4I4TB

Crystal structure of tubulin-rb3-ttl-zampanolide complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 158
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i4tB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i4tB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i4tB01
5JQGA 1W581 3E22A 3HKBA 3JASB 3VOAA 1OFUA 4E6EA 5BMVB 4WBNB 4YJ3B 5LP6B 4TV9B 1SA0A 3N2KA 4DRXA 1Z5WA 1W5AA 4O4HA 4ZI7A 3RYIA 5LOVA 3WGKA 4ZOLA 3UT5A 3WGNA 4I50B 4U3JB 5GONB 4FFBB 5ITZB 3JALB 3ZIDA 1JFFA 4ZHQB 3WGMA 4I55A 4F6RA 2VAPA 4EB6A 4B45A 5LYJA 2R751 4O2BA 1W5FA 1TVKA 3JAWB 4XCQA 5JQGB 3E22B 3HKBB 3JASA 5MN5A 1W59A 5BMVA 4WBNA 5LP6A 4TV9A 5IJ9B 5JH7A 4X20A 4O4HB 4ZI7B 3RYFB 3WGJA 2R6R1 5LA6A 5LOVB 4TUYB 5EYPA 4I50A 4U3JA 3RB8A 5CB4B 3JALA 3R4VA 4ZHQA 4I55B 3HKCB 4EB6B 5FNVA 5JCOA 4LNUA 4O2BB 5CA1B 1TVKB 4EI8A 3CB2A 2Q1XA 2VXYA 2BTQA 5KMGA 3V3TA 3N2GA 5IJ9A 5JH7B 3HKDA 4X20B 5J2UA 3RYFA 3M89A 1FSZA 5LA6B 2RHLA 4O4IB 1FFXB 3JAKA 4TUYA 5EYPB 5JVDA 1TUBB 3VPAA 5CB4A 5KX5B 3ZBQA 4YJ2A 3HKCA 5EIBC 5EIBD 5LXTB 5IJ0B 3JARA 5J2TB 1RQ7A 4X1KA 5MN4A 4U39A 5FNVB 4LNUB 5CA1A 3RYHB 4IHJA 2BTQB 5KMGB 1W5EA 3N2GB 4KWEA 2RHHA 4IIJB 5EZYB 5J2UB 2GVIA 2VAMA 4X1YA 4O4IA 1FFXA 3JAKB 5JVDB 1TUBA 4HNAB 4O4JA 5CA0B 5KX5A 3WGLA 4O4LA 3RYCA 4YJ2B 3VO9A 5C8YA 5LXTA 5IJ0A 3JARB 5J2TA 4TV8A 4EI9A 4X1KB 4X1IA 2BTOA 4M8IA 4I4TB 1W5BA 3RYHA 4IHJB 3HKEA 2VAWA 4B46A 2RHOA 3JATA 1Z5VA 4IIJA 5EZYA 5IYZB 3HKDB 4O2AB 4X1YB 3VOBA 5JCOC 4YJ3A 4HNAA 4O4JB 5CA0A 1SA0B 3N2KB 4DRXB 2Q1YA 3C8LA 4O4LB 3RYCB 3M8KA 3ZBPA 5MN6A 5C8YB 5LP6C 3RYIB 3VO8A 2XKBA 4TV8B 4ZOLB 3UT5B 4DXDA 4EI7A 5GONA 4FFBA 5ITZA 4X1IB 5M7EA 1JFFB 1RQ2A 4I4TA 4F6RB 3HKEB 1RLUA 2RHJA 3JATB 2XKAA 5LYJB 3JAWA 5IYZA 4O2AA
chains in the Genus database with same CATH superfamily
4D4KA 2AJTA 4H0LB 2HGSA 4ZI2A 3IPCA 3L4SO 4HH3C 1FTNA 2XYRA 5LD2B 4JI1B 3PFIA 4KJZA 4G5SA 4YTEA 4DC1A 3W3ZB 4E6PA 4WFGA 2BOBC 5BXZA 2XMCA 3EJ6A 1JR3D 3V8NA 3AR7A 4UM9B 1T2UA 1QLNA 1WX1A 4PC1A 3L04A 1IWBB 3GP8A 2HZ7A 1SCBA 4U3FH 5DECA 3CCLV 3QOWA 3G49A 1USVA 5L3RA 4EG3A 5JNTA 2DFDA 1SQ5A 3KSUA 4JU9A 1KJQA 4DLWA 1F6DA 1FRVA 5JLJA 1OVGA 4WACA 3UXHA 3QPAA 2QSZA 3ZS8C 3I8SA 3PFKA 4KXFB 4TVBA 4UDYX 4Z4FA 2BGLA 5E6UB 2JVKA 1YHQF 5GMOA 3UMSA 3LMEA 2XNSA 1DEKA 3H1HH 2NN3C 1TJ5A 3L0IB 3L6RA 3VTIC 1Q17A 1JKIA 1OCCC 2DTXA 3GG9A 1E9VA 4ZHSA 4ZO9A 4PV1B 3BKXA 2QDOA 4QPJA 3IIMA 4TLAA 3RD5A 3L46A 4I55B 1KBOA 4B3TB 1ODEA 2CMFA 2JASA 2OCDA 2ZP1A 3HMKA 4RQBA 3SZ3A 3UK2A 3ICXA 3HYNA 3WGIA 1ZKMA 3B7WA 3E8XA 1WHSB 4JLOA 4BN0A 4G0VA 3CUTA 4LY0A 3CZQA 5CDFE 2AN5A 2IYOA 4TS1A 4JTCB 2OHHA 4JODA 2JVJA 4DXWA 5KYKA 5HX7A 1DGQA 4IUBS 5FWDA 4ZZ0A 4HGRA 2ECFA 4U7OA 4U7HA 1P0MA 1X4TA 4ZV9A 5IKOA 3F1LA 1CB0A 4QPJC 1UBUS 4ER0A 5BY2A 2OORC 4CV0A 1FMJA 2Q2WA 4BNXA 3QEBZ 2MJLA 1M8FA 4IDBA 3GA0A 4IMPA 2YWFA 3NBZC 1QE0A 2VJLA 4QYMA 3WK8A 3M82A 3O1HB 4FEYA 2YI9A 3V4OA 3FNBA 2YSUB 2VS0A 1MO6A 2HMUA 3PI7A 1GKIA 1WA8A 1TCVA 5F76A 1KEVA 4NZPA 2QQGA 1U43A 2X5XA 2H4JA 4DMFA 1VF6C 5J47A 1YRBA 4PAQA 3GJ7A 5H5NA 1UJMA 5DGTA 1KO5A 4NCIA 5EZYB 1JAYA 1XEAA 2BY4A 2J6HA 3DBRB 3KTFA 3LUHA 4KDRA 4X41A 5JNSA 3K1YA 4Y98A 2B4TO 3D6VA 3COSA 3FWHA 4YROA 2XZTA 4AMVA 1K8RA 1UKEA 2WP8J 4L85A 4CC6A 1G6KA 4OREX 4W9NA 2VZ0A 4GF5A 1N0NA 3K15A 1RBQA 4WSOA 2CXOA 3N59A 3UAYA 5CW1A 2NUTB 4PWZA 2PZKA 3VVCA 4B3CA 2XA1A 2FPOA 1BS9A 3EXHC 3KSRA 3CNQS 4GXQA 2PXHA 1PUJA 4I4TB 2BFBB 2GJ9A 3P9XA 3L7IA 5D00A 4YUAA 3H87A 4RY9A 2J0UB 1P6QA 2Z0AA 2PSSA 4FGKA 3A9TA 5IYZB 1P4SA 4NBKA 4LYGA 3RSFA 1LCIA 2G5TA 1TTQB 3EPPA 4E1BA 2H7CA 1GNSA 3VA7A 1AUOA 4N65A 3LPLA 3ZJYA 4W8HA 5CGQB 4COOA 2HDNB 5MN6A 1OXUA 2P0YA 5LC1A 4U7PB 5A5VA 5MHTA 1IWPB 1XCLA 1KFEB 1T1GA 1Y6GA 5BN4B 2BMAA 4H1VA 4N7RA 4HV4A 5DHQA 1N3IA 4EB8A 1QBGA 3ZCPA 2P06A 2G28A 2IY7A 4GMXA 1IQUA 3MSXA 2FMKA 2BSKB 4OTZA 4WQMA 4JI8B 4X45A 5ALZA 1Y6ZA 1YZVA 3GEPA 4S35A 4KQWA 3EVDA 4MAFA 4XH9B 2ITCC 3G68A 3U5ZB 3K1AA 3H5WA 1U0JA 2NACA 3DE3X 4JJIA 3TXQA 2FEPA 1Q6IA 1DBQA 4BMDA 5I4IA 1XK6A 1QHYA 2XV1A 1RFGE 4FMDF 5ALPA 4ROTA 3WLSA 5BPFA 5HZMA 2K7FA 1QK3A 3DXRA 2QB5A 2QGZA 2QMOA 2FPWA 1FUIA 4ZVMA 4ALJA 4DPMA 4CTMA 4LK3A 2BGKA 2UYYA 4YC7A 1RRFA 3DA8A 4HAUA 3UMRA 3WK4A 1A9QA 1SC1A 3DMTA 1AO0A 2I8AA 1Y9EA 4OJQA 1WMSA 1D2DA 2HRYA 2WD9A 5E9JA 4N7JA 4G0XA 1V1MB 1ZMRA 2P9YA 5CDTA 2XB9A 4IKPA 4J16C 2QUIA 4EP1A 1U1IA 1TU0A 3B13B 2E21A 2EINC 4KO1S 3SI7A 1XZMA 3JQGB 1K9MH 3LQQA 3ML1A 4NOJA 2XNDD 5K1ZA 2QAIA 2QR4A 4KCGA 5KEIA 4GVPA 1WB4A 1BSVA 4D4LA 1E2MA 1UMDB 4UU7A 5EIEA 4MDEA 5FOVA 3USES 1QCEA 4MTGA 2PX6A 1CR1A 4WADA 2EQBA 3N0XA 5I47A 1KC8H 2QEXF 4OK5A 1JSZA 2PL3A 1QBKC 4YT5A 2G9QA 4BKQA 1LK7A 3KOZA 1M57C 1P0FA 2WIKA 2JGDB 3OIVA 4Y7DA 1Y1QA 3SZMA 2JNBA 2JGJA 2WJ6A 3ILXA 3LE8A 1C2TA 1IU9A 1XI1A 2O3QA 3THXA 2P22C 2CSLA 1Q7TA 1XI2A 5KZMB 3GLIE 4L7VA 1GHTA 3DOCA 4NXNO 1WLSA 1Y34E 2WHPB 5JPDA 2JCSA 4FC6A 4ZQFA 1NVPD 1WZIA 4YP1A 2X0JA 5T6MA 1UI9A 5A3JA 1JH9A 2YUTA 2ENUA 2H7VA 1Z47A 1H5UA 1ZSYA 4ED9A 2DMRA 2DC1A 2ZBQA 4PXSA 5FI3A 1L5HB 3RUEA 4EL0A 1GQ2A 3IHKA 3ZOKA 2PE5A 5TS2A 2WWWA 5I4BA 3HEMA 3T7IA 3WNBA 1TUBA 3SM9A 1UBNA 2A5FA 2XZDA 4BTEA 4YJ3F 4E0BA 3ANSA 3RYCA 3G9UA 4F6LA 2AG1A 3SXUA 5JAHA 5KU7A 1WUYA 2H1HA 1NXVA 1C3VA 1YDFA 2EWVA 4YQEA 3TZLA 5B1AC 3CPWF 1CRPA 3IEXA 1G2IA 2HPZA 2X1VA 4LDZA 4CN9A 2ZZMA 4QYXA 5FL7G 4QSHA 1LBHA 1NUSA 1D2MA 2Z3VA 1IE3A 1L8OA 4H3HB 4GZ5A 4BQNA 1UZNA 3E05A 3TNJA 3VO1A 2CWDA 5JXGA 3JSXA 4YRNA 1G4AE 4NJMB 4GP9A 2WE7A 3FVTA 3L7QA 2OZPA 2PLAA 4ZU6X 1YZNA 3MMNA 5LZ7A 1CE8B 3H2GA 4QSMA 2TSYB 5BR1A 1TJ3A 2FFHA 1NKSA 3E8BA 1JVSA 1E5DA 1PL8A 1XL6A 3MF4A 2QD4A 2IXDA 4QFMA 5H4GA 1VJ1A 5B66Z 3L70H 1CRZA 3HBAA 2FOXA 4J9ZB 1W8IA 1ZFNA 2CCJA 1E8MA 2OGTA 2XR1A 3QIVA 4NZYA 4PAWA 5CHYA 3RGWS 3ZW7A 1O97C 1SHTX 1XU7A 5H2FZ 4BFSA 4B5KA 4D8XA 3RFRA 1KSHA 2PBRA 1OFVA 1H2KA 3T1HB 3MWFA 3PA8A 2PGNA 2W6JG 2H7YA 3P9IA 1ICIA 4G4JA 5EZ6B 3RUFA 1EFLA 4LCUC 2Z98A 3MDOA 4LXIA 4QLOA 4RHXA 1EJ6A 4WFBV 3RRJA 3ZXXA 1S2IA 1VFPA 2WPNA 3IAM6 3HB9A 5K3BA 4EMSA 4KLCA 1VL0A 1EGAA 3U7QB 3K53A 3ZGNA 4AXBA 3GQVA 8OHMA 3ZDDA 3O75A 2ZBUA 4F45A 4GKKB 2JAUA 2X5JO 2I1VB 1I6LA 3L7YA 5HXAA 3HCBA 2PBZA 3FTCA 1L9XA 2YZKA 4LY3A 3EGWA 1Q5PA 4WEQA 2D0PB 4CIYA 3VMMA 4FW8A 4G0YA 1YCDA 5IDVA 2AHZA 2G4CA 3ZE7A 1M3SA 1XZFA 4BVFA 2XGMA 5TQ0B 6NULA 3SJBA 1TRKA 3H9VA 4P54A 4V3BA 3AERB 4WGGA 2FFRA 1JU3A 5J2UF 1FNJA 1PL6A 2E4XA 3L0YA 5CITA 1ZR4A 1TFRA 2OEPA 4CHTA 2Q4OA 2X9GA 1IYZA 3CPSA 1GUZA 3MQ4A 2DPYA 2B8TA 3AQ4A 2HJGA 3M84A 3IR5A 5FHQA 2E48A 5HZKA 1QGZA 1E2UA 2Z6AA 3T1TA 1ZCBA 5DGHA 1KO7A 4BFTA 1JQBA 5IDXA 4R3WA 3DLTA 2BFCA 4TS9A 3HAXD 2PU7A 4XM2A 3B51X 3CLHA 1W0JD 3A31A 1D9ZA 3AR9A 1JBKA 5AOBA 3FDZA 4D8VA 4R05A 2V6FA 1Z4OA 4DIUA 3HCRA 2O5EA 3WYCA 3RYFA 1Z83A 2HCJB 2ZB4A 2JIZG 3CW2A 1JA1A 4Z3DA 1DQSA 1ABFA 1M5UA 4TZKA 4A2QA 1UOPA 1SIBE 3NTXA 5AW6A 2JIDA 3CGGA 1EK6A 3G0BA 3BIWA 4LH6A 4M37A 4LNUB 3I4CA 1EVEA 3FD9A 3EMKA 3CRRA 1WPQA 2R6AA 1C7QA 5KWJA 2EIJC 3DMGA 4YP7A 1QQBA 1MRSA 4QG3A 2ZI5A 4IOKA 4NDAA 5EG5A 4PXYA 5JR3A 2RHHA 4KXNA 4IIJB 4FZRA 1XRGA 4RX1A 3GNSA 3I9LA 3S27A 1FU4A 1ZG3A 2YWCA 3IC5A 3U5TA 1SULA 1GCOA 3E8GA 4FE7A 4BV8A 1KMQA 1U0FA 2WLIA 1XMSA 1ZC4A 5BO5A 2FPRA 2ZM5A 3EX7C 3NT2A 4Y2HA 1TT7A 1E89A 1QHHB 3UJ6A 4LTDA 2NUAA 1FNCA 3QP9A 4EEQA 5KBYA 1AG9A 1NQ5A 4FILA 3PJGA 3PLAE 1UFKA 4R7CA 4TTPA 2V1XA 4YK7A 3UATA 1VCHA 3R7WA 2VQEB 3HKEA 2VK8A 1UC5B 4Z1MA 3A8TA 4GZRB 4DHWA 3EVKA 3SJCA 1HKHA 4WX2B 1LTQA 4C07A 4CH6A 1GADO 1T0HB 5JZOA 1BE3H 2YRFA 4KRGA 3ZEAA 4LJLA 3PQ8A 1V41E 4RDHA 3UB3A 4PA9A 4Y0AA 2VPXA 3WDKA 1VQ7F 4RZIA 4J80A 4BVSA 1K66A 3I23A 3OF3A 1V5IA 3MD0A 1OWLA 2AQHA 4F2PA 4P31A 1TB4A 3BIFA 5HUHA 3D2CA 2AYZA 5EA2A 2UAGA 5BOSA 4EKYA 4QNNA 3CVOA 2P1DA 1NXOA 5HRCA 4I36A 3I8XA 5GGXA 2SNIE 4UMEA 4WKGA 3V6MA 3RJMA 3WBBA 3BYQA 3BORA 5FOQA 1L5OA 2JBHA 4ZQBA 2H51A 2FPUA 4EAQA 2QY6A 4BFYA 3H18A 3MYYA 2Q68A 4YUVA 4ZT6A 1ZUQA 2PT9A 4C6TB 3KLMX 4Q05A 3HUFA 1QQAA 4L28A 4YQYA 3CCEV 1RJGA 2BO1A 2ZJ7A 4NJEA 5EJ5A 1XJ5A 1QX4A 4JI3B 3ZDBA 3RJ5A 2WLTA 4PONA 2A1IA 4EGQA 4XWGA 1I3OA 5EKUA 1N6LA 4B3MB 4WKNA 4UEWA 5BY1A 1G5QA 3KR2A 5E1DA 1AGYA 3B53X 5ALGA 3ABTA 4U0JA 1C0IA 1MJGA 1SHUX 1X6VA 2ATCA 3P8ZA 1JLHA 2PRIA 4X89A 1P3JA 1QK4A 4KQHA 4QTTB 2CL6X 4RPKA 3B85A 1OCCB 3BWYA 3L6OO 4DFDA 4ENTA 1Q8IA 1XTTA 5C35A 1D5CA 3EGDB 2N48A 3PK0A 4D42A 1RXWA 1K08A 4H6XA 1EX1A 3IHLA 2XUFA 5D8DA 1NH2B 1X25A 1QFSA 3L1VA 1IN1A 3R4VA 1DFGA 1QMPA 2WLJA 3QENA 1ISRA 1Z4NA 3MAAC 5IVHA 4PLVA 1TEHA 2A2ZA 5U4QA 2CLOB 5A9GA 3CVJA 1K1EA 2YI8A 1NSFA 1YB2A 1D9XA 4IZOA 4MB6A 3REQB 3KJJA 1EXMA 3AUXA 1AQUA 4MUNA 1MB2A 4CV3A 5T8KA 3Q11A 5JPCA 1Q14A 4N3NA 4Y2QA 2G88A 2PL5A 3ENWA 4JGBA 1KTIA 5EBLC 4F8YA 1R5BA 2EOAA 2XHEA 1EUYA 4XFDA 5L7YA 4XIFA 2QKCA 3MGKA 1I3MA 4MS3B 4MLDA 2ZR7A 5KNLA 3AF0A 3O93A 1U0OC 1SEVA 1NYLA 1QO7A 1W49A 4EDHA 2QMUA 3IUYA 5J2TB 1LTHR 3QITA 2VP3A 4YAUA 1OHHA 2CJPA 3KFLA 3GVMA 4M55A 4ZCSA 3TETA 5B7QA 2O2EA 3H8SA 1NF2A 5EUQB 3U1TA 2HK9A 3W0LB 5FPTA 3OKFA 3SG0A 5ALLA 3W7VA 4XRGA 1M83A 4UTOA 1VF5B 2C1XA 1W7AA 3DR3A 2ZLBA 4LZAA 2KS6A 4EX6A 2XSZD 2FX5A 4LGCA 2HW8A 4HDKA 5B2EA 3PWZA 2NYRA 5K51A 4KG7A 4PG5A 5DHAA 4E30A 1WA5A 2O3TA 4NJMA 2WNSA 1W73A 4BLPA 2F55A 3TJTA 4ZYUA 4ZCQA 2H6LA 5EPEA 3TIGA 2R44A 3SIWA 5JI3E 2X22A 1ESNA 3AYXB 1ZAUA 1CQIA 1OXMA 3N27A 1P45A 2PZ8A 3C6KA 3KPYA 3OY2A 1MVNA 3P45A 1SU6A 4H7IA 1E0SA 3HUDA 4XX1A 1VQ5F 1CY6A 1ISFA 2D06A 3IPAA 4EENA 4F8EA 4YRAA 2GJAA 3V32A 4BP9A 5K1XA 3ECAA 1QZXA 1V96A 2V7QG 3S3WA 3LHFA 3T1QA 1XA4A 1KS2A 1GNLA 3TW8A 2ZSFA 4AJJA 4AMBA 5BWMA 5CVJA 2J0VA 4N3BA 4WXYB 1Y7IA 1JW9B 2VWHA 1U3LA 1NE7A 2OFOA 2XB6A 3AUUA 2NUBA 3F2IA 1FE8A 4EFKA 1SM4A 2WILA 1I2AA 4IG4A 3RVOA 1RJ9A 1M1KH 1B1CA 1CUBA 1FFAA 1P2DA 4YJHA 2XWSA 3GGPA 4XWKA 4ENWA 2ZU6A 3CBQA 1MNGA 3KQMA 5DZSA 3WNCA 4C4YA 4HVTA 3R75A 3N2IA 4F4HA 1XXHE 2E49A 2O54A 2QTWB 1VPVA 1P6XA 3CUEF 2H00A 3DZFA 4EYGA 4W5QA 4M88A 2IH2A 4KFUA 4YRSA 5HZGA 1E6CA 5TQ0A 1R3IC 2GNAA 3KJFA 4YWJA 2Y1WA 4U7WA 1VLVA 1Y5IA 3I42A 2QXTA 1LV7A 5EMLA 3B5IA 1EVYA 1YA8A 3L5KA 3OSZA 1XZGA 4V02A 5AOVA 3GJRA 1GPMA 5IAAA 4FJ0A 5IX8A 3AF6A 3ZIDA 5LNK6 1NOIA 4K6CA 2QZPA 4J4TA 1ZGJA 3TW0A 2QRVB 3IC7A 2W6JD 1Z2GA 2W42A 5ENVA 1D6NA 1RLJA 2C88A 1LF5A 3UB2A 3ZE8A 1X7WA 4BDTA 2Q0QA 5JNVA 4U5XA 5KINB 3HY4A 3SFVA 3QYFA 2AR7A 3HGTA 4L8LA 4F56A 4GOXA 4BWAA 1JVBA 2HYDA 2P41A 2LWIA 5KI6A 3BREA 4J7KA 1KYZA 1R50A 4PPGA 3VGJA 2ZPTX 5DYYA 4P4TA 1F4PA 1FSPA 4MKXA 2QMYA 4YLGA 3NDIA 2R9VA 3H5VA 1OF1A 3W05A 1GCGA 3RVNA 4TVSA 4EFDA 1HNXO 1HNZB 5B55A 3TDMA 2LCFA 4ZAXA 1L7DA 1XZKA 2DH6A 4L5IA 1TEVA 1P2FA 3ZXIA 3IP3A 2WT9A 3PDIB 4DN6A 3D8BA 1VB3A 1Q6ZA 2BZSA 2F17A 5LKAA 3DAFA 1G5PA 1MAUA 1R15A 2QN3A 4UPDA 3LRXA 3ZDYB 2OUIA 1Y48E 1CLEA 3N5KA 5EWJA 3SR3A 5DX8A 4F5DA 1AJPA 3C1UA 5B58C 3GHYA 4KMRA 4YVFA 4HXYA 3UCFA 1JG6A 1H0SA 1N57A 1E2FA 1CR6A 1T0PA 1Y3BE 2JARA 2NPOA 2ORIA 3B3GA 3JWHA 2DPGA 3QA9A 4QOEA 3VZRA 5JHHB 4CT0A 2HLDD 4A5OA 2BR3A 1JLKA 1KDRA 4HGZA 1GG5A 4DW0A 1Q6YA 3SJBC 4Q3BA 1ZGGA 3OUTA 4AW9A 1D04A 2I7VA 4P35A 5F3DA 5PGMA 2FMFA 3B38A 2OBMA 2ZW9A 3T1CA 1AZTA 1JRLA 4XCVA 4JWTA 4DLBA 1TAUA 4ETNA 1IBMB 5JU6A 2CEAA 1CR4A 2B5OA 2YX1A 4W6ZA 5JTTA 1G5RA 4YAOA 3WGZA 4RULA 2X7HA 3NM6B 2LO1A 1SCJA 3R23A 2A1TS 3L6DA 4HHEA 4MCHA 3VDQA 2DW4A 3QF4A 2UXNA 2EJCA 3DV0A 2QQEA 5DM0A 4UPEA 1ORDA 5JAZA 2BN4A 3QVLA 3SFZA 1RIFA 2ZTLA 3PC7A 3QU5A 3KB8A 4FR5A 4B6OA 1TJYA 5B1AB 1D5NA 2YVUA 4R3NA 1QRTA 3VO9A 1DWPA 2LBPA 3H17A 4QHTA 4Q9JA 1IB6A 4NV3A 4PTZA 4X1KB 3ICVA 4PIMA 1MMMA 1YF2A 5A2QN 1C9JA 3MMZA 1U9IC 1H6BA 4YYZA 3G6EV 1BKDR 4FW9A 1GRQA 4MWOA 4R16A 4I1PA 4M1ZA 1FK8A 3OTFA 4U2KA 3QEJA 2OGUA 4DDMA 4GE3A 1H2HA 5CBPA 5L40A 3MINA 1H2BA 2QTSA 3RANA 5B3KA 1U2EA 3OZVA 5EERA 2X1HA 1F8YA 3PRHA 5DWDA 2Q6AA 3HJFA 1JIIA 2HX0A 1G8YA 4QQ8A 5G4UC 1GPH1 3KWJA 5GTDA 1S6YA 4AY3A 3IDSA 2Q0SA 4RS4A 5DSZA 1AU9A 1M1UA 2H2AA 3B1VA 2FUG1 2IH3C 2ZYGA 1VQVA 2YYAA 1AX9A 3INYA 3V8VA 2VPIA 3VUFA 4DZTA 1BQ0A 3EWIA 1JKJB 2D0DA 1ZBQA 1AKVA 3G6EF 5EXDA 5IWCA 1R0KA 4AILC 2EW2A 2FR0A 3TSCA 3WIOA 2I2FA 2Z1NA 3PEFA 5G0WA 1O3YA 2ZINA 4G01B 4XDJA 1GPKA 4HAXA 4RETA 1YV9A 4BN4A 4ND4A 2WSSA 4WFIA 1OFUA 2F64A 1MABA 4TT8A 1KPIA 2Y0CA 2H4YA 3HVHA 2KGWA 3NASA 3RWBA 3VTFA 4JJ6A 1HRDA 2X6QA 1RWKA 2D1RA 1SXHA 1YAHA 2H2WA 1CHNA 4J07A 2ZI4A 5B2FA 1P3Y1 2YS7A 1S2MA 3CH4B 1UMCB 1WXWA 2ZBDA 1IBKO 1YR9A 4FOSA 4E3ZA 3D5TA 4KXUA 3SS8A 5D5QA 1H48A 4ZK7A 1FTWA 1U97A 2HF2A 2PL9A 5DNYB 1ZD4A 3BTVA 4JN6B 4BPRA 4GR5A 1VQOV 3LPDA 3GJYA 2PGJA 5I51A 3MFYA 1GTG1 3BABA 1V6CA 1A5SB 3A9UA 3E22B 2FK7A 3T4XA 4FJ2A 4BNTA 3BD9A 1MVOA 1PK9A 3JR7A 4TVOA 4UEKA 2WSYB 4FFMA 4UCRA 2C3OA 2IPNA 2QAJA 3AGQA 4I99A 1UK7A 4ASUG 2C61A 2ERXA 4WY2A 5HIAA 1W5TA 3N05A 3AJEA 1B42A 4UVCA 1V7CA 3MBIA 3LWZA 3PUIA 4KRXA 3A1NA 1QS0A 4PPYA 3F3KA 2HRCA 1ZK2A 1HBJA 1JN0A 3VR2A 3GJZA 3TGUH 2VNIA 1ZUIA 1EP9A 1J6UA 1P7WA 1P39A 2NTEA 5FAXA 4C0HA 1M8GA 4H44B 1TVKB 1DARA 2CZCA 3PDUA 4L15A 3WG7B 5K8TA 2VHJA 1FSGA 1RQLA 1JU4A 3U3MA 3MAGA 2WJJA 1DE0A 3WYNA 4AN1A 3CD6V 4QPNA 2AG0A 2IPMA 4HN4B 2WD8A 4MT8A 2Q9UA 4L5CA 5IE9A 4RF4A 1LB1B 1NTRA 4B8ZA 3VNSA 4H7DA 3CCRV 2YDXA 3W2IA 2HVKC 3K1ZA 4YAKA 3G5UA 1QNLA 1QP8A 4AT1A 2E18A 2OCKA 1P7BA 1YL7A 5HILA 2W11A 2X58A 3T12A 4RPIA 2GT1A 2YOFA 3OU6A 4DC9A 4YY3O 3B12A 3H9GA 2XH8A 1PFYA 1PZHA 2XAUA 3AR8A 4K46A 3CKLA 5DGIA 1HLDA 5ALYA 4BWFB 4Z6KA 3CLSD 5KNCD 4WZ6A 1WB5A 3GEHA 5B64A 1G8FA 2BGRA 3AF2A 4FGLA 4P08A 1QV7A 2YV2A 3G7NA 1NQOA 4WKPA 4EHAA 5DGDA 3IQEA 4MCIA 3L8CA 2OLJA 4N8SA 2BMEA 4BV2A 3A6EA 2W48A 5KYYB 2XRYA 4KR9A 3G3EA 3LC1O 3HLTA 1OW3B 2WJAA 2CXPA 3NHRA 1GFIA 1XWIA 3RW9A 4AF8A 2B0JA 3MGBA 1G18A 1A4UA 2JLBA 3RUPA 4QKQA 1OWOA 4BKUA 4UEOA 3UMCA 3O65A 1ZJ4A 3KZVA 1NU8A 1O95D 4OXKA 1DELA 3BIJA 4WV3A 2JS5A 1MORA 5C93A 5JATA 1U2DA 1YRLA 1PM9A 4NECA 5ITWA 4LSWA 4CTJA 4NYIQ 3F4BA 3LCRA 4P9PA 3HVRA 2OYCA 2VKQA 1TKCA 3QFRA 4JC4A 3NHUA 4MMYB 3WZMA 2BKAA 5I8PA 3D7RA 1NVTA 3DMYA 2XQFA 1DDIA 3UO2A 1XZCA 2IZ1A 4Y6PA 1I7QB 3R9WA 5JXHA 1KQ3A 4D8TA 5KSPA 4PDLA 5D85A 5IF9A 1KNKA 1T1SA 5HKLA 2R1VB 2CGOA 3EZ2A 3FI9A 1H22A 4W9NC 5C2JB 3AVWA 1Q81W 4PZPA 2Y0PA 1XLVA 2GESA 1IOZA 4BT4A 4GOND 4Q12A 3AY6A 1UC4B 3UK0A 1X7WB 2YNMC 5F7ZA 3WG9A 4DV3B 5G4VC 5AHOA 1AKNA 3GZNB 2GEKA 3CPHA 4ONEA 4U2BA 3CU5A 2ARHA 1I7LA 4CIWA 2C1ZA 1W2HA 1SWVA 4JWKA 4MV3A 1EUCA 5KAIZ 4PI2A 1BGXT 2G1AA 1C4WA 5HBRA 1IL0A 4A15A 1M2GA 1WXQA 1FLAA 4R40A 3WX0A 1L5QA 4B4OA 2AOWA 1H0KA 3CLRC 3R66A 1IUKA 1DC3A 3BUSA 1PEYA 4NZ9A 5G1NA 3UOAB 1T1JA 3UT6A 4YPVA 1NONA 2F9MA 2OD9A 5BN5B 1QF6A 2QLJA 4BBAA 1C50A 2FSHA 2FQWA 2IDZA 3DE5X 3I64A 1UWCA 4WA7A 5ALOA 1XVTA 1LJUA 3D3WB 3PJSK 4EKEA 3HVKA 4WI1A 3WWCA 3L92A 1KI6B 1NW4A 2IHBA 4H7EA 1T8WA 4O4HB 1L5SA 4CH4A 1RMYA 3QKRB 1PTJA 2YY7A 1Z0FA 3ZU6A 3OZCA 5DGXA 5JOQA 3SPJA 1GARA 3EQ7A 2D3WA 2UUAO 3OCVA 4U1RA 3NEYA 1MAWA 1J5XA 3E2MA 2H0QA 2F1IA 4TKZA 5BT9A 4EHIA 4KYVA 1P2BA 4RGVA 4DYVA 1EZVH 1VP9A 1O58A 1XZQA 3B89A 7MDHA 2Q5JA 5IAOA 1Y8RA 2Z83A 4WXRA 2PAAA 1Q86W 2YVKA 3ER6A 4W4TA 1NBMA 2JCVA 2EKQA 3K9CA 3BXGA 2VT6A 5EVJA 3Q85A 5F7JA 4W5RA 2O8FA 5IBCA 1FQJA 1Y9JA 2HA4A 4UVGA 2OYQA 3AW9A 4EMBA 2J7PA 4QQNA 3BCHA 2IYFA 1X7ZB 3EZXA 3C8UA 2YXBA 4LF7B 3LX8A 4Z3OA 1XAGA 1LNZA 1CJUC 4L8GA 5EFOA 3UJDA 2W6ZA 3RA5A 3DCNA 3E2PA 5HCNA 2VSYA 5JMPA 4X1KA 1YR1A 1G38A 1PPJH 5D1NA 3FTFA 4BW5A 4UUNA 2XNKA 4RJLA 4AK9A 4M1EA 4G9GA 3LC7O 3M1YA 4BBZA 3AFOA 4MRMB 5K0EA 2W4MA 3B60A 3TGPA 2Q4RA 3CRAA 2BEJA 1QB8A 5DO9A 2GN9A 4NCHA 3WLKX 2XXBA 1JP7A 4BGIA 3T3IA 3E9EA 1GLVA 4RGYA 5JQGF 1K3UB 2PY5A 1MA1A 1KP9A 3L1UA 4TVKA 4B73A 4EGCB 4KVZA 4AJLA 1VMGA 4RTSA 1Y82A 3NWJA 4WUTA 1VE5A 1UMKA 3WKDA 3ZCTA 5T67A 3SJUA 2R96A 3NM5A 5AM0A 5SICE 4ALLA 5EO3A 3TLAA 1THMA 5HXUA 1EEHA 2NO7A 4NZMA 1BIFA 4B3FX 3FTQA 5DNCA 4LBZA 2PUHA 3O7WA 1H9BA 3HV0A 3FF4A 3CC2V 3FB1A 2E5WA 3EXEA 3UKOA 4ZAYA 4Z9YA 5FPSA 1KI2A 4QDTA 3REGA 3SYRA 4US2R 2XOKD 1Y8CA 5AXDA 5LOVF 3FH0A 1V71A 4DOMA 3SR0A 4DYDA 3QZUA 3ETQA 2BFEB 2TMGA 4FX5A 1OXBB 3FSJX 3MC1A 1MFZA 4WCDA 3F6MA 3VCZA 2XADA 2QBYA 1H3EA 1NNI1 2YJTD 4G24A 4JXXA 2YY5A 4I9NA 4AI8A 3U9LA 3OOEA 1BMQA 2YV3A 3KHUA 3U81A 4AJEA 4EABA 3A36A 2V0CA 1RLUA 2O9JA 3HVIA 3JYPA 4K6FA 4OMUA 3G8CA 1JILA 4TLEA 5SZHB 4GL2A 3H5RA 5B4VA 4LWOA 3VPFA 4ZDJA 3AK1A 1K8QA 3PPIA 1VYTA 3GLKA 3WIBA 4A6PA 1S72V 4C7BA 1CVIA 2PVCA 2X4IA 1BXRA 4N3GA 2HGZA 2RJNA 1B6RA 4FP9A 1V9PA 4PICA 1XDDA 1DS6A 3ZU2A 4DDUA 1QIMA 3OZBA 2JFZA 2JGUA 3QXCA 4AZ0B 3HXMA 2WFMA 2I4LA 2HLPA 5A9TA 4XDGA 3OPQA 1JN1A 2OBNA 4RELA 2J32A 5GONB 1H47A 3QK7A 5I4CA 3E8MA 2XA9A 2NGRA 4KE6A 4NXMB 9LDTA 4PZLA 2MMCA 2R7AA 4KPYA 3ZCSA 1IN6A 2DQ4A 3VTZA 1HDRA 1T5TA 3AHEA 3ITEA 4CU5A 2JJYA 1FD9A 1CUGA 3CMEV 1F7YA 1SPXA 2XPCA 1JJIA 3ZHTA 1VYVA 2LP7A 1E2LA 1MC8A 2XE8A 1UC8A 3ENQA 3F96A 1J0XO 1CUXA 1GUAA 4C0LA 1C7ZA 3HDVA 3ZI0A 1CB7A 3FKSG 3F67A 3HJTA 3P0IA 2BHNA 5TY0A 5BRJA 3T1YB 1Z8FA 1F06A 4C5BA 5I7SA 3BFJA 2KKWA 2BTEA 2HFKA 4L3OA 1CW2B 1QZZA 4XGNA 3WGYA 1CKEA 2G72A 4WL0A 5A5DA 4QM7A 2Q7HA 2C58A 2Q3BA 3FN4A 4C4ZA 3EXG2 1I5OA 2ZSAA 1N6HA 2FPKA 1T2DA 4L50A 1KK0A 1WZUA 5DN6A 2WJYA 1IPHA 1EVIA 2UXCB 2O0HA 5FJ4C 3M70A 2WKQA 4FS3A 4LXHA 2I76A 2V7BA 3V1NA 5KYWB 2B9ZA 3E89A 5A3VA 3OD5A 3NJRA 1PQPA 4CMKA 1XAJA 4UAJA 1DU4A 1XKXA 3G0GA 4UTPA 4LISA 4RHFA 5FA5A 1O6FA 1KJ8A 2KMLA 3K9WA 3W5BA 2CNLA 3ZHOA 2UVDA 2ZITA 4OHMA 4XUEA 1P74A 2X2FA 2YQ5A 3UWPA 1VF6A 2WJHA 1E5LA 4PA4A 2Y1DA 1KXJA 3NONA 3IEQA 1PKXA 1H8EA 4JI4O 3E5MA 1A9XA 3VC2A 4FK8A 4CL8A 4H33A 3L4BA 3VJLA 1D2EA 1YZ3A 5AJTA 2EKZA 2VI5A 5C52B 4WJLA 1WMEA 4UCVA 2FG6C 4ZVKA 2FPIA 5EHZA 3D8RA 4D02A 2I7XA 1NVEA 3E1SA 4RD1A 1U8UA 3L4BC 5AVXA 2EJ7A 3NGLA 3EXIA 4URHA 2NTVA 4K8RB 1HP8A 5FPRA 1Z4IA 2PH3A 3FFMA 5EL0A 4ZDIA 4LMBA 1CEYA 1JQLB 2RKWA 1RYFA 1ODTC 4J6EA 5GADl 1IHUA 1LR1A 1L8DA 5DN6D 2R8PA 1A27A 3N6RA 1O8CA 4M8IA 1CVRA 1Z2CA 4I50F 3CW9A 2X3FA 3CF4G 4UHKA 3S55A 3SCZA 5M29A 5A7HA 3IP5A 1KMNA 1X7YA 2FUEA 5F7XA 1V7ZA 4LHEA 4JAUA 3GYBA 3JATA 5HJEA 3UW3A 4ZKIA 4MDYA 1FMFA 4H13B 2A3RA 3GZNA 1CUJA 3MS7A 1WQ1R 5L3QB 4JT2A 2QA4F 2MU1A 3KKKA 2JVDA 3KKZA 4KI0A 1PV4A 1SESA 3DV9A 5LMNB 2FWBA 2ZF8A 1EUCB 1U3GA 1N8NA 1RQPA 3OT5A 4RK6A 4ARZB 1ZOSA 4DM7A 4H9GA 5K3EA 1T36A 1F2UB 3O3CA 1TF2A 1MRZA 1M6HA 3KOWA 1DQRA 3O7MA 2AE2A 4M4SA 1X86B 4DR5B 1JDSA 3S0YA 2QN9A 3DZDA 2QWXA 4RAOA 3D3WA 2GA8A 1Y3IA 3KOXA 4O4IF 4BO4A 4DJJA 2WR8A 4F1JA 1CJCA 3TVYA 2D2FA 4GMHA 3OESA 5IC5A 1YZFA 1G7TA 4PSAA 4YDQA 4LTMA 5IP5A 2EKDA 1JQDA 1JHOA 2OP1A 4OBWA 2C54A 4EHBA 4NVPA 1ZK1A 1DJLA 4C0WA 4CKCB 1E0DA 1KR2A 2JHGA 1IOWA 3TQHA 5KTTA 1T2AA 3GFTA 5EMNA 4B0OA 4DJTA 1RADA 3PP8A 2OA0A 2RK4A 3M6XA 3Q4GA 5KHLB 2F95B 2EJBA 5I9MA 4EY7A 2IHVA 3LC0A 1EFCA 1HLGA 4G4ZA 1BXKA 4MUKA 3QKWA 3QWHA 5HTKA 4BX3A 2IEAA 1IOLA 3P97A 5EPOA 1O0CA 3LPNA 3HKBB 3JD4A 3HGQA 4MVJI 4B6RA 1W59A 1FJXA 2BE3A 5KTPA 1MB0A 3GNLA 1LWOA 2JI9A 1VMAA 2H59A 3RUDA 1LPPA 4C3UA 3DD1A 4GP7A 3FNEA 5EJ2A 3STXA 1RFYA 3VR4D 3ZMZA 3WB9A 2DXIA 4J1SA 3CCQF 1G2OA 4NYIR 1XTKA 2WSBA 4C29A 1YTUA 2F3QA 3PX3A 4KE7A 2JGEA 2YEVA 3N9IA 3WAGA 3UGQA 2AMLA 2FPLA 2Z3WA 1DEXA 4CYMA 3IJPA 1FP4A 1DWOA 1RXSA 3IHTA 2AXTZ 1JIVA 3FPBA 1QTNA 2Q8NA 1L3IA 1SQGA 2WRZA 4MRMA 1A9OA 3HB0A 1V7PC 4PINA 1D2CA 1KZ1A 2BELA 3KFVA 1J42A 1NIPA 3CUSA 1ZH4A 3C41J 5DOVA 4XUDA 3VH3A 3R65A 1B2LA 3Q2IA 4O4IB 4WDRA 2NO5A 5FX2A 1V8BA 2J46A 2VTKA 4TZ0A 5IBQA 3AFNA 1EK5A 2AFIE 3C98A 1CJSA 1FB5A 1XLWA 2L69A 3K1TA 4HNQA 4LXGA 4NG5A 4LOHA 5KNDD 3HP4A 1EM6A 4ZT3A 3FW1A 1IXBA 2R9IA 4JJ4A 1Z2EA 4EZIA 4GI5A 2MIIA 5CA1A 2GFQA 2FSSA 1E9BA 1IY9A 4KIJA 4YP5A 1LSOA 3DT6A 4GG1A 1VQ8V 4ZGWA 3AVUA 5IMBA 1UFIA 1D5AA 1SOAA 3FD5A 1TGVA 2WV7A 3ZNOA 1VHTA 2EATA 1ZQ1A 3O4FA 1SJ9A 4Q4AB 4WH0A 5CYOA 5A9RA 5KOIA 2GVIA 2O2HA 1MIOB 4UAVA 3CF6R 3V1KA 4YHHO 2Z9BA 1T2CA 3JAKB 3P3PA 1EBUA 2AF4C 3DB2A 2HUPA 3TLKA 1Z29A 2F9ZC 1R0WA 2ZGVA 1N3YA 1N9ZA 2GBLC 2GKOA 3GQBB 2FL4A 4ITUA 1VPWA 4CCAA 2QI2A 1C4XA 4D57A 4G09A 4TTJA 4TT3D 3CKYA 3Q5DA 4N5IX 1ZKDA 2PX4A 3C5EA 5A5GA 1ICEA 1YL5A 4F11A 2TMYA 2OFXA 3OQIB 3DJYA 4Q37A 3WK6A 2VAWA 2OHWA 3A2MA 3AEUB 2PF4E 3C74A 3IPYA 4B8YA 3BHIA 1IJKA 1E1KA 4RNCA 3A2NA 4NULA 2WSSG 3C6XA 1RYYA 2PL1A 4RCYA 1Z63A 1Q3KA 2GN6A 2YCLA 3B1FA 3DDZX 3LLMA 4PSKA 1Q1EA 2HM7A 3K9FC 3H1AA 3I58A 2DBRA 4BJ5A 3CPWU 2AK2A 1SR8A 1Z45A 2K5UA 3OP4A 3HYTA 4LC9A 2JFGA 1P91A 2P5OA 1PYGA 3EORA 4GOLD 1OXVA 4MW2A 5LQRA 3ZOZA 3BK1A 3HPRA 2YMMA 4QGSA 1V8DA 3DW3X 3LDGA 1KP3A 1SQ6A 2ATVA 3FZEA 4H77A 4MQ6A 1SF9A 3S1LA 1XB2A 2GQ0A 1W1IA 3B1YA 3JAWA 1G20A 4OG2A 1IY0A 5JEEA 1TCCA 4MI3A 4M9RA 1QP4A 2C4KA 3FWKA 4X8MA 2HYIC 2QTOA 4JUIA 3CWBH 1BEEA 3ZY3A 2ANCA 4LSMA 3GJTA 3PC2A 4L9WA 1D1QA 2FPSA 3KD3A 3QOYA 5F3WB 4R84A 3R7AA 5LOVA 3ZLBA 5A4MS 3K5PA 5E2BA 1YB6A 3C3YA 3O4VA 5EI5A 2ZBFA 2X5OA 2P9HA 4KHPB 3ZE0B 4ZKDA 4Y67A 5U9CA 3C87A 4Q4JA 4PRYA 4MW0A 3V8PA 1NNSA 1NXQA 4X7BA 3T61A 3U26A 4EELA 3HWWA 4RUFA 3ZE9A 2V8BA 4M1QA 1E1CA 2JPDA 3ZLUA 3ZV7A 3M2PA 3ETDA 4CBVA 4RTMA 3COWA 2YH2A 4DTIA 1XQWA 3L5OA 3NCTA 4EFMA 5CVTA 3RUAA 4LI0A 3WWDA 3DGEC 3IB6A 4KFCA 3LVBA 3HB3B 5F9FA 5FLYA 3S06A 1C80A 1MDBA 1WSWA 3NEJA 2Q7OE 3H8WA 3SVLA 3SGLA 2FN7A 1YFJA 1S01A 4Q3AA 1T6XA 4CLHA 3IAEA 4DV0B 4MGIR 2I1WA 2VH1A 3I9V6 5B8FA 4Q7MB 1MOQA 3LL7A 1G5FA 2ACWA 3Q0EA 1OXXK 1SBIA 5ILQA 2QE7D 5I3CA 2PZFA 3O5AA 3IUEA 1YVUA 2XQVA 3JQFC 3K03A 3PL5A 1YJ8A 1W9HA 2Z5FA 1J8MF 3H4VA 2IHUA 3O8LA 2DYSB 4F6EA 4P3YA 3SICE 4CE6A 4B6EA 3U6BA 2ZS7A 2IXEA 2DBQA 4G1VA 4X24A 4DQUA 3R7BA 3OWHA 5YASA 2JDIA 1FFXB 2RNBA 3DC5A 3V34A 1MA0A 4P0PB 4FLYA 3LDEA 1W8DA 4YJ2A 1A72A 3WVNA 3BK2A 3IOBA 5HKAA 1P6UA 4J7AA 3JARA 3AZPA 4KO2S 5IN4A 2P6RA 2AMTA 2ZKIA 3K9QO 1XC7A 4RXMA 4YRGA 3ASUA 5K6AC 1P5FA 1NN5A 2WYVA 3DHWC 4CM9D 1GGJA 2ZYTX 1X7YB 3PUKA 4HQLA 3OLVA 2QTBA 3J7TA 1ZEMA 3VR6A 1X1SA 2H1RA 2NU7B 4XGIA 4AIIA 3DAYA 3I32A 2J45A 4HC4A 4KDCA 5SYNA 1DGSA 3KZXA 1E96A 3OHSX 4I8IA 4WOPA 3R8CA 1JD1A 3COVA 2EL9A 3EAGA 4J43A 5LQAA 5L53A 3EOAI 4A0SA 2AGAA 4UVAA 3I53A 3MCZA 3RJ9A 4EF6A 4WCFB 4RKRA 3DBLA 4K86A 5EJGA 1RM0A 1T36B 4UU1A 2XRZA 1TU4A 1YD7A 3VOTA 2QN1A 4HYYA 4BVGA 3U31A 2Q3HA 4OD0A 5DK4A 1T9HA 3DWGA 4GZMA 3V00A 4BB5A 3J80A 4V0MA 5FBHA 2QT0A 1IY1A 2XA2A 1JEAA 2AG6A 1LPBB 3FKSD 3ETLA 3AG2C 1RCFA 4UQLA 1VI5A 3TTWA 1CIJA 1BS1A 1XVUA 2I6TA 1QH8A 3DMDA 4HADA 3RE3A 1HYEA 3M8KA 1CWUA 2P3LA 3QV1A 1I4OA 3ER8A 1I5XA 4ENPA 2IYWA 4E51A 3IQGX 2YXNA 2AZDA 4PNZA 3CKMA 4CKCA 2FJUA 2ZUUA 1QRSA 4K0RA 4QT0A 1K33A 3OZXA 1LBSA 4JLSA 1TJ4A 3FCUB 4URZR 3TTTA 1OROA 2NNWB 3LGSA 2GPTA 3L9WA 1WHTB 3D54D 4ILEA 3AZQA 4PQGA 1OASA 5CNMA 2HV9A 2ZG6A 5AJWA 1Z5GA 2WYUA 3L1KA 1K5DA 3BK7A 2QR3A 4LF7O 3T7JA 2Q3JA 5C7IO 4I14A 4ZZIA 3SY8A 3HKBA 2J3DA 1ZL0A 3G7UA 4I9FA 5LP6B 4I4CA 1P2UA 3AHHA 1MOFA 2DFPA 3DEHA 2JAOA 3KKLA 3QYJA 4UNIA 4DMMA 2KM1A 3KPWA 4PWYA 3GT0A 3BRQA 1JX6A 3K0HA 4QJ3A 2FPPA 2IOFA 3ETJA 3OOSA 3SQNA 3EW9A 2WM8A 2YIJA 3X1JA 3KHNA 4LX0A 4C2BA 4EGSA 1HDYA 1SWWA 2ZR8A 1ZN8A 2N46A 3V55A 4JL5A 3IHWA 3TXAA 1N0IA 1VBMA 3W5HA 4RIGA 3L0DA 1S0VA 1FP4B 2P27A 3D6TB 3LDTA 4DILA 2FYTA 2JCGA 3SGIA 1WP4A 5L45A 5GAJA 4D26A 1KDPA 1EWRA 2ZVYA 2FOLA 1CJTC 4B3GA 4MR9B 1T0AA 2P40A 5CPFA 4E2XA 3EXFA 1S2GA 3OE7G 2XUDA 2UYGA 721PA 4DR6O 1EHYA 2XOXA 4I3GA 4UARA 5A3SA 5AW4A 4XB1A 2PMDA 4TSRA 2OR3A 2RI0A 2ZJ4A 4YRZA 1E79G 3H19A 4NU0A 1JT2A 1L9KA 5DBIA 1T4CB 2VP0A 1OBCA 3ZHUA 5D5HA 4BLVA 1B2RA 4MRPA 3SLRA 4JEHA 4AD8A 2CXHA 4PLFA 3RRXA 3H04A 4GS5A 4JSYA 1E92A 1PR3A 3ZHQA 2QYSA 2FFBA 2PCLA 3RHFA 4L5YA 3GK3A 3EQ8A 1Y8QA 4BNFA 3C3JA 2QGFA 3ZHZA 4CR7A 3ERNA 3L6UA 4Q4AA 3WC4A 5C4IA 3OX4A 2IUUA 2UXDO 2PUJA 2FUKA 3VU1A 3CCSV 4ESHA 2Y3IA 5KCZA 4E46A 3JAKA 1FYFA 1I1HA 3C8ZA 3H2IA 5DI9A 2B3DA 1KU9A 1DDGA 1H65A 3D6MA 3KXKA 5BMVF 5BYAA 3EHBB 1TOAA 3BS4A 4JYMA 5EIWA 5FOSA 3BTUA 4IRUB 4RSMA 1M90H 4PIVA 4P0QB 1X15A 1L3BA 4TRJA 5KTYA 1BVUA 4RWUA 4QDXA 2JLAA 2NG1A 2Z2ZA 1R4ZA 4H1HA 3W3AH 2AI1A 2QY9A 4E5VA 1PSWA 1S8FA 3SQLA 3PSHA 1P2VA 4JELA 3O8OA 4Z1OA 2UYJA 3H75A 2HLDA 3ONNA 4IX1A 3SZRA 3MBKA 4FZVA 4GGMX 2LR0A 4N0MA 4IWNA 2L17A 4L76A 1SCAA 4UBJA 4DUZO 2R47A 3RVYA 4NATA 3WKEA 2AGVA 4ITVA 5EUCA 3QVGA 1TDJA 1JZQA 2YCBA 1TKAA 1YZKA 3K5HA 2R8ZA 4NV0A 4H7JA 4DR2B 2QU8A 3MWDB 4TM7A 1GU1A 4IHAA 2ZETA 4U9HS 2JG3A 5GM2A 1DAMA 4CQNA 3KTDA 3IMFA 1E1YA 1Y76B 1XVLA 4WOJA 2VHEA 3HUTA 2ZUEA 3GRUA 1URFA 2C77A 3C39A 2UUBO 5FQNA 3ZX4A 4WLFA 3ZJVA 4QJ4A 3WLOA 1OX5A 4P81A 3HWUA 3FYTA 4KQ9A 4R2XA 3TPCA 4FC7A 3AVTA 1QVFU 1P4JA 1SQVH 1G60A 4QXPA 3KHSA 1A7KA 4I8DA 1NG9A 1K6IA 1JHXA 3WYAA 2H16A 2GARA 2JFHA 3BSSA 2AXQA 1XCMA 1NJ8A 1JXAA 3DVLA 2P69A 2O8EB 1NVVQ 2JK1A 3ZGLA 3S8EA 3DBHA 2V7TA 1PLKA 4Z4CA 2FSIA 3I61A 1SIUA 3AGPA 3K7EA 1OZAA 2VK4A 4Y9RA 3PC8A 3VI6A 4G2KA 3GRZA 3A6LA 4OSEA 1E1NA 1UCFA 1V3VA 2Z5LA 2V58A 1N33B 1UBOS 1GO0A 3IRUA 2XODA 3OMLA 4Q3CA 4DARA 1GCUA 3CC8A 4L72A 2VTBB 4Z4EA 4E3WA 2CFOA 1X42A 1RXVA 1GGHA 1H4VB 4KR0A 4NR0A 5FPKA 4REQB 1IXSB 4QYIA 3DZKA 1W5AA 1DTEA 1LNSA 1I4EB 5HVNA 1YBVA 3IEWA 4U9IS 2O6HA 5AO9A 3GRCA 5BMOA 2FDXA 3W6UA 1A7UA 2VTDA 3UZUA 2VQFB 1HK7A 2C7GA 3OGIB 2IIPA 2ZPUA 4BFZA 2QX9A 1JFFA 5BR4A 3CTPA 4BEJA 3KDPA 1PZMA 1N9GB 1Q7CA 3W04A 1OFTA 3GJ8A 1PR6A 4GBMA 2FP4A 3DLAA 4H0CA 4HTAA 2DYYA 5EMHA 1KI4A 3BY6A 4MVRA 2GJ4A 3APOA 1FLDA 2ZIGA 3EXG1 1XTQA 2QL5A 1Z62A 1CF9A 4EIWA 4ENRA 1GQRA 4QAJA 1DJOA 1V8ZA 3ESJA 1CFZA 3LSUA 2WA3A 3BXOA 4QG7A 3B1KA 1GJRA 3MRTA 1AR1B 3IOCA 5L6LB 2R87A 2R00C 4HS9A 1XZAA 1SXPA 3ICCA 1VIMA 4ZN6A 2PMWB 4R9VA 1V54C 5DNAA 1SD1A 2OAQ1 5HY1A 3SC2A 5LWQA 4YMSA 3NBXX 4DJDC 2G70A 4G4SO 5B4UA 3A2KA 2HRUA 1KBZA 2PQ2A 4R3UC 4XM1A 3D7SA 3VI3B 5REQA 3LBAA 3GUCA 3GXOA 2Q1XA 1Z5OA 1V11A 4J76A 4Q1AA 4JR2A 5D84A 3RIGA 4B2IA 4BQFA 4E5KA 3CMAF 5GJVC 2C8JA 5THKA 3QKSB 5FHRA 1FYVA 1JTFA 3MB8A 1TW3A 3RAJA 3MT0A 2QX7A 4R01A 4RPCA 2DM6A 2I8LA 2XSZA 1H2EA 3WRXC 3ZTWA 2XF2A 4NFYA 4JB2A 3SE7A 3KKPA 4WFKA 4FINA 5JSHA 4A8PA 3OOHA 3ADBA 4WCFA 1K27A 3HMQA 2O2YA 4PLCA 3PV0A 1DXYA 4U39A 2DHQA 1V39A 5IWAB 4OJTA 2JCBA 2ZSUA 1NMUB 4DQXA 4HVLA 4DLXA 2HG5C 2LBWA 1TQ2A 1BZYA 1UK9A 3I04M 3PNPA 4I66A 1X8JA 5JD6A 2IOHA 5J2UB 1AB5A 1QGYA 2O7NA 3FCCA 4J4BA 1E20A 1ZX1A 2PEYA 3A1VA 3B36A 3QHAA 3OF5A 3QMWA 3RG8A 5K3SA 3VDXA 3E9CA 5DM6V 4MVJP 1NQAO 1DBWA 1YKGA 3GFVA 3L84A 4A8JA 2QYTA 2W6CX 2XUHA 4B7AA 2B6HA 4HFJA 3CCFA 5GOTA 1Q84A 1UP6A 1JHMA 3OBWA 1O8BA 1VRVA 5CCBA 3HS3A 4AXXA 1N9KA 3PD0A 3K35A 4F85A 3VC3A 2JDIG 1PT6A 1GPUA 4AYXA 1OOEA 4J29A 1OX4A 5A5FA 1L0NH 4KXRA 1ZZGA 3COZA 5CDHA 2BGGA 4S2UA 4D45A 5I45A 4EW3A 1U7DA 2CXNA 4GM1A 4YCNA 4A73A 2RIPA 3L6EA 3WA6A 2HPVA 5B5EZ 3T0FA 1ZESA 4CTNA 4Y6LA 4DV3O 5L95A 2H17A 3QEAZ 2OV2A 2PZMA 2EX3A 3A6DA 3OZ7A 3P2MA 1GN9A 5TMPA 3CVYA 2CCKA 2R85A 4A10A 4PX2A 3TD4A 2Q9CA 3SDSA 2H5EA 1OZHA 3EYWA 4TPKA 5IHPA 3LU1A 2FEWB 3SEZA 3PQEA 3ZGXA 3FTEA 2D54A 5AOAA 1HDCA 1OLXA 4ZAZA 1JV2B 3K3WA 2FG5A 3OE7D 4LBVA 4NENA 3D4LA 4DS3A 4FB5A 3VPBA 1QR8A 2B9EA 1GT91 4M53A 4FFNA 2OLEA 4DQVA 4RNDB 4I2NA 3K59A 2IBMA 1CP2A 1UXJA 2AXPA 2BMJA 3KQLA 2ID9A 2FZVA 1SXQA 1EFAA 1SXJE 4NTWA 4ARVA 3TVDA 2HPAA 2GTPA 1FS5A 3W7XA 2QYOA 2VPYA 1CHDA 3ON1A 2FRDC 4RZHA 4MW3A 4XPIB 4Y6OA 1KC3A 3JU3A 3NYQA 3F8WA 3C4JA 4E11A 1SVSA 5GIOE 2XCSB 3RSSA 1C7IA 3FDFA 4YLYA 1RMQA 1AE1A 4CV1A 2Q7DA 4V0RA 3AY3A 4K8XA 1RHJA 3NWOA 3I55V 1NQVA 1GFWA 4LH7A 1KZGB 3K6JA 4YO7A 2JHFA 5E8RA 5HFJA 1KBQA 2PUFA 3IEMA 4PDMA 2VPZA 3NP9A 3KJGA 2G07A 3W1WA 2AR9A 5COBA 3URKA 2XTJA 4RORA 3WMRA 1GQFA 2J5KA 4BKRA 1SQQH 1EJ0A 4TQ9A 3QFHA 4PLYA 4P5DA 2CGEA 1I33A 1DKRA 4G89A 3ASOB 4FM1A 2O50A 4QD3A 4RK5A 3A9WA 4RMHA 3W5AA 4Z1MD 1KDVA 2JZNA 1U63A 2FW0A 4DA9A 1HDEA 3FRHA 1L1FA 2Y0BA 4PE5B 5JCOA 3ZMSA 2HS4A 1TPZA 2AG8A 4IAOA 4PBTA 6AT1A 2O4CA 2W2KA 1Q0PA 1U7WA 3C3MA 4CKWB 2W0FC 5K3CA 2MOKA 4OI2A 3W2HA 4Q6BA 1E77A 1MB4A 1UEIA 5GPBA 4JBXA 4JHLA 1KOJA 3LY7A 1RJDA 2ZFUA 3PCTA 3QVJA 4LZNA 4DLYA 5BYBA 1GZ3A 4MMXB 4UHFA 4PLZA 1UJCA 4I6EA 2RI1A 2NU9A 3SEQA 4P4SA 2HA7A 2ZXFA 2EJWA 2ZBPA 2DT8A 2P6UA 1EWKA 3A1CA 2WU3A 5JT1A 1QONA 2GJKA 3MWJA 1VE9A 3L74H 3CPJB 5KNCH 3KT6A 4EHLA 3BAAA 2ZYHA 4X97A 3UM9A 4A0HA 4NTYA 3BERA 1V4BA 1REQA 3S2UA 1FP7A 1E3QA 2GPJA 2PY6A 3GLTA 4CLOA 5JJKA 4LJSA 1PNTA 2DQ3A 1RXEA 1YQUA 3FHCB 4FXOA 2VAVA 4EEZA 5AM2A 1ZUNA 1C9NA 2A0YA 1Z68A 3OY7A 3WLQA 3TVTA 1X1BA 3F4LA 3NOOA 4ZODA 1O4WA 4X61A 4BNMA 4DUPA 1LC3A 3Q0TA 5EJMA 4ZHQF 2ZJAA 3FCAA 1ZJ6A 3SP1A 1ODJA 3B6ZA 3LIIA 1V5WA 2PQMA 1GFZA 3HRIA 1M1ZA 1SD5A 1NW5A 1W0JA 2W6PA 1WP9A 2OVBA 5KQMA 1R5NA 2P5SA 4NI5A 3WFZA 2R9RB 1H2MA 3AVYA 4HYTA 1P2TA 3RM3A 4IO1A 1NYQA 3R0QA 1R8QA 1RTKA 3E83A 3ZZMA 3UIEA 1XRQA 2JIPA 5KQSA 1YQXA 1RYHA 1DB3A 2EKLA 3EY4A 3LA8A 4X64B 1RWBA 4DXAA 2ECQA 3ROQA 5JFGA 821PA 4JP2A 2LRHA 2P65A 4YPOA 2XCOA 4HNVA 1TECE 2QSYA 5KOYA 2VTBA 2XI4A 3HO6A 1HTBA 2R65A 1QFZA 1N92A 4C87A 4WIAA 4IRXA 5I9SA 2REOA 4CKEA 2OG2A 3AEXA 1SC9A 3Q15C 2ZE5A 1TMOA 1BWPA 4MR8A 4QVKA 4LKRA 4D97A 1L4YA 2XMPA 4LYFA 4XKJA 4ZXPA 2W4QA 4DMKA 1PZFA 1S7CA 5EAZA 1XZDA 2RCNA 2VDLB 2ZVDA 3B1ZA 3I2FA 4PTYA 1W34A 3D01A 4AZ3B 4QLBA 4YV1A 4DCNA 3NXKA 4FFLA 5FUMA 2VNHA 2PYIA 1EFTA 3CJHB 4TLBA 2WWHA 3KP1A 3SHWA 3IJEB 4FR2A 3DVQX 3H9JA 4U9UA 5K0ZA 4HEQA 1TQ4A 2GEJA 1VF7A 1XK7A 1XKLA 2OBYA 1X1RA 2JNWA 3PE4A 4Q00A 1JIJA 1YR2A 5DLPA 3RS7A 2ZDHA 3DPUA 3T5DA 1TYCA 4C14A 1JWBB 3CLRD 4INJA 4ZVUA 1P1HA 3WKBA 1P7ZA 1HE4A 2EU8A 2GPYA 5LQJA 4KSBA 1TYBE 3T0GA 2WHRA 2IPXA 1AURA 1FF9A 1UDCA 2A1UA 2PX5A 3GGSA 4BV9A 2SHKA 4OQFA 1HW7A 3U3OA 3BSWA 2ATEA 5CK4A 3VXKA 4GKBA 2ACKA 3CCCA 3CM0A 4I1VA 2AC2A 3UF0A 3LFOA 1BQEA 2VGNA 2Q2OA 1BA2A 3FUVA 3NGXA 1NF9A 1W0CA 3FNHA 4IIBA 4QUBA 3QKSA 5ISMA 1NVGA 5CXUA 3CRMA 2P9GA 1KIFA 4G5XA 4RABA 3RSHA 2QTTA 4FHFA 3SU8A 1I7FA 1KD1H 4KV7A 4AP5A 2V7PA 3VC7A 5E4TA 2QNBA 1A50B 4QGBA 4KIUA 3JVDA 3GGGA 4IQFA 3U49A 3FDJA 5DLYA 3WL5A 1PTJC 2HP3A 4C4OA 4DCOA 4NOKA 4ETMA 1P5ZB 5A9SB 2DE0X 2BV3A 3WLIA 4YRLA 4C4SA 3CA8A 3WTBA 4U2CA 4BECA 4TKVA 3TUZC 4OQMA 1RCTE 4HD8A 1O2DA 5KVSA 3OU2A 2AD5A 2F1JA 5DH9A 4RA6B 3G5TA 5JMWA 2ODNA 3M8AA 4R2WA 4ARCA 4Z8XA 1BW9B 2GPBA 3UMJA 1Z6PA 3HP1A 1T5EA 4YAWA 1J5PA 3MCAA 4A91A 2LW7A 2QRZA 3KTOA 1U7ZA 3IAM1 3DUWA 5FFNA 1FVHA 5FUYA 5H0IA 1JYEA 4F46A 5AW0A 1JYFA 3FGPA 3VNQA 3AVQA 5C7OO 4YONB 2HSZA 3S3TA 2CMKA 4Y1EA 2VQ6A 2XEDA 4XVHA 5DBFA 1JFTA 2X6AA 3ZZTA 4D9MA 2PFGA 1U9JA 1Z35A 4YRIA 1Z7YA 5LQSA 2G08A 1GAXA 4BTLA 2VGMA 1LVUA 1RYZA 2I67A 3GRPA 3PCRB 4GC9A 1Y3FE 2B37A 1YA6A 1SCDA 1ZUWA 2BC9A 4YBRA 2MMGA 1A3CA 1H8HA 5KVAA 5LMUB 3SD7A 1EZ1A 4MW6A 4G0UA 3VUEA 4C2AA 1G7CA 5BR7A 1ETHA 3FPHA 3O47A 1AJNA 3R20A 5GONF 4LF6O 3W7AA 3MHTA 3RYHA 3KEOA 5E8JA 4QJBA 1ZX3A 1UM8A 2B4QA 2C31A 4MVCA 1DFIA 4UEJA 1W4RA 1ZRNA 4NENB 3UC5A 4EVQA 3R7FA 4IOLA 4G1EB 4XARA 3FUWA 3R6DA 1KNXA 4QBFA 3VU0A 1R37A 1T3GA 2D4HA 4EG7A 3EIUA 4ZRMA 2HP0A 2QM0A 4MKFA 5BVGA 5CTJA 3A0RA 3GCWA 2BEWA 3EDQA 4U2DA 2C04A 1UAYA 3ZLVA 1MA3A 4B4WA 4B79A 3K5OA 3A28A 3GRRA 4WNAA 3W34A 4CI9A 4PPNA 4BZWA 5JAPA 3GA7A 2HBRA 3CN7A 4PEVA 4WFQA 3PX7A 1YQWA 2ALJA 2GDSA 1U28C 3CC4V 1M2HA 1M1KW 1QIIA 2QL6A 2WA2A 5DBGA 1K75A 5TEWA 5IT0A 1K9VF 2D3OW 4TWKA 3GAFA 2L42A 4JB0A 1NBWB 2C2XA 2QTLA 3THOA 2J30A 3JZFA 3R09A 2BHRA 3CSSA 5DNVA 4AICA 1M5IA 3FMOB 2DJIA 1AQLA 2Q9AA 4QBKA 3T8YA 3VYVA 4WFJA 4AWBA 4HVCA 3HKDA 1K3TA 3EWNA 4LFBB 1HKUA 3AOEA 1JDUA 1BNCA 2IZ6A 4BCBA 1D7OA 1QVAA 2CJWA 1MLDA 3SHQA 3DKVA 4BWYA 3VMFA 4AIRA 4AMUA 2PXXA 3D7LA 3TD2A 4CMAA 4J0EA 3VKGA 1JFSA 2OAGA 1FA9A 1V5FA 2ZJYA 3LA6A 3GMTA 2R4QA 4L4RA 1T3LA 1RKQA 1Z5ZA 3AEYA 3QLTA 3CIOA 2X0EA 3VR6D 3OQOA 3VGPA 1J8VA 4OP2A 4PD4F 1JJAA 2VJOA 3PKIA 4KWTA 2MYPA 2FFQA 4QNMA 5AKXA 3E5NA 4A2CA 1ECPA 4MWBA 2F43G 4BW0B 1YI1A 2W2KB 2XMQA 3D9QX 2Y76A 1L4LA 3OP1A 1Z36A 4RQFA 3L0PA 3ZRSA 1KJ9A 3Q3VA 1P0QA 4MPRA 1CT9A 2Z6VA 4Q1FA 2HDWA 2YC4C 4DUGD 4F5YA 3TINA 4AYWA 3O38A 4P2ZA 4HWSA 1K34A 5EC1C 2P4QA 2OFFA 1BOFA 1HFKA 3A1TA 1PS0A 3DL2A 1A1VA 3GBPA 1DKMA 3W2TA 3EPLA 2DLCX 4XA8A 2EZTA 2Y1FA 3JQAA 1BDMA 3HO8A 4PLWA 4KAXA 3BZWA 3HC7A 4P83A 3S0HA 5FBRB 1IUPA 1QV9A 2CUZA 1F3OA 4UTNA 4G36A 1IHPA 2X6TA 4KN8A 1PFGA 3F0DA 3OFNG 1Y0BA 3LC2O 4KFSA 4P32A 4UM9D 4AWXA 4CQLA 3ESAA 4CLDA 3FHLA 2JKYA 4K28A 3PHLA 2UUAB 2FN3A 2HNBA 4GPIB 3RRMA 2R0QC 1RZRA 3BWEA 1DUVG 2P6YA 3ZS9A 4NB5A 1IMOA 5EYPB 1SO8A 3ICWA 3KQQA 4L4SA 5CNJA 5EKDA 4ZMSA 1WKBA 2QTRA 1P9WA 4XDYA 5CNIA 3R5HA 2VSQA 5G0SA 3S4YA 2PVPA 1VTKA 2VRCD 3HJUA 3Q40A 3EF3A 4PXAA 1AHPA 3EK2A 3VZSA 2NP7A 2FW9A 4JPRA 4C82A 4LDNA 4A03A 2XB8A 1B6QA 1I2CA 1SB9A 3CVXA 4MGZR 3LWOC 1HMPA 2GEVA 3I55F 5AVTA 1PK7A 1YE3A 4RBNA 3SYOA 1PUIA 1Q91A 1ZD3A 4TRMA 5JHGB 3CXCF 1PNVA 3JAMN 2C5FA 3NHSA 1DRVA 1L6IA 3CUWA 1ZSVA 4KP4A 4YMIA 5DLQC 3V7YA 4DM3A 2DULA 1GPLA 3AX6A 1VCIA 2FMLA 2NZYA 5JCPA 2V59A 4KODA 5J5AA 1E1QG 5CLGA 3GCZA 3TSZA 2OHOA 2AZXA 1FFCA 2XVYA 3FAZA 1MR3F 3BEDA 3PXXA 2DSTA 2WT8A 1F51A 3ZMTA 5DWQA 2J8ZA 3ED1A 3RT9A 3USZA 4KITB 1J8DA 2F48A 2ZUVA 2W2NA 3BZUA 4G5FA 1NU1H 2AMFA 3QBJA 4LDJA 4Y1RB 5F21A 4AZ3A 3K0SA 1VG8A 2XYVA 3CH7A 2BBOA 3CT6A 4QGHA 4XOIA 3SEFA 4NCAA 2AFRA 4UHBA 5IS2A 2IS1A 1KAEA 4B83A 3DQQA 3GB9A 4P5EA 3J7AC 4DJFC 1QWOA 3E20B 4XFKA 4HLNA 1EJBA 2D7DA 5JRDS 2CGNA 3ZNQA 1OGYA 3LFUA 5JZBA 1ADBA 1NLZA 1TUEB 2GK6A 2HJSA 4BT2A 3ZCRA 3A1SA 4GOOD 3DHVA 2VBIA 4WK6A 1GWNA 4B2YA 4QIHA 3DTTA 4I9QA 3CYFA 3LQ2A 3RRNA 4G4WA 5AOCA 2N1MA 4E03A 3JVIA 1Q12A 4IVNA 3PXUA 4PLHA 2ZRGA 1YJWF 1U8TA 4YUZA 5CH3A 5LA6F 1P49A 3MXOA 4PQRA 4DPKA 2IV2X 2UYCA 1FFTB 5FFMA 5ALMA 3HU1A 5I9TA 3PXEA 3LO5A 3AVOA 4P93A 3TBKA 2G4VA 4P7FA 7ABPA 4F06A 4NUTA 1WY7A 4FN4A 4QOHA 2GPNA 5EJ4A 5LYYA 3U40A 2YHIA 4MJXA 4PO8A 3WP1B 1QHGA 1CUCA 4OLFA 2C2OA 4PZCA 2DUUA 4S0ZA 2IEZA 5CX4A 1IG3A 2UUOA 3LHKA 5BSVA 1UBFA 5IM4F 2GM4A 4BQEA 2RH5A 2PH5A 1PLJA 2XGGA 3DTYA 1Q3EA 3QUSA 1S5PA 4MUXA 2PWZA 1AKUA 2QENA 3HCWA 3QPWA 3KLOA 4PGAA 3R3UA 4QFCA 3A1EA 2V6GA 5CLQA 4EHFA 3HSYA 3JVHA 5AD1A 3A25A 3C15C 1Z38A 2HA5A 4BATA 3A27A 1X7PA 3PYLA 4XGKA 3TLGB 3A4LA 1A0OA 1J95A 4D3FA 2QN8A 1T0IA 2REQA 2EP8A 3EEQA 2ZATA 3FWPA 4ZD6A 2PXAA 3NTUA 2A0KA 3RB8A 5HDQA 4LUCA 1U2PA 2DR3A 4MVWA 5AKJA 1DVRA 4DANA 2YOGA 3LECA 1XHZA 4G8CA 2B8NA 4E5YA 4MB2A 3QMPA 1NMZA 2WF5A 5EUBA 1EYZA 1YDEA 2HIMA 4FQ8A 2YWHA 4R0VA 1SZJG 3GJXC 3WBFA 5JY1A 2Y6VA 4DK0A 1SKBA 2PI5A 2HU8A 3BF7A 3Q9SA 1KPGA 4OSPA 2G09A 2PG3A 4UZFA 3TKLA 1G21B 3CD6F 2P4HX 3M1IA 2Q7GA 2IUTA 3SYCA 2H63A 2EF0A 3CX7A 4M2LA 3VFDA 4F9TA 2O52A 4IDAA 5LA6B 2PT5A 3IVGA 3CP1A 2GMWA 1USUA 1S77D 1VPLA 1KQNA 1AGRA 4DCMA 2YN0A 2E4ZA 4LFAB 4A2WA 1DEHA 4H4DA 4JEIA 1ZISA 2CH7B 3R3ZA 3AM1A 1Z7EA 4WFFA 3NFYA 4EITA 4F9EA 3LG2A 5L3FA 1FQWA 2CK3D 1NHWA 3E3LA 5ECWA 3FCXA 3LW7A 1GPNA 2OENG 1YOVA 5CXQA 1QU7A 3NYWA 1H2RS 1TUGA 4PR3A 3KD2A 2PHNA 3GFRA 3OCJA 4G2TA 1L5KA 2AFIB 4H1TA 3TRIA 4ACAA 3THYA 2R7LA 4RTNA 3FYUB 3TSAA 3SJQC 3PHHA 2GB4A 3KL4A 3PUVA 4KB5A 3G6BA 2YZGA 5FYDA 3D36A 1LPOA 3VZQA 1I7NA 3QO8A 2GFIA 1TI7A 2KLBA 4LCJA 4C7KA 2IJIA 3FB5C 1S5HC 2CTQA 1DT9A 1C8KA 1SHLA 1IZYA 1Y6JA 3H4IA 1DJPA 4MHOA 5EKXA 3SSMA 3T7EA 4BNKA 4EB3A 1J20A 4BZQA 4JQCA 1IWOA 2Q3FA 2VP9A 3EUAA 3NVMB 4G0PA 4TN1A 2UU9O 1YZUA 2BP7B 1L5HA 4B7UA 3ZYCA 3EEFA 1SXIA 1ZH8A 4B31A 1V2GA 3RQSA 3NWBA 3JWIA 2J4FA 1Y8AA 5CA0A 5DYWA 2VPQA 4C2UA 2OY0A 4PYQA 3RYCB 3WO1A 4D9FA 3ZN0A 4YXWD 2F4VO 1B3RA 4GUAA 3BL5A 2VF2A 4Q0MA 4ZICA 4TV8B 5BZBA 5AW3A 3H9CA 5EMKA 4YQFA 5J1TB 3OM3B 1F8XA 3G2NA 3NI2A 3DO6A 2PRJA 1DPFA 1QU2A 4EGJA 5C3MA 4DR3B 1ENYA 3KJNA 4M6WB 5C5EA 4MPTA 3VYUB 3TLBA 3C5HA 5ALIA 2ODTX 2AOUB 3M6WA 5DSXA 3SN6A 3TS1A 4YAIA 1SKYB 2IJKA 4DUYB 2Y99A 1RA4A 1Q1GA 3NIGB 3PQFA 4IFIA 4JAVA 1C8LA 1TADA 2ZM6B 3I8OA 1I94O 3F7VC 1WZCA 3LPMA 3LZCA 3OA2A 4LGVA 3UMVA 3K30A 3VZDA 2IHJA 2DGDA 3EIFA 3HBFA 5E4YA 1W55A 1TVMA 4IL6Z 2G9NA 1E9AA 2V65A 1CC1S 4CS3A 2ZI9A 4XYBA 3N70A 3NIWA 1NTOA 2HHAA 2AMYA 4MQFB 2OVFA 3AUFA 1QNFA 2HY7A 1B26A 2C97A 1QOPB 2Z8YM 3AM5A 3L8FA 1N0JA 3ONEA 4JIMA 2JJ2G 1VE1A 5G1OA 3NB0A 4PYRA 1WD7A 2CDBA 3RA6A 2Y1XA 3R5KA 1WRBA 4UTXA 2K2QB 2ZVPX 1IZ7A 3VYRB 1KAQA 3MUOA 3U11A 2AC4A 4F5EA 2EZOA 4Y6GB 3FB8C 2VHWA 2WF7A 1LS1A 2G6TA 3IMKA 3ORRA 4N48A 2M9MA 5DM4A 5AHRA 1R73A 3I28A 5C37A 5HF8A 2UXBO 2VJKA 4OQNA 5IW8A 2LFRA 3FMPB 1XNHA 2QQ0A 2CXUA 1R0SA 1X7XA 1R1BA 2C0CA 1GG2A 4A1OA 1YKSA 4B9EA 1G8HA 2HL6A 4ATNA 3VR5A 1OAPA 1QCZA 2QA5A 4K8OA 2ZJ1A 4O2AF 4BRUA 3GA5A 5C1PA 1XL0A 2H3OA 4UUJC 3CF0A 1W57A 2VYND 3UWDA 1VGVA 4ILKA 3NT4A 1HT0A 4II2A 4LS3A 2IDMA 2QN7A 2HS3A 3L7OA 3LL4A 1E4YA 2P9JA 3Q7RA 4IF4A 3M89A 2C7OA 1UL1X 4DG8A 1K6JA 1RD4A 4DCCA 1VQKV 2Q4PA 1XTJA 2F1RA 2FB9A 2X3YA 3AQIA 3VX3A 3DHYA 5F23A 5JS6A 3HKCA 2C29D 4BO5A 5KTSA 1U3VA 2W9XA 2ZZKA 4ITRC 3IUPA 3G1UA 3S68A 3ZC3A 2FY8A 1CUYA 3Q3HA 1HTTA 4GQAA 4DB2A 1FRFS 2O1SA 2OHVA 1J49A 3OC6A 2SKEA 2AE1A 3LYLA 4KO4S 3KLPX 4LOAA 4YFVA 3WFIA 4KREA 2Z2KA 1FSFA 1BHO1 1BQ3A 1NMYA 1XTUA 3IO3A 1KL7A 3PHGA 4QU0A 5FUVA 3USCS 4UOEA 4ZCRA 1Y89A 4KGDA 4Y9SA 3S03A 1J4AA 1BDJA 4N5DA 4ZV7A 3SJAC 4C20A 1YIJV 2O3RA 1DINA 4ZXFA 2ZRNA 1XZLA 1VG1A 4DIBA 4ZEMA 4Z2YA 1MVLA 2P2LA 4C3VA 5H81A 1T15A 4UCXA 3T5AA 1BE8A 3W79A 5B57C 1RE1A 2Z3ZA 1TUEA 1V16A 4CM4B 1HUQA 1E6EA 3PN1A 1Z8NA 1ZWKA 2XE4A 4QDOA 3UAXA 4EO7A 3PQ2A 4DLAA 1Z4JA 4PLTA 4LF8O 5G53C 1VSBA 2EFHB 4F3CA 1J00A 1JIXA 4BIOA 3F97A 4JJZA 1DPGA 1T8YA 3EFOB 5FI1B 1F4NA 5C5CA 1Y5MA 1L5VA 4GX5A 1N0UA 3S8YA 3PDCA 4O2AB 3MXTA 4EMTA 4K40A 2A94A 3FSGD 1NXXA 4X5OA 3VOBA 2LE0A 2W90A 4R1MA 4PFJA 1W75A 3A6GA 2Z09A 2QRGA 2I4MA 2MYUA 4FDMA 2VCYA 5F35A 1P7CA 1NLYA 4O4HF 4RK0A 4OGKA 2NUAB 2C82A 2PRKA 1KZYC 2QKAA 4LXTA 2YXPX 2QDKA 3UO8B 2AEFA 2B3TA 2DP4E 2XOKA 3KX2A 4KPUA 3NWEA 4L27A 4Y30A 4RAQA 5EP1A 2E5LB 4AS2A 4WCVA 5DT9A 3RS5A 1EGVB 3IE0A 1E1MA 1RWQA 3RS2A 4JKOA 3K9GA 1KYOF 5CP8A 3TCUA 2FVYA 3KYIB 2UZHA 2R6FA 2OHIA 1ZVMA 4UVIA 2AKEA 4QA9A 4R8VA 1XXHA 5FLXN 5KX5F 1DIBA 2JD0A 1QUEA 3EVTA 4Z0TA 2Q9BA 1WUIS 4WN9B 2QAGA 5HR5A 1GYPA 1ODCA 1AR4A 3GJSA 1IBRA 4F4JA 1R6VA 1R27A 1ZJ5A 2ETVA 4A82A 2X8LA 4WNYA 3BH0A 4Z53A 1N6RA 4JT8A 2J5QA 2WC1A 4GAEA 1WVGA 2DBYA 4S1PA 1QP0A 4AROA 2C4VA 3K2XA 1ABEA 1U04A 1UADA 4TWZA 4WOCA 4YDRA 5FXMA 2NQTA 4XEHA 1BS2A 1E4EA 2ZYUX 3SM3A 2PZAA 1KEKA 4MWSA 4GUDA 2WFLB 1L7PA 1ZIXA 5LIRA 5LA6A 2XWQA 4NFHA 5E6RA 2ZRDA 3PGMA 2FTKA 1NBOA 1RLIA 3ND8A 4QUDA 4F4DA 3UKJA 4ZOEA 3V4FA 1NV9A 3TQSA 3AW8A 3VQWA 3HQ4O 3KKNA 3LPCA 3O8QB 2C9CA 3T4ZA 3EWAA 4JIGA 4D4MA 1MZEA 2NQ2C 3K8YA 2B5UA 1JEYB 4FU0A 1F23A 1YK0A 4F5WA 4BKPA 5CB0A 4FWIB 3OMAB 5DHTA 5TT1A 3PNSA 2C5SA 3F5QA 1Y3AA 3SIRA 4CKZA 4JFAA 4XDLA 3CRW1 2DTEA 1R64A 3ORSA 2RGXA 3R2JA 1ZNQO 1EK1A 4L87A 3DFZA 1LBEA 1W2BU 3FFWA 4ZBMA 4TTTS 4BWGA 4E5DA 1WABA 2H4XA 1G3RA 2Z4RA 3D0OA 3C6BA 3OOJA 3P9KA 4KN9S 4NFLA 5DEIA 3DNMA 3X2QB 2AI3A 4AHCA 1RS0A 1ULSA 2Q21A 4QQRA 1M90W 1UBRS 4DSOA 3W4KA 1WOYA 2CXTA 4JVLA 4KAAA 2X19A 2XMRA 3FR8A 3NAQA 1ISJA 3VJMA 4ZVLA 4CM8B 4DV2B 1JTEA 2F23A 1W4BA 2CDCA 4I6GA 4KSCA 2NSYA 2CV2A 1DTWB 2P0AA 1WW3A 1MJNA 1WU8A 3NKLA 2J3EA 4KX3A 3C6ZA 4ZAWA 4RD4A 1Z22A 3TECE 3D4BA 4ZGGA 3GWZA 4XB6B 4Y0NA 3VZBA 3BKWA 3G6KA 2IIQA 3GFOA 2A58A 2DR0A 1R00A 3P2OA 1EKXA 1A76A 2MSLA 4WZAB 3UH1A 4GLBA 1SUBA 2CHQA 3P9RA 4O4LA 3WIEA 4K9LA 3OONA 3F9IA 3HBNA 1QHEA 4QPZA 4G67A 5IJ0A 5J2TA 3JYCA 3OIWA 4TV8A 4PZZA 2EGUA 1E1RG 5D86A 3PFHA 3TD9A 4X6UA 2FTKE 3QOXA 4JMLA 1UWLA 1GMGA 1EFVA 4F4LA 3O95A 1FZQA 2ZU0C 4I19A 2DQ0A 4B7CA 2EINB 5CN0A 4UMFA 2KG7A 2GKGA 1LSJA 3ZH2A 2RHOA 3O2NA 3S1AB 5E0OA 5CURA 5M2QA 3WYGA 3GJ6A 1TTTA 2OMEA 4URWR 3ONDA 4JA0A 4CTOA 2HHCA 5B3LA 4GM0A 3V8QA 3L06A 1XKQA 4OH1A 3TB4A 4F12A 5BWCA 2HKOA 2IV3A 4Z0HO 4ZMRA 4U6SA 3JSAA 4HGNA 1KPHA 4FWTA 3VAZA 2PFKA 2RB5A 1NAIA 4BB0A 1IPEA 4ABTA 1E2DA 2BONA 2E3JA 2JS7A 3U1VA 2QPLA 4WNCA 3SZOA 5B12A 3IALA 2YXYA 1VG9B 1VHLA 3RAFC 4OAOA 1VQ7V 1XMXA 4IBOA 1R6UA 4L8FA 4O8CA 3G9TA 4KGZA 2C94A 1U2TA 4JEUA 2RHGB 4OYHA 2WWVD 4CKYA 2M7WA 3C3WA 1Z3CA 1EP2B 3KE8A 4DCUA 2ADFA 4ZQHA 4NZNA 1O95A 4PZDA 3LGXA 4DV5B 3C3SA 3CH5A 4L3VA 4OK6A 5A1TA 3RADC 4IJ6A 4JP5A 4ZDKA 4MPJA 1X9HA 3DMTC 3TR5A 4P3PA 5L51A 3RO7A 3NHMA 4EM6A 1UC9A 4FMTA 1QDUA 3K9AA 3S0WA 2GSWA 2VHCA 2BHLA 3OIGA 1N2IA 5AUPB 5KSOA 1SZCA 2RIRA 3UN1A 2ZI6A 4RL4A 5CA0F 4I55A 4H3KB 5FTKA 2PWPA 3LUPA 1ETUA 4UOZA 4HBGA 4L5AA 4L78A 3QVNA 4JI4B 5AKGA 3S81A 1L4KA 3U16A 3AJRA 5IXJA 1O1YA 1OXTA 3X0DA 2RMKB 1WAZA 2J9XB 2GCNA 4HNRA 3EARA 1SKVA 3PHCA 5I4KA 3WXMB 3M4SA 2Z2XA 3AUKA 1Q7EA 1MZVA 2PJRA 2YFYA 4Y2RA 4ZOQI 1PWEA 2E75B 1X38A 4QE3A 3KUDA 3ZWCA 3B09A 1B4DA 2BM1A 3TCXB 2G82A 9MHTA 3NJ4A 4MIYA 1T8UA 5HS6A 4NBTA 2R6ZA 2R7KA 2QRVA 2X8BA 2FYUH 1ZEJA 2M2IA 3CXRA 3E18A 3FRJA 3IT3A 3WBKA 4WZBB 1GDTA 3KKMA 1ES9A 2WKRA 1XD8A 2P2ZA 2IBTA 4KHPO 1YI2F 2EKPA 2IYRA 2QLLA 4HH0A 2O2IA 5AM4A 4BGDA 3DCYA 3EH1A 3MRVA 2BTQA 3Q7SA 1BTOA