2BPOA 3VZCA 4R7CA 2PV7A 2X13A 3G9TA 3BERA 5LQCA 3TBFA 2XWJI 4CRWB 3KAKA 3VI4B 1F23A 3ROQA 1FTQA 3GAFA 3LT2A 3LNMB 2V65A 1HDZA 2A7QA 3T38A 2YYEA 2QN8A 2IU6A 5REQA 4JASA 2HCTA 4EB6A 3KOOA 5TT0A 4KI7A 4P08A 5JUWA 4YDRA 3D4LA 4YDHB 2BHTA 3D3WA 3E9QA 4Y67A 4MA4A 2O3QA 1V7CA 2HMTA 3MCTA 1QRUA 3LVRE 1JL3A 1T36B 1F7UA 5JJCA 2PH5A 3HO8A 2QV7A 5FHQA 4L6IA 3S55A 3M5WA 1P3Y1 4OQFA 3JR3A 1D7OA 4A8TA 1AQLA 1FMJA 5IARA 3LYHA 3WIUA 4NCAA 1PZGA 1KMCA 3WMXA 3EQZA 1ODFA 3QUAA 1V1RB 1TK3A 4PJ0Z 3E7XA 2GX6A 3Q3GE 2JF0A 3EEQA 4L74A 3FJOA 1YCHA 4D8YA 1JHXA 4LNUB 2AK3A 4FWTA 1NJFA 3W5HA 2C5GA 1G8YA 3VX3A 4P7FA 3HHPA 1FDTA 1SERA 4BASA 3D6JA 1Q0HA 3VX4A 3ZLUA 2ZKIA 1C0KA 3CG0A 2H5JA 4N3BA 3O7WA 2FSGA 4L8WB 2LFRA 2CF6A 2CXSA 1SRRA 1TU0A 4WACA 4ZYVA 2CFCA 3K08A 4CFZA 1WP7A 3IOCA 3OEEA 1RZVA 2DUNA 1G38A 1SG6A 1V9CA 3E5NA 4M36A 2E37A 2ZWAA 1O95D 3GDHA 1XF1A 2GCIA 4OJTA 1Z6AA 3ASOC 4BT2A 4PO8A 1ZGBA 2C9CA 4B48A 1QHFA 3FKJA 1ECCA 1SQBH 4FLZA 3ESXA 4EPRA 3MHHC 1M3SA 3DXXA 5ALTA 4JJKA 1E2EA 3T9FA 3NHAA 2XB6A 3ZZMA 4A82A 3K5NA 1ORDA 1E1KA 1U0LA 3KCNA 4NARA 3AL3A 4AT1A 3EVBA 1ZOPA 5DM1A 3I64A 2PXXA 1OGIA 1KA9H 4QWMA 4DV5O 1PEYA 1R4AA 5KOIA 5G4VC 2QA4F 1K33A 2PGNA 4CS2A 1KOFA 2AG8A 5E95A 2FWMX 1U3PA 1KOLA 3IV9A 4FB5A 1XEQA 3KSUA 2XNDG 3E1GA 3X0DA 5KYVA 4OYYA 2RH4A 2FEXA 1SCUA 1IIRA 1K89A 3IOMA 4JCOA 4RQEA 1JQDA 4B3TB 1N3BA 2Z2YA 3TB6A 5F7XA 4CZ2A 2WABA 1JHMA 1EFVA 4X8AA 3DEZA 4EYSA 4KBYA 2O05A 1P7WA 1V4NA 3CRNA 2BEWA 1TQ4A 4M0DA 1YGPA 2QSUA 1Z73A 1Q0TA 3ANYB 5BN5A 2CF5A 2ES4A 1XZKA 4EATA 3EXAA 4D99A 3QQPA 1JT9A 1IZ3A 4EGJA 1SURA 3ZQ6A 4FYYA 1C9YA 2XOKA 4DC0A 4YV7A 4GYCB 3C7KA 3EYAA 5THKA 1KE1A 2EILB 3D8BA 3QMWA 4J1NA 2LFSA 2VHQA 3NVMB 1NVKA 2HGSA 2IS1A 1ZUIA 3WLIA 4C3OB 1GQ2A 3OKFA 1UPUA 1WQ4A 5AM0A 4IOJA 1U0GA 1XRGA 1X7XB 1P9OA 3E9NA 1VLJA 3AF0A 3NHLA 3T1TA 3CR8A 4XFDA 1P7CA 1LH0A 3A4LA 2Q8QA 4AICA 2QPTA 3FUXA 2PQ6A 3ZCCA 4PWYA 3CIOA 1R27A 2Z9DA 3TFQA 1LLCA 1BO6A 1TCAA 2TS1A 2YC4C 1MQSA 2BISA 2FVXA 3HB3B 2YW9A 1G5PA 1JPJA 5JSZB 2UYHA 5G0SA 3UJ8A 4LHXA 2QRHA 3ASZA 4KXVA 4QNHB 1E79A 3MJEA 2BE3A 1HM5A 1L9KA 5HE8A 4K87A 1CY2A 4IOKA 1K66A 3TOXA 1RA4A 4JS0A 4FW9A 2G5CA 1HEIA 3I4FA 5DYTA 3CX3A 3AG4C 1ODSA 4BW0B 1E7RA 1VPLA 3Q2KA 4HH3C 2F1RA 3C98A 4PG5A 1XWFA 3SX2A 5CH5A 2JGEA 1OGYA 1JT2A 2HRCA 3WV5A 3O8LA 5IEBA 1K8XB 3EC2A 3JZIA 1V96A 3STHA 1M6YA 4JB2A 2Z30A 3NTLA 1RBMA 2NZUG 2Y93A 3AEUB 2I22A 3TQOA 4AJEA 1QK4A 5KDOA 4PHFA 4LVUA 5HFJA 5JAHA 5A6SA 3BB1A 2YZKA 4RJJA 3WE7A 2C9BA 4ZHVA 1NC3A 3AP1A 4GZRB 1J25A 4E5KA 3VOUA 1ZVQA 2XCSB 1VG8A 4M8LA 5DP2A 1FMCA 3PFWO 4LGMA 1H2LA 1Y5RA 3WGLA 2PSSA 2XECA 4BGVA 1EGMB 5LDGA 1OMOA 3AVTA 3AEQB 1ZOSA 3R65A 2CSXA 2G71A 5TDHA 5C8VA 3N0WA 3FZYA 1CJCA 2C7QA 9LDTA 2R97A 1DP4A 4ZIRA 2VRBA 2ZAGA 2XA1A 1ZJWA 1EVIA 1Z4KA 3T0FA 1MX9A 1YI0A 4ZRMA 2KQUA 1IBKO 2DPMA 3AFMA 1XLVA 3RC9A 3UJPA 1PJSA 5EJ8A 4LYFA 3VR2D 1MZFA 5DTMA 1HDEA 1ENOA 2QN9A 1OE0A 5HQJA 4PQFA 2OAQ1 5AVUA 4NNJA 1XYGA 3OPVA 5AK0A 2B61A 1YOVB 4WBNF 1I0IA 2Q5IA 2ZWVA 3JSLA 3FTQA 3JYCA 5CVJA 4RJKA 3E2PA 1QPZA 4UE2A 2CJPA 3G9QA 4JUBA 4LJ5A 3JYNA 5DI3B 5EVJA 1RZ3A 5EMMA 4NU6A 3B2EE 3B7WA 1CQZA 4IIUA 1O94C 3H9BA 2GPTA 1L8XA 1L6IA 1V54B 1A8QA 4CL8A 4N82A 1COZA 2FW9A 4JL5A 1WDWB 3MMNA 4WA8A 5GIPC 2PUAA 2VYNA 2HB6A 4W9RA 4I50B 5C5CA 4PBSA 1Z63A 2C3OA 3HYNA 2XJ9A 1WLEA 3DXRA 2GNAA 4Q4HA 1HQYE 2WU8A 5EHZA 4K3UA 3CCJV 4O1MA 3A6ZA 1E0KA 3HCRA 3IULA 4IIXA 5C5IA 1RHUA 2ZPTX 4YY3B 5B2ZA 1XJQA 4MS4B 4PYQA 3RUHA 5B6JA 3EVCA 4MS3B 4YAUA 4EFMA 2CXTA 1Q95A 5E4YA 1FRNA 4ZAVA 4F84A 1OT5A 4D79A 2F2TA 4TTIA 2VTBB 4HLQB 3TZEA 1SVKA 4PU0A 3WBKA 2W70A 4CV0A 3PV0A 4S05A 1VHQA 3CXUA 2AI1A 1JVMA 3HJRA 2VNJA 5E79Z 3I55V 5I6DA 2FSFA 3OT1B 3LT5A 2GGSA 5KVQA 2YHAA 1V3VA 3LBYA 2C54A 3LSYA 1EZVH 3WJ2A 4Q0MA 3ZVMA 4FI3C 2BEVB 5EMLA 4W5QA 1G6OA 3G1TA 3WKBA 3UHJA 4UUQA 3OBIA 1KYXA 2E74B 2BRUC 5IK2A 4LBWA 1JA0A 3ICVA 3W5SA 5GIPE 2OXRA 3E3AA 1O4VA 3WOHA 3T06B 2PQMA 5TPWA 4BO2A 5HJ2A 4S24A 3ZBQA 3DG9A 2Q5FA 2ZBPA 3WNCA 1BHQ1 3WLMA 2YNMA 1F8XA 3MA0A 2XYVA 4FXPA 1H1DA 2XDQB 1JZSA 1EM6A 3N07A 2A5GA 4D7SA 1FX0B 4IJUA 3DMTA 3T9DA 4WWHA 2EGUA 4IICA 3AJ8A 1DIGA 3QKIA 3KD2A 3OQ6A 2XPCA 1NJIW 3SPGA 1F1JA 4P84A 4KP7A 4CE6A 4YUZA 5CT8A 4P3YA 1TC2A 3GEGA 1KI3A 2P67A 4R2IA 1C9MA 2ITDC 4H0CA 4OX9O 3AJAA 2GEKA 1N6RA 4OL0A 3IT0A 3L01A 4C2UA 1LQ2A 3A1DA 3F2IA 1OZAA 3GNTA 1BCRA 1HE8B 2A1IA 2ID8A 3D0OA 3L4BA 1P61B 2HP8A 2REOA 4ZO7A 1JX9A 4LIPD 3V3KA 3IDOA 4IDGA 2TMDA 1XDGA 1R88A 1TOAA 2V7UA 2Q7DA 3PGJA 3N74A 3B1FA 2GJAA 3F9IA 4INOA 4Y2XA 2F3RA 1MQ9A 4OTZA 3MCVA 3CMEF 1HT0A 3ZCPA 1UJMA 5HYVA 1Y1RA 2ZSFA 3OIUA 4LQCA 2IG8A 5CB4B 1XJ5A 1AN0A 1UFOA 3RGWS 3DE5X 3HVUA 3B7GA 1Q3KA 1JAXA 3HDGA 4UDNA 2O59A 1W8IA 5KJ1A 5AVZA 1OLOA 3T6KA 1EBFA 2VOEA 3KXLA 2HYDA 1ZX3A 2ZS7A 3JARB 3I2FA 3AWIA 4XRRA 5FNZA 3CXCF 5KSYA 4YI5A 3SEQA 3ENZA 4G0YA 3N87A 5L4LA 5AQ1A 5EG5A 2FMKA 4IDAA 3V4ZA 3SPJA 1NGSA 2HRUA 1EXNA 1PI3A 1P45A 3LHFA 4MPDA 2SCUB 4B7KA 3D1LA 2MSCB 2HKIA 3D4NA 3FN4A 4NLLA 2DU8A 1T9AA 2IU0A 3AXSA 2IW3A 2HLDD 3PGA1 2G9RA 4TXNA 2HF7A 5T4FA 5H9WA 2A14A 3PJDA 3DE0X 1FS0G 1F8UA 4DYHA 5HJ7A 2FZ5A 1ODJA 3DOIA 3SC3A 3CU5A 3OFJA 2OILA 3ZXSA 3HCOA 2QKYA 3N9IA 1OVMA 4HGNA 2WA1A 1I5YA 2X9LA 3U0OA 2V7QG 3F0TA 3SZUA 4Z4EA 4OXYA 4UD6A 5ALFA 4I6JA 1KO1A 3T2MA 3PRHA 1LS1A 4H7PA 3L92A 1BQ4A 4G85A 4PZCA 1ZESA 5JROA 2ZD9A 1WUHS 2Y92A 4EMSA 2ZIGA 4J16C 1KI8A 3I45A 2EVWX 3USCS 2P30A 4BAZA 2IK8A 2GN0A 2QVYX 4RCVA 1SKBA 3BB4A 3DAYA 3H16A 2H16A 4MVWA 4RF3A 3II6X 1NZDA 2CJWA 3V8PA 2XMCA 4I55B 2H1LA 1K3TA 3P32A 4F1WA 2MSLA 4B3RO 3CCVF 2C9YA 4X20A 4YT5A 4UHHA 4GUNA 1ZGZA 2XR1A 4DW1A 2WLSA 4A8JC 5LBIA 1NUHA 4N49A 4YXWA 2JI4A 3ETJA 5AOCA 1H0HA 2LPMA 5A3SA 4EH1A 1BN6A 2X7JA 3AI7A 2C2AA 2DCMA 3L0YA 5IAAA 1IEVA 3NNNA 2QX9A 3MTJA 4C4PA 3EWSA 1XZ8A 4LH6A 3TAXA 3CWQA 2ZS8A 4EMBA 4KBGA 4WEQA 3THWB 3W7XA 4OL9A 4KVZA 2X22A 1VKNA 5EE0A 5DASA 2JRLA 2IE8A 1E98A 1Z2AA 2P2ZA 2IC5A 3DT6A 1H85A 3EZ6A 2V0CA 4NG5A 1ZH0A 1VA5A 4QFCA 5C34B 3QPWA 4ZP1A 3KSZO 1EX9A 3MOGA 1QFXA 1SBHA 4NDNE 5AKKA 2CMKA 3CUUA 2VA8A 2QGNA 3FNGA 4HXGA 3RU9A 3B6NA 3A10A 1C7IA 4W5JA 4GL4A 3QKUA 2FF5A 1E6LA 1XZBA 4KUGA 3U5TA 3S03A 1VQ9V 4IV5A 1OU0A 1LBSA 4Z1OA 1D4ZA 3BWXA 3V9PA 4BP9A 1E89A 3OEEG 5LQSA 1NASA 1RZUA 3WLEA 5LL6Y 1RAHA 3TZHA 4ZOQI 3MAGA 4FM9A 5J5CA 2EZUA 4BNKA 4ZYUA 4ND6A 3OU6A 3ITEA 3K96A 1L8AA 4Q7QA 4IJ6A 5DNAA 1NH2B 1XZDA 5L45A 3J81k 3VGJA 4YAIA 4ITUA 4B09A 4HD8A 1ULSA 4JI7O 2ZBRA 4UVDA 4B3SO 1HV8A 3NORA 5LKAA 5CA3A 2Y4TA 2BJVA 3P9KA 3VZQA 1HURA 5EC1C 1DBFA 4LVOA 4X5OA 1NX6A 3VR4D 4G8CA 3PJEA 1NA5A 2VH1A 4S1WA 2C77A 2JDIA 2QZ9A 4LWPA 4RTLA 5TX7A 1V43A 4GAEA 1XF9A 3E8BA 4Q4CA 1N25A 4WZAA 1T1GA 3VO2A 4CIBA 3F5SA 2BKVA 5FWXB 5J4YA 2XTAA 1FTNA 1OAPA 2CHSA 1N2ZA 3QGMA 2FPPB 3DD5A 1YFKA 4RF5A 5EE1A 3K59A 1YMVA 3LUHA 5AK6A 1W4BA 1D07A 2C31A 3RS3A 3G13A 1MDFA 1Z7GA 1TVEA 3ONEA 2N1BA 1KEKA 1RWQA 3FOWA 4HB2A 5COAA 1MB0A 4LZZA 2NO6A 3S27A 4C07A 3B36A 3F96A 1ZMRA 4ZICA 2I8AA 4B84A 5COBA 2Y68A 3X44A 4AQ7A 1U97A 1YMQA 3RQSA 1RKVA 3WISA 1UP4A 3HY6A 1PT5A 4C89A 5E2AA 4I9WA 2NSDA 1ZC4A 4HLUC 3ZRXA 2RIRA 2CUKA 4M9RA 4RKYA 3VH2A 3L0SA 1NRWA 3EWNA 4JB0A 1M57B 2XOKG 2YXHA 3UZUA 1FU7A 1V39A 3GC6A 2AK2A 2ZE6A 3IESA 2KG4A 1U6KA 5A06A 5HQ3B 1BVUA 1N7JA 1RVDA 2XGJA 1THZA 2Y48A 3IDAA 1KS9A 1QZ3A 3NP9A 5T3YA 1L4UA 3AJEA 3CC2V 1YS6A 2ADQB 2IITA 1Z35A 3JATA 1E3SA 1RBYA 2CW5A 1CRZA 1R0RE 1P2BA 4AURA 4LOKA 1L1RA 5E1BA 2JHFA 4G81A 1SKUA 1IM8A 3PD7A 3E5MA 2QOEA 4AXXA 5DM4A 4ND3A 3CV3A 2UYOA 2JLXA 3SF8B 4D9MA 1JDSA 1OKKA 2JL1A 4XM1A 2XGOA 5BN3B 4JH0A 1NH2D 2XMSA 3MHSC 1X3LA 2FI1A 2NX2A 1XEWX 1E79G 2A5DA 3KJJA 3VAYA 1X8JA 2TSYB 5LYJA 5EWJB 4U63A 1DWOA 5AKXA 3JXEA 3UJ6A 2EZOA 3W2FA 5B7QA 2Q5CA 1S0UA 1H2GA 4EBBA 3CVYA 4MJXA 2WY2D 4HRYA 2W6JA 3GLUA 5DHFA 1XFDA 4U5QA 3G49A 3PF9A 1P7BA 2BFNA 3I62A 2QBYB 1W8DA 2A8YA 2MHCA 1U3DA 4ND1A 1KRXA 2FTKE 4PHHA 3NMUC 3ND9A 1M9NA 4Z0TA 2H4JA 3G3EA 5JZVA 5AJHA 1Z8FA 2AVDA 5J2TB 5JJJB 1JZQA 3U3XA 1JF8A 3LX5A 4XASA 1DI0A 3D81A 4RSGA 2PLAA 3X1YA 3PGXA 2A06H 4KVFA 1P19A 4AY2A 4GE3A 5AW6A 4FLVA 2YYAA 4N48A 1EXMA 3N2ZB 2M2IA 5BVHA 3C3TA 3WB9A 5DGCA 2C8LA 2Q9UA 3WMRA 3QITA 5TEVA 1RSOB 1M10A 2BVNA 1P9NA 1XBLA 3V1NA 4DB2A 1EAMA 3WYBA 1Z4OA 5CYOA 3UA3A 2O3JA 3O9MA 3DNFA 5FO1A 1AHPA 1R12A 4F3CA 2I5PO 1SCAA 2Q1XA 4C7OB 1IEQA 4K6OA 3DEJA 1YDWA 3BTOA 2VF2A 4U7TB 4W7HA 3ORFA 3I05A 4C22A 1TVKB 2IIPA 3LUBA 1EVEA 1A5ZA 1U8FO 1UL1X 4FZ1A 2VYFA 4CZZA 3K5IA 4RNDB 5FFFA 1EP1B 4JOSA 4QYSA 4CN9A 4FMDF 3IC7A 3AG3C 3PC7A 5HS4A 2DEUA 1C50A 4DQKA 3HB5X 3K15A 1AUQA 3T1OA 2PX4A 2ODNA 1XA3A 2PJDA 2QTSA 2JZNA 1M90H 4AF7A 5HUQA 4IX1A 1DBIA 2AXQA 2H8CA 1ZAUA 4HNAA 4G86A 4KUMA 1C8LA 1VFNA 1T9BA 2NYRA 1EHIA 3SXPA 4A2PA 5TJHA 5HTKA 5JCOC 2QSAA 4Q03A 2OBYA 5H6RA 2BFDA 3TKLA 2IIBA 2QW0X 5IAGA 1SXJB 3LKDA 5BPFA 1YDMA 4DZTA 3RYFA 1VQ9F 3EG5A 2CHQA 3DOCA 1NM5A 1NBOA 3FFMA 3D31A 1E8NA 4FT4A 3JASA 1DFGA 1ZOIA 4M21A 3IVMA 2IJJA 3BTUA 1IBCA 3VKHA 2Y0IA 4DRZA 3RFRA 1UDXA 3R3WA 5K20A 3COVA 4OQ4A 3WNDA 1XMXA 4I8IA 4Y1GA 3D3QA 2QGZA 5HY0A 1XOUA 2Q7HA 3GJ5A 5H8WA 1J95A 3CN7A 4N0DA 4X7RA 1AUXA 4JSYA 2GHYA 3T54A 1A8IA 5HBRA 4F3RA 2ODEA 3ZNQA 2CLDX 1RI3A 1Y6GA 1JE1A 3CXCU 4JJIA 5B5SA 3ZWNA 4J9ZB 4AMVA 1HTBA 2IYXA 5DXJA 4ND4A 1Q7BA 1PVDA 4KLNA 3VA7A 3INNA 3WB0A 4U2DA 1ZHOA 2QLBA 2WSMA 1LFAA 4J0FA 2F3SA 2VT2A 3SR3A 2GZAA 2RGEA 3LO5A 4YRQA 5HKLA 4EF6A 3C7AA 5CEFA 1XAIA 2ZSBA 4RPIA 2D5IA 3R7WB 4HATA 4JI1O 5IEJA 5SY9A 3I6YA 2W2LA 3FB6C 2ECOA 2YXNA 1IEWA 2QU8A 3PUIA 4DAEA 2Q3HA 4UZEA 1S6YA 3QELB 1XNQB 3LDEA 3F0FA 4Y6SA 4R1UA 1YITV 5HS6A 1E7YA 3A4IA 3EF3A 3ZDEA 1FFWA 3KK0A 2G25A 4CIVA 4X61A 3DVAA 5JALA 2DWCA 2QRMA 3U80A 1Z6TA 2YXYA 1SOMA 4K28A 4X3CA 1U3LA 13PKA 1RAIA 2I33A 4PN3A 4N6NA 1DXHA 4L8GA 4E94A 2XE4A 3WC4A 2OENG 4KFCA 3JQAA 5CUQA 3IEKA 4BZXA 1JLLB 4MVRA 3QHDA 3T1YO 2R6DA 3UAOA 3RVNA 2W2PA 4FFBB 2G38A 4HDAA 4EB0A 1OPXA 2DRIA 3LNTA 1P1JA 2Y1EA 3P0IA 3E8GA 4DV2B 2ZBVA 1WZ2A 1ID8A 1VHLA 4IQ8A 1ANKA 1M5IA 1SXJD 5HW0A 1J21A 1F0PA 5KOHB 4R40B 3I9FA 5F1KA 4JKYA 1Z25A 4I1VA 1WD7A 2CXHA 4ZJPA 1BKYA 1G20A 2Y76A 4WZBA 4YK7A 4M9ZA 1K5SA 3MNFA 3QBDA 1RC0A 3OX1A 1P17A 3AVPA 2IPNA 2J30A 3MIIA 2Q3LA 4KAAA 3S02A 4RD0A 5KYWB 2EL7A 1NUQA 1ITZA 1SVSA 3PFKA 1DS6A 3LCUA 4CEHA 6ADHA 4XH9B 2ZUUA 3GVPA 3HXLA 3L18A 4UAVA 1RKQA 1HNWB 2X1MA 1ZM3A 1NSTA 3EVDA 4KXWA 4I4NA 3PNVA 4G24A 1GGMA 3JYQA 3ANTA 4PLZA 1CJMA 2X14A 5EB1B 4MUXA 5B1IA 1EFKA 2Z6AA 3CW2A 5CT5A 2VF5X 3BPSA 3TLEA 1XELA 1XU7A 3DLPX 3R23A 5KS2A 4WBNB 4LWQA 3RS2A 2H92A 1LK0A 3LUCA 5A2QN 2F93B 4NPHA 5LIRA 4IH1A 5FWDA 4PWTA 1AK9A 4WZ6A 1S0VA 3OKCA 5DGTA 1WSDA 2IYOA 2XE7A 4KLZA 2BP7A 4TT3A 2BLLA 2JPDA 4OYHA 1Y4UA 3B1XA 1L5NA 4JQYA 5KSOA 1U8TA 2HY7A 4KDFA 4J0JA 2HBYA 1VFPA 3QUTA 2FW7A 3R3YA 4F56A 1YUNA 2FSVC 3T4UA 2H51A 1REQA 3ZE0B 3CE6A 4OAOA 1SZXA 3RROA 5CBHA 3MT8A 3GUZA 3G71F 1IY9A 3W7WA 3PHLA 1LTKA 3GLGB 3BEOA 4YMWA 1BZYA 1E6KA 3ZH2A 1MABA 3WFZA 3TVYA 4RDIA 3D36A 2C9MA 2ZM6O 5GONA 3PNBA 1D2RA 4HPJB 1YNSA 3E86A 3BA9A 1VJDA 2W2OA 3GRAA 4RHAA 3FCCA 4DXWA 1K5HA 1AHIA 4ZT5A 1GRJA 3B6MA 2E1PA 3BMQB 2JAWA 4C4WC 3D2CA 1ZCAA 3DBOB 3HCEA 4P5PA 4Q7MB 4JXJA 5DBIA 4RTSA 3LP6A 5H70A 1OZHA 1NI3A 1AQJA 1GJRA 4HO1X 3L07A 3OT7A 1Z83A 3S2EA 3W7UA 2NVUB 2YQ5A 3D5EA 2WT8A 6GPBA 4DM4A 3TSYA 3LUDA 4I99A 1PL8A 3SBXA 2HIGA 3DEKA 4J0IA 1XZQA 4HDMB 3THYB 4D3FA 1YV9A 4BW9A 3MGCA 2ZANA 5B3JC 2X1LA 5KNCA 4ZI3A 3ZRWB 3ZS8A 2G36A 3R7NA 1SQQH 3T7KA 1UFVA 1RWBA 2FPGB 4MQFB 5BMVA 2RHMA 1AQUA 1P0MA 2ZIVB 1TCUA 4KHZA 4G1UC 2G63A 4Q3NA 2W6CX 4UBJA 1PQWA 2PMFA 4R2XA 3M6XA 3V3TA 5ILQA 3ANNA 4FD2A 2QMEA 1UMKA 3UQZA 1H0RA 1NP7A 3CNBA 2PZGA 4YUVA 5LL6P 4YXWG 1F9AA 5C8XA 5CB4F 3E7DA 2B8EA 4R3NA 2HMVA 1GG2A 4YRNA 2WJAA 2I03A 5B6IA 1IM2A 3BJRA 3BJZA 4QOIA 1QCCA 3OTGA 1LEHA 5K3EA 4JK3A 5I4CA 4DLVA 3EIOA 4ARZB 3P71T 3BXEA 5U4XA 4D9CA 4C43A 3LX8A 4MW4A 3DBRB 5GJCA 5AJWA 3KEOA 4QLBA 5EGSA 1N5RA 3DMFA 1CP9A 5F73A 2A9PA 1TT5B 1ECGA 4R98A 1E2GA 1YRHA 1E60A 1SQ5A 4TS3A 4DMCA 3GJ8A 4LXIA 1VGVA 5EYPB 2HNAA 3DLBA 4LPKA 1JDPA 1QKKA 4WCFC 3N2KB 1JTVA 2XADA 3LXMA 4PQEA 4LCJA 1ODCA 2IYVA 4HI0E 2VXCA 2QK4A 2GTIA 4BO9A 2RCVA 1HYGA 4YGYA 3CZQA 1Q7CA 5JYEA 2C8JA 1I5XA 2YWGA 2ZI4A 1E9DA 4FGUA 4GRIA 1W73A 5G4KA 3CPEA 2B6NA 3ERCA 1Q15A 4BO4A 3H1IH 2CC2A 1Y7TA 5F77A 1XNHA 4YR7A 1FP4A 1CNEA 2JAHA 5FL7D 4AI6A 3UIEA 3EGXB 3OEWA 4GM1A 4CL2A 1GH6A 4CGYA 1JS1X 2ZLBA 1Y89A 1OWPA 1BDBA 5LBQA 4BLPA 2RONA 3QYFA 1RYHA 3ZYZA 3E9DA 3VJRA 1J0XO 2R7MA 2IUTA 1VKHA 3N59A 4J7ZA 2CFTA 3W4JA 2QVGA 4E5SA 2IXGA 4MW5A 2JDIG 2BMFA 1Q43A 1D2MA 3OUFA 3KTAB 3P2OA 3CWCA 2W9XA 4DR2O 2G7ZA 4IF4A 4XX0B 4PFKA 3GIWA 1GZ5A 1AA9A 1V9PA 4MWBA 2JKYA 3PUZA 3MWKA 4M6WA 1CC1S 4KN9S 3OQVA 1GUZA 2A79B 1KI9A 1R6BX 3V4DA 4PDLA 1AROP 4JHLA 4NFHA 1UANA 3PJGA 1WHTA 3KFLA 4KQKA 3HM9A 4DL9A 1BMQA 1NW7A 4FS8A 4HN4B 4IV8A 2P78A 1XCOA 4UHEA 3LBIA 4POAA 2GPBA 4LJ8A 4IHJF 1S72F 1US8B 2IHYA 4DBLC 5JR3A 2NZYA 1DU4A 4A1OA 1CUHA 5EL0A 1W76A 2BEKA 4YRDA 2CVHA 3KPVA 1E3WB 3HKBA 1IN7A 1LSSA 3K6KA 1RXVA 2FPWA 4Z7NB 2IVZA 4FINA 4WL0A 1KIFA 1IXSB 4GXNA 3AIIA 2VK1A 5E4JA 3DOOA 4YUXA 3TBKA 4BKOA 4Q1CA 3DTTA 4BDSA 4HAMA 1PTKA 3EEIA 2MSEB 4Z51A 3RSCA 1KH1A 2OZVA 4AMBA 4RK5A 1O9GA 3EVTA 4Z4CA 2W7TA 2BTQB 1RQLA 5HRCA 1IV2A 4JLVA 1V45E 3HC7A 5ELXA 5KQPA 3R5SA 1MT0A 1M33A 2XQKA 2PT5A 3ZWPA 1ZD3A 3WGQA 2CYAA 3T7RA 4ZU1X 1ZIPA 3CBGA 4MRNA 4PZPA 1E96A 2J9ZB 4COKA 5CFLA 3H1FA 4FOOA 5CH3A 1EWRA 3OTOO 2GRAA 2VHWA 3OO1A 1WWKA 3Q3IA 5AK5A 3VZSA 3HWUA 1YKFA 4JBLA 4D7AA 1Z26A 4Y2TA 3MMPA 2JS3A 1BX1A 4YJDA 4Y6GB 2OAEA 4AFNA 2OXEA 3AG1C 2ZP1A 3QE2A 4DBLE 1T9DA 3DOJA 1R10A 1O5OA 1S4QA 4X3PA 5B1AB 1E3TA 5DCVA 2W6JG 4DEVA 3IXMA 1RYDA 3QW4B 2AWNA 2QEQA 4XVRA 3EVZA 2B3DA 3NALA 1IXKA 1B23P 1ESZA 2RHWA 1TD1A 3VC2A 4ZAFA 5F52A 4J2OA 1HE2A 5JD6A 4KLRA 1EZ4A 4EUKA 5CR9A 3GEPA 1N3IA 4OHRA 4UREA 5KNLA 3COZA 3U2QA 2BGTA 3QU4A 4DV6O 1W55A 3OBYA 4RETA 1DKQA 1U4OA 2WLNA 2NTYC 2N0SA 5KSPA 2K1EA 5IYZA 3Q7TA 3GVIA 1D8AA 1P0CA 4ROTA 4IGEA 3VSEA 2AG0A 5H3LA 1YA4A 2AOWA 1FUIA 3VVMA 2PZSA 1UBMS 1C2YA 4DHEA 5HBGA 1YZTA 2B30A 2OSBA 3IJ5A 1VDMA 2PS3A 2WA2A 3CXHF 4I4LA 3TMYA 2OECA 2HKOA 4Q7JB 3CIFA 4D4MA 1QHEA 3E82A 1COWD 3Q9NA 2J3LA 3MTDA 5KLVH 5D3MA 3T3DA 1G9SA 1YF3A 1CY6A 1BXRB 3P9XA 2B5OA 5CXQA 4DJJA 2V3CC 3IRVA 2QU7A 1YFZA 2JGIA 4B6EA 2YHIB 4EVIA 4PPFA 1DG3A 5I3CA 1KMMA 4CBCA 2CK3A 3E61A 1OCZB 2GDZA 4QM6A 1ZO8A 2LKCA 4YO7A 5G41A 4HP8A 3IQWA 2NYAA 3IVXA 3F2VA 4QNRA 3WGVA 6CHYA 1FRVA 2AF4C 2IPOA 1WVIA 2V6BA 2QWRB 4V0LA 1JDTA 1HFEL 2RI0A 3LLCA 4ZVVA 2RMKA 4V0SA 4EHNA 3KZCA 4Q3AA 3PXGA 3O91A 2H94A 4ZC1A 1R7RA 1T29A 2R9IA 3KQSA 4HTFA 3CQ9A 4GOJA 5K3FB 3Q0TA 4DR1O 1NOKA 2KMLA 3WJQA 3CHXA 4DRYA 1WU7A 1I3OA 2ZDHA 1FLDA 3OZCA 2QE6A 3FNQA 1PWXA 3C7CB 4DR7O 5E4FA 1TFRA 3Q8LA 1NNEA 4H60A 2DYRB 2YICA 4UMEA 1STOA 3UH1A 1J9GA 3G0OA 2CB9A 4DV0B 5M04A 2A94A 3E5RA 5ICMA 4DXAA 1I3CA 5DT2A 2B7BA 1BA2A 3UO3A 1VG0B 5J2TF 4QIHA 5C7IO 4JENA 2Z98A 5AKHA 1VHAA 1WE2A 4QUBA 3FSEA 3AINA 4EFLA 4EQ6B 3MJTA 3Q3CA 3OTFA 4YN3A 2UVDA 4DWJA 3RBZA 3ZHUA 1U2PA 4HT3B 3AF2A 2IV3A 3CCFA 1ZGGA 1B8OA 3MRSA 1SU6A 3EJWA 3BKXA 4ZALA 2I4IA 4OFWA 4CKCA 1T6BY 2ZT7A 3SIXA 4B79A 1NNSA 1A1VA 2VDWA 1W0JA 3OMIB 2R8YA 3LSSA 3KQPA 1WHSA 1N3YA 3D8UA 2WR8A 3M1IA 3LGXA 1JJIA 4GRAA 2PM8A 4HAUA 1KO4A 4MGZR 3VBBA 2E4AA 2JLYA 5I4IA 1GGFA 2PMDA 3PPWA 1Z5UA 3KE1A 2NP7A 1IJBA 2M98A 2OXCA 5K99A 3CYOA 1NZFA 4C4YA 2YZMA 1UXJA 3FYUB 3RV3A 4K03A 4R69A 2NV0A 4OA8A 1Y0BA 4C0AC 3KEQA 1UJ5A 1YC2A 3HU3A 5BSWA 1HNXB 4JYCA 5GTIZ 4DR4B 3CNQS 3KV1A 3FAKA 1YR6A 2HO4A 2NP6A 4UCUA 1K9MW 4ZYZA 2R1VB 1KPGA 1OA0A 3A1UA 3SVTA 4G4IA 1OFIA 1FJGO 1V5IA 2WM9B 3K94A 3A1TA 4Q1DA 1T26A 5GQSA 2BJHA 2ADOA 4DMLA 5B66Z 4FLEA 4XWYA 3TLGA 3SYRA 2HOQA 2PT7A 4F6CA 2FPIA 1Z2NX 4B82A 3DUFA 3ZNPA 3U09A 3C3YA 1R37A 4EPTA 2EP8A 1AJEA 2H9YA 2XTZA 2BSKB 3STXA 3U19A 1J8VA 5TMEA 1ZSPA 3SE7A 4PIVA 4FMDB 1H9BA 4CMEC 2B20A 3JU3A 1YJQA 3DOFA 4GS5A 1NBMA 3P5SA 1DAOA 4BT6A 1X1RA 5L3VA 1Q3TA 3VVCA 2NO9A 1SCIA 2QXTA 3MTQA 3USES 3MELA 1DIOB 4JI2B 1GTJ1 5AVOA 2IBTA 2ZT9B 1O6GA 1YDFA 3EG9B 1IOWA 4PGAA 5FAXA 5GTHZ 1S9DA 4BNDA 5LXTA 3O0TA 1VHWA 4Q1VA 1N2IA 2PNJA 1EQ2A 5BYBA 4CBVA 4MW9A 3E84A 1E94E 3QF4B 5BRAA 2BGWA 3QKSB 4FYPA 3T9BA 2GTAA 1KP3A 3L06A 3KHKA 3HR8A 2P2GA 2GJ8A 1UJ6A 4MV5A 2NPFA 4G67A 1PDWA 1H42A 2ORED 3PPIA 1XZMA 3IPCA 4F4JA 1CTQA 1ZIXA 3F5MA 4EJ2A 3PD1A 2JKVA 4ENVA 1K63A 1VPTA 1FTWA 1L8QA 3K53A 3DS8A 2QTFA 4TT3G 4MQ6A 3IB6A 3S0HA 4Q37A 1AJNA 821PA 1WY7A 2OO5C 2GCPA 4F4LA 4TXHA 3WK5A 3UTCA 4JI0B 2XCTB 1LBTA 3QNUA 3CC7V 3DMGA 3AT1A 3VMFA 3L7IA 4GBGA 1NN0A 2WLLB 3TDMA 3SDSA 3DZKA 1DKRA 3KCYA 1KH2A 1FRZA 5HF8A 4UATA 3CUTA 4R8MA 3DCYA 4RL6A 3PEFA 1II8B 2L35A 3G68A 3TF5A 3TCKA 3UT6A 4MUAA 2DERA 3PXUA 2IYLD 3PNPA 1KDTA 4BNGA 1ZG3A 1MABG 4ICIA 3TR5A 3N0RA 4DHWA 4QFBA 3PPXA 3O94A 4NBLA 2HMYB 4LAFA 2KTVA 1XXHB 1QQ7A 1KWGA 1BMFA 4PQRA 5HWEA 1E99A 3RKSA 3OR7C 4YFVA 3WRXC 1VKOA 1EESA 3QUSA 1AO0A 2ETXA 4RJLA 2CL7X 4YUYA 5IWCA 3NR7A 1CUAA 2REXB 3A4TA 4X60A 4LE2A 3WXMB 3RIGA 2YWDA 4XCQA 1C3LA 1WMBA 2B94A 4C3VA 2GZ3A 2XDWA 2GUZA 5DYGA 1VKRA 5EJGA 2ZRKA 3AG2C 4HNUA 3DHNA 4OSEA 5DEOA 1MMFB 2UYKA 4CKEB 1NQAO 1RMTA 3JAMN 7GPBA 1PZFA 3BE5A 4AWBA 5EP4A 1PZEA 2BM1A 1Q1ZA 2XNDD 3G2IA 2XCQA 2BF7A 3LUJA 4J8PA 4XRGA 1MJ5A 1BOFA 721PA 3QPAA 4WCEV 4Z8YA 5EZ5A 3ZEAA 4TKUA 1RCFA 2PS1A 5AVJA 1U0RA 5HIIA 1R5BA 2NTEA 3C1UA 3KPJA 1E1CA 3B5IA 4XXHA 1G1XB 5UKDA 1J2RA 5TF4A 2SKDA 4PX2A 4KR7A 5DHAA 1IWBB 3K5MA 4PV7A 2OHWA 4D6XA 2NTJA 2Z08A 2C97A 2AYZA 3FMVA 5E2IA 4MKIA 2UU9O 3HRHA 1K8RA 2ZS9A 4DF3A 1TTTA 1ABEA 4FOSA 3NG1A 3TETA 1HLPA 4BZQA 4EA7A 4IP0A 3SHQA 3G6EV 1IEXA 2OMEA 4HYEA 5IAJA 3RTGA 2X3FA 3OCYA 4HS9A 2JA2A 5BN4A 3BABA 1N0JA 2XE6A 3IHKA 3FPIA 3I92A 3PUXA 3IR6A 4BFVA 3RE3A 3WGZA 1ZK4A 1KOGA 1KI2A 1KKCA 4GPZA 4UBOA 3W3AH 4CKWA 3CO5A 3K6SB 3KOUA 1HNZB 3TR0A 3TM5A 5AUNB 3C16C 1KSGA 4JMLA 3BJEA 4WOJA 1WTCA 4Z0PA 1WPRA 1OFUX 1WZCA 3FWPA 3PK0A 1OUMA 1DT5A 4PHCA 1N7IA 4QXMA 1LUWA 3ZVRA 4DLUA 3LKBA 3KL2A 1Z36A 3KZ1E 2CMHA 1EWTA 2JCBA 1EE1A 4KV7A 3JTMA 5ALQA 2GN9A 1E9RA 2HHHB 1UPCA 1I0HA 3ROPA 5JECA 3LAWA 1GAXA 4G8JA 3U4GA 4ARVA 1V16B 3KQWA 4P2ZA 2BE9A 4D8TA 1K7FB 2J09A 4JBWA 1RTKA 4G36A 2OOKA 1ES9A 3QVWA 1G1AA 2LQTA 3NGXA 3LZ6A 1HDOA 3FHJA 5I7SA 4NV0A 2QSJA 1U5BA 4CWAA 1M2JA 2PFKA 1K9VF 3OZ7A 2VRZA 2KBEA 4DG9A 2D0DA 3HFJA 5JWRA 3ZR4B 3HKCA 2CYCA 4XI9A 3V1UA 4OGLA 5HFNA 4R6XA 2Z4SA 2D5LA 2OGUA 1CUDA 2IZ1A 3G5TA 3UUFA 1UOOA 3T1NA 2NVOA 2Q7XA 2AW9A 1GNPA 3IC5A 1GLNA 1ZUNB 2Z1UA 2FE4A 1G8KA 5A02A 1SUIA 3N28A 3VRHA 5LQDA 3S6JA 4YV1A 4HJXA 1QGED 2QPAA 4RV9A 1PYGA 1CUBA 1YQEA 5JMWA 2YWBA 1RJWA 4C6TB 4HX2A 2YIBD 3NBZC 1ATZA 4F71A 1YJAA 1Q21A 3FB1A 4GWGA 3FYTA 3L8FA 3M1YA 1Q5PA 4PFQA 2QE7D 3HA2A 4JL8A 5K5EA 1PT9A 4G1VA 2OV1A 4RHXA 3BH6A 1YTUA 4NOLA 4RE6A 1HH4A 4I9HA 1PL4A 1X87A 1UM9B 3OP4A 3V1KA 2QWNB 2ZBQA 3IT3A 3CX7A 4A6DA 3TTYA 3L7OA 1HKUA 2PWYA 5HJEA 3V97A 1Z33A 4PRYA 2UUBB 5SYNA 4EP1A 2MCFA 1KYWA 3CEJA 2H3OA 1EUCA 3IXLA 1P6XA 3UICA 3UKDA 5BT8A 4V1CI 2XZLA 3MJDA 1NVEA 5CTJA 1YA6A 5J40A 3ME5A 4HAWA 3DLCA 1QPBA 4KOAA 1VE6A 3R3XA 4BV8A 4CI9A 2JRIA 1IRIA 3CC7F 4Q6WA 4I6EA 4ZZ1A 1MO6A 3W06A 2L2QA 3W79A 2FUNB 4B08A 4AJPA 1Q1BA 4P58A 1I51A 2WFLA 1XP8A 4FBLA 2H0AA 4CS3A 2HCFA 3NHWA 4QBIA 4P30A 3FHLA 1RYYA 3LDDA 2EYUA 3OUSA 2AOVA 3PUJA 3N8GA 3BWEA 1PF5A 5JTTA 5CFZA 1M0SA 1ZH2A 3PR3A 1UBSB 1E66A 4D9KA 4QTXA 2YCBA 4JP1A 4DUGA 1P2DA 3HJUA 1YZNA 1E69A 1E6EA 3M5PA 4P4TA 2IYFA 1JEOA 2HTEA 4IZHA 1ZRMA 3FMGA 1TVMA 2O4UX 3H6KA 3F46A 1SUPA 1DCTA 3GCGA 2XD4A 1OI7A 1H3EA 5EB0A 4ZQEA 1RM5A 3HQ4O 4K3VA 1F9EA 4GMHA 3IH5A 5TXGA 1FD9A 3H11B 1VMDA 3GJYA 2D2CB 4Q82A 3WAGA 3S06A 2WSLA 2QR3A 1EE2A 2V3VA 2WALA 4RK4A 2ZATA 1TA9A 3ESDA 1GM8A 4ZVKA 4U6QA 1NBEA 2JGKA 2RB4A 1R0LA 3SIRA 4HTAA 4JQZA 4DG8A 2PIDA 3WB2A 4CKZA 1PSZA 4G5FA 2Q3CA 1I1HA 3M2TA 1E0JA 5ANRB 3FOFC 3NANA 4PVCA 3JCZA 1FOEB 4JV5O 3AEXA 1UPAA 4IRUB 1WG8A 1ZWKA 1HOXA 4TMXA 3ETNA 1MJHA 1WAZA 3MYRA 4Z99A 1W3EX 4L9SA 4Y1RB 3ZXIA 4EK9A 3E9MA 3H1GA 4MV7A 2WZCA 2CK3G 2CV0A 5HWSA 1Y4ZA 1ISSA 1NI4B 1PS9A 2VQSA 2VN8A 1T1SA 2P3LA 4IHJB 2A0KA 1E32A 1TI7A 4FYMA 1U8AA 3K0GA 3UV6A 1KJWA 1ZYUA 1UOQA 3WQRA 2YVAA 3CCJF 3AI1A 1FXWF 2P65A 4DPKA 1A9PA 3KBOA 1YK0A 5D6OA 2JB9A 1ONPA 1Z0DA 4YJ2F 1Z6PA 2ANCA 2VPTA 4R1LA 2VPYA 1VL5A 5J4LA 3G2QA 4N4AA 4QFDA 5LMNB 4LYHA 1IXZA 1J2YA 3R7AA 1DGQA 2WB4A 3U4QB 2DUJA 3DTVA 1VLHA 4D57A 5FI0B 1M56B 3DLAA 2HF8A 2QT9A 4B1FA 3P27A 3WYEA 2NXNA 1J1ZA 3FSGD 1H66A 4TZZA 5REQB 4JASB 3O90A 1XI1A 4EB6B 4GCZA 1F7VA 3I55F 5BWLA 1T8RA 4TL7A 1OZGA 3PLAC 4LFAB 2WIJA 3U9SA 2IXTA 1YHYA 3D3WB 1T5SA 2LXNA 4BWYA 3G2HA 1IUKA 2XQJA 3LWZA 4IDPA 5EK0A 3OJCA 1VF6A 4HWSA 2VF7A 4Y0VA 1IZ9A 2YN2A 5KHOC 5F3WB 1E7KA 3AG7A 1ZBQA 1M8GA 5M29A 2C5EA 2RBGA 1XNJA 3Q7PA 4YP5A 3HK2A 4F5WA 1TO6A 3TLXA 1KMQA 4IGFA 4XDYA 2KB0A 1JB1A 2Y9MB 3PF8A 1ZMOA 2GLXA 2C2KA 4B4WA 3L8EA 2ID4A 3CLUD 2FKNA 1DFHA 3A1VA 3BY6A 1T0KB 4NAUA 5LYJF 1AGPA 3M34A 4BFTA 4RXMA 3ABKB 3VR1A 1UFYA 2XZPA 3ZKAA 1N5OX 3GUHA 3L6CA 5A0TA 4KO4S 2A9OA 5H16A 3O84A 5BUSA 3PXDA 4UUOA 1LSUA 2X40A 3EPHA 4IWYA 2NXJA 3GMIA 2X6CA 1XA4A 4L76A 1H47A 4O0LA 3I56V 5ALSA 3WLLA 4P3PA 1GPAA 4TN5A 3HP4A 1IU9A 2N04A 5DM0A 3OPYI 4M38A 4C7KA 2V7QD 1JN1A 4V38A 4WE3A 4AYTA 3IURA 1EFDN 1GNTA 4DMFA 4Y1FA 3KKOA 1V8ZA 3LGSA 3WL7A 2WYUA 3U0VA 4OEHA 2BM0A 2J08A 2B8WA 1MHTA 1HL3A 1NTMH 4UQOA 3R7SA 1E5LA 1XEXA 1JG6A 1Z9BA 4ALKA 4XR4A 2JD2A 1QAMA 5B4UA 4F6RA 5BNIA 3GB7C 2AMVA 2VJQA 1PR0A 2JCXA 2CGEA 1U1DA 4QT4A 4FBGA 1QZZA 1USUA 1UKAA 2A57A 1NBMG 1WMSA 5B1BB 2DF8A 2CSUA 1PYDA 4EVSA 5B36A 2ZQYA 1QGOA 3O93A 4LF5O 1K0FA 4CM9A 1QONA 4PAQA 3A3NA 3O8NA 5CD9A 4TV8A 3EXEA 3WSVA 1J22A 5GW7A 1ZUD1 2W2MA 1JPNA 1SCUB 4XARA 3OCXA 1QH9A 1FU4A 3BFVA 3H2BA 4RACA 2R65A 3CN9A 2OXIA 1V8PA 2VDVE 4FS3A 1I7PA 4A91A 3C3DA 2X8BA 2WMNB 1CS0B 5H7XA 4BIIA 1OH6A 4JDPA 5L7TA 3PNYA 3E35A 1YL6A 1U1FA 4PR0A 2GV9A 3KJQA 3WFIA 4YCBA 2JZCA 4I8XA 1QQ6A 2WF7A 5LUAA 3TOSA 1AZTA 4G0VA 1W88A 3O4FA 2NACA 4D44A 4H16A 2K9PA 7MHTA 1TYCA 2CXRA 2PX0A 1UKBA 2H5EA 5KU7A 4NBRA 3VPCA 1X39A 4M86A 1UBFA 1AS2A 2PBRA 1XHZA 2VYQA 3DZDA 3WICA 3B52X 4M49A 2Y0CA 1C7EA 1XN1A 2E3CA 1A9XA 5G4LA 1MX3A 5AW3A 5H3HA 3W6PA 5JPCA 4DIUA 1GZ4A 1RAFA 2YZ7A 3RQIA 5EJAA 1V26A 3BX1A 1T2AA 1E3JA 4OB6A 5BORA 1Z8HA 2WI8A 2XV1A 2VQFO 3OMWA 5B1HA 4OUDA 2I6TA 1Y63A 3FCAA 3KFXA 1AHHA 3QU2A 2PMCA 5DYNA 1PTJC 2V1XA 1T91A 4RHUA 1UT6A 3CY6A 4ZGGA 4GI1A 2D2XA 3U5ZB 2RBKA 1I6KA 3KLPX 4H2DA 4N5NA 3BT7A 1C1HA 5A2GA 3BMNA 1DQZA 5AJTA 3GYGA 2O8FA 2G5GX 3T7EA 3RB8A 2HRYA 3W1WA 3D59A 4YJ3A 1M0TA 5LU8A 2OCYC 4WLNA 2JFNA 2H1WA 4AJ4A 1DKMA 2YDYA 2P11A 3Q5GA 2X0LA 1QTQA 4IZIA 2RB5A 3TLMA 4OHKA 2DBVO 1X86B 3I6ZA 2JAXA 3SBDA 4XDHA 3UMVA 3CH7A 2AOXA 2P3SA 3D4PA 3LC2O 1NT2A 3ECAA 1JWLA 1OH5A 4HFRA 4CF7A 4BJHB 5KYYB 4W9NC 3HXKA 2G09A 1E9EA 1TAGA 1JDUA 1OTXA 2PKXA 2BMDA 5K3DA 5TQ0A 4QGPA 4C3UA 4PTLA 3QLVA 1NUAA 1GCUA 4EI9A 1SIOA 1G8GA 1L5VA 2AZDA 1Z88A 5KNBD 3ICXA 2YWHA 3BZUA 5FULA 1EPUA 1R9GA 1EM8A 2GNOA 4TRRA 3R4CA 2DFPA 1DUVG 3PR1A 3Q3VA 4L72A 4C14A 3FF4A 3AF6A 3I9KA 1XQWA 2UXXA 2EJTA 4QNMA 2R0QC 2YYSA 3D3EA 1U0SY 3R5TA 2OORA 5K0CA 2ZE8A 3Q2IA 2XLCA 1E8DA 4TL8A 5ALNA 5BMOA 2QTLA 2X0FA 2ODWA 2C42A 4YVFA 1BRTA 4AQYO 3I6QA 2Q6TA 3GFGA 2QNIA 2GTPA 4Y7CA 5BT9A 3TXSA 1X2EA 4BTEA 1U7WA 1NBAA 5ADVA 3OM9A 4N5HX 4IUDS 1TQDA 4A26A 3S2ZA 2VBFA 1SQVH 3QLEA 1Y6JA 1QVFF 5AHOA 5G1PA 2G70A 2V6JA 1FFBA 3ROGA 1E79D 3I5UA 2H18A 1VSVA 1KARA 4E13A 2X7HA 1L5RA 3L4KA 2Z5VA 3A1FA 4BJ5A 3GAZA 3VXKA 3UK2A 1QJ4A 4LC0A 1O8BA 2V4UA 3HNOA 1IUNA 2VP9A 3WYFA 3THXA 3SJ7A 5JQGA 5JZBA 4X62O 5KHKA 3UB4A 4ZVPA 1RPAA 4A03A 3ZU5A 4WKNA 1RM1C 1TAEA 4PQGA 1KAMA 5FBRB 2VSYA 4MUHA 4DT1A 4DJTA 3I56F 2ZZNA 5KA5A 2XUGA 1UJNA 2JLVA 3NP7A 2VDQB 4DJDC 1WQ1R 3IBSA 3CPQA 3P3NA 4GSKA 5I7RA 2Q0HA 2DJIA 2BV3A 5KO2A 4DZRA 5KNDH 1AP6A 1YRQA 3CC2F 1S3FA 5B12A 3TTVA 1XYYA 3UCXA 3MFYA 5EIHA 4L9WA 3JQ7B 2IXDA 3C5HA 3QNMA 2HNBA 3DXRB 4Q4HB 3UFBA 4EGSA 3U26A 3Q8KA 3IDSA 3F49S 2P77A 1BOOA 4HPWA 1CJBA 4WKOA 1QHHA 4DPMA 4KGZA 3X2QB 1HMPA 2L42A 1QX4A 4PDMA 4HQNA 4L8JA 1QIHA 3O9ZA 1C4KA 4B9EA 5GONF 4WEOA 1AMUA 4PLPA 1PNOA 3OTQA 3VIUA 2IUEA 2NR5A 4UTXA 1NX9A 3ZXXA 1H69A 5LGNA 3O8RA 5IJ0A 2XHZA 3N6RA 1ZZGA 1HE4A 3L1UA 4D0GA 4PX9A 3PPYA 2RKBA 1ADFA 4Q1BA 2F66C 4D45A 5ARBA 4RPHA 4KN8A 4XQCA 4E12A 3QENA 2XODA 2J3KA 3BMOA 5CIQA 3CCUV 3S81A 2VNAA 2B83A 4TKZA 1SHUX 2YXEA 1SZTA 2KHZA 1Z0UA 2WP0A 2Z83A 3RS0A 2VHZA 1Y3DE 2GD0A 2YMPA 4RJIA 3M9XA 4PSUA 3TECE 1VP7A 4J1TA 2FRDC 4NU5A 3EUAA 1CG6A 4NJMA 3DDWA 5BSVA 6ABPA 2J5KA 2R47A 4HJRA 1L5HA 1T6NA 4MDEA 3QY0A 4L2IB 5BMVF 1ISHA 3IJEB 1VL6A 1IXYA 3PJRA 4I7ZB 5K0GA 5E1MA 4M1MA 4D25A 5LB4A 2CUZA 3STVA 3CJRA 3UQYS 4MI1A 1GRRA 5HXUA 1U7PA 4KDEA 1OX5A 2VDUE 5A4DA 1ENVA 3R1IA 3HFGA 2ARHA 2BTOA 4HBGA 5GWXA 1JJFA 4O4JA 2Q4TA 4KSCA 5D1NA 1MEOA 1KVTA 3VU8A 2HDHA 2IJHA 1FMFA 1AN9A 5EIEA 1MAAA 2R62A 1YS2X 1SUEA 3NHZA 4OH1A 5FLXN 4BHTA 3GNQA 5AJUA 1SKVA 3RU3A 3CNEA 2VYND 4BAGA 4LSGA 3A3OA 3CB2A 3C39A 1C9EA 4H3VA 3P9QA 5KMGA 3MINA 2PX5A 3KALA 1KC8W 5FUVA 1MVNA 4Z6KA 2YHUA 4TMVA 2N42A 1IBRA 1AKMA 2AR7A 3TOVA 1GU1A 3M33A 3HU2A 3H4MA 2FWRA 5JXHA 3Q1KA 4LCBA 1KJ9A 5D3ZA 3BFKA 4F93B 2IFTA 5IUJC 3QVJA 5AH0A 3R3HA 4G0XA 5LJLA 4B8WA 1UQUA 3OETA 1OAOC 3W2TA 4L5BA 3GFPA 4K6FA 1XZPA 2D7CA 4TGLA 3K9AA 5AHKA 2EC5A 3ICOA 3GLIB 3D1VA 4JJ8A 3V4LA 3ILXA 1YDEA 2XT0A 3EFFK 4M1WA 3FA2A 3CF4A 3IAUA 2FLKA 4NXMO 1E2JA 2OOSA 3G2JA 2HJRA 2Y9PB 4NR0A 5FOTA 4H9GA 1W5TA 5KCMA 1GLVA 1W9HA 2EAUA 3TE6A 4NXNB 3E22B 4MMXB 5LM3A 2BI4A 4HG2A 2FFHA 2YUIA 2WILA 2MQEA 2QIOA 3RN4A 1TO2E 4YP6A 3GEBA 1L0LH 4OM7A 4AILC 2VHVA 1SNYA 4PCVA 1W48A 2OWDA 3GT4A 3OA2A 2VJNA 4GIBA 3K58A 3DOUA 1QWSA 1KJ8A 1URPA 3CYPB 2YNMD 4LCEA 1KRWA 3T3NA 3MAQA 2ITCC 4Y1EA 2M6KA 3FBAA 1DQRA 3K03A 1HDRA 3FCEA 3NEYA 2ZI7A 2Q3MA 2LD4A 2D5CA 5J59A 3HPLC 4EW3A 1EGHA 4B3XA 1DTSA 1LLUA 3WQSB 4XVCA 1N3LA 1UDRA 4E2LA 3IV7A 4AECA 2YKGA 3FG9A 5DISB 3W5AA 5SZKB 2NLJC 2GFQA 4D2IA 1UZUA 3UMMA 4V0NA 1RHMA 4ZVNA 3T5TA 4LF7B 2CJWB 1NXQA 2BZSA 1X7WA 2WF6A 3AGKA 1IOVA 2HK6A 4L6AA 1YITF 4NL4H 4MQ5A 3W1VA 2C58A 3HV2A 4INAA 4RHYA 3ZGZA 1XL1A 1P9LA 1JSLA 4A6EA 5JRZA 2BDEA 5JYDA 1PDOA 1YZUA 1SC1A 1BNCA 5IT9A 3VJMA 3QHPA 4XIJA 3AKYA 3EIUA 5TGTA 5G0WA 1VA4A 2PL9A 1XU4A 3BXZA 1NYQA 2ILMA 1F4MA 3L0BA 4LX8A 5CW2A 4HUTA 3E1SA 4HLDA 2R6FA 5JWPA 1PQYA 4OKIA 4CUJA 2QRUA 2W93A 4GKKB 3D9QX 2XOEA 2WG0A 1X92A 1HO3A 3W77A 5JAZA 4DAOA 2LR0A 2XUAA 1K3FA 3EZLA 3EDYA 1IMOA 3VV2A 4JA2A 3VAAA 2ATCA 3EARA 4WQMA 4C4OA 2Z6UA 3MPUA 5BW4A 1BVRA 3ETLA 2VNSA 1PUXA 1QE0A 4B17A 1A97A 5FUYA 2Z6QA 2C7GA 4ZI5A 2GSWA 3MT0A 2O1XA 3U0BA 2PANA 3OW2F 3AY6A 1JTFA 4MQ4A 4TXLA 1DRVA 2MSNA 3I5YA 1B00A 5LMUB 3C5VA 1CZLA 3IVGA 4N5LA 2UUAB 3RUAA 1PS0A 5J58A 3V8NA 3UWMA 1PP4A 4ZTZB 1V4VA 2D1SA 3F1KA 1EHYA 2P9JA 2LBTA 3GCXA 5L51A 4BFWA 1H9CA 2LGWA 2GF9A 3QKTA 1XZIA 4DCGA 3G4SV 4N0EA 4CL3A 3LP5A 4D56A 4PELA 4WY8A 2X2FA 3UV7A 2HEIA 5IYZF 2JJYA 4YQYA 3GPDG 4KITB 2ZVJA 2WIAA 1DO8A 3ZE8A 4Y6OA 3WL3A 1ZSVA 4WZAB 4QG7A 2GA9A 4A27A 2BZGA 4KXXA 3RS5A 3FLBA 1BH6A 1FLVA 1SD1A 1F3LA 1M6VA 2DKFA 3RS8A 1U2TA 4F6LA 2IY7A 1TLTA 4HB3A 4RWUA 1S3SA 1N0UA 3I5DA 2WSBA 2W90A 2A9QA 1MF7A 1Q90D 1Y5NA 4EKIA 3G88A 3NTXA 3TD9A 1WZNA 1CRWG 4YJ2B 2J07A 4N1AA 2GSMB 4Q47A 1QG2A 4JLDA 1LTQA 6NULA 4I4IA 5AI6A 2HP0A 2IXBA 4KMMA 2G4CA 2V9ZA 3Q7EA 3O4RA 3TINA 1ZGHA 3PCRB 4CLRB 3IILA 2CH7A 1LPMA 4JT2A 1Y74A 2YFKA 2FX5A 4Q15A 3ZW9A 4REMA 2GZDA 4RZSA 2ZJ5A 4F3NA 4M1KA 1W36C 1QVFU 2W2TA 4JYYA 1X13A 2H1HA 1RPNA 2AV6A 4BRSA 3E7FA 3D3IA 3I2JA 2VS0A 3STTA 1N33O 1Z37A 4Y2GA 3V8MA 2OZPA 4QGAA 3KAJA 3OOHA 2PZKA 3J80M 1XOIA 2WQ7A 3JATB 4KFUA 3B2NA 4H7KA 4KQFA 4XOIA 2NXWA 4TRJA 1D1SA 1E1DA 4PI2A 5GVSA