4I4TB

Crystal structure of tubulin-rb3-ttl-zampanolide complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 158
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i4tB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i4tB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i4tB01
5JCOC 4B46A 5EZYB 4X1IB 3WGMA 4YJ3A 5KMGB 3VO8A 2BTOA 5EIBD 4X1KB 4U39A 3N2GB 4DXDA 3JAKA 4I50A 4KWEA 5CA0A 1FFXA 3JASB 4O2AA 5CA1A 3RYHA 3UT5A 5IJ9A 5LOVA 4EB6A 5EIBC 4TV8A 4U3JB 5GONA 3WGLA 3WGKA 3RB8A 1TVKB 4ZHQB 2RHHA 5KX5B 5IYZA 5CB4B 5LXTA 5LA6A 5ITZA 1JFFB 3JALB 3C8LA 2GVIA 2Q1YA 3JATB 4LNUA 5JCOA 4XCQA 3RYIB 4FFBA 1Z5VA 3HKCA 4ZI7A 3HKEB 4X1YA 4F6RB 2VAWA 1SA0B 3RYCA 5JH7A 1RQ7A 5EYPA 4I4TA 4O4IA 4O4JB 5C8YB 5J2UA 4YJ2A 1W59A 3JARA 5BMVA 3N2KA 3HKBA 5EZYA 4X1IA 2RHOA 4O4LB 5JQGA 3E22B 4HNAB 3N2GA 2R6R1 5J2TB 2Q1XA 4I50B 3RYFA 2BTQA 3JAWB 5CA0B 2VAMA 4TUYB 2XKAA 4EI9A 5FNVB 4IIJB 5CA1B 4O4HB 3RYHB 3VO9A 2VXYA 3CB2A 4TV9B 5MN6A 4U3JA 5IJ0A 1TVKA 1TUBA 2RHJA 5CB4A 5LP6B 5LXTB 5MN5A 5ITZB 4WBNB 1JFFA 4IHJB 1FSZA 1OFUA 4X20A 4ZOLB 3JATA 5LYJA 4DRXA 5JVDA 1W5BA 1W5EA 3HKDA 4I55B 4EI8A 4O2BB 5KMGA 4F6RA 1RQ2A 4YJ3B 1W5AA 3V3TA 5LP6C 4X1KA 1SA0A 3JAKB 2RHLA 5EYPB 4I4TB 5M7EA 3JASA 3ZIDA 1FFXB 4YJ2B 3JARB 5BMVB 4O2AB 3N2KB 4EI7A 1Z5WA 3M89A 3UT5B 3HKBB 5IJ9B 2VAPA 5LOVB 4EB6B 4O4LA 4TV8B 5GONB 4M8IA 3E22A 5JQGB 4HNAA 1W581 4ZHQA 5J2TA 5KX5A 5IYZB 5LA6B 3JAWA 3RYFB 2BTQB 3JALA 4TUYA 5FNVA 4IIJA 4E6EA 4O4HA 3VOAA 3R4VA 4TV9A 3VOBA 4B45A 3WGJA 3VPAA 2R751 4LNUB 3RYIA 5IJ0B 1TUBB 4FFBB 3HKCB 4ZI7B 3HKEA 5LP6A 2XKBA 4WBNA 1W5FA 4X1YB 4IHJA 1RLUA 3ZBPA 4X20B 3RYCB 4ZOLA 5JH7B 4O4JA 5LYJB 5J2UB 4O4IB 5C8YA 5JVDB 4DRXB 3WGNA 5MN4A 3M8KA 3ZBQA 4I55A 3HKDB 4O2BA
chains in the Genus database with same CATH superfamily
4P08A 5DCVA 3EEQA 3GZNB 4CI0B 4CCYA 4C29A 2HPAA 1FK8A 2QZSA 5IUNC 5BQ3A 1K4YA 4NSNA 4BJ3A 1K86A 4JLVA 3SVLA 2IQIA 5CLFA 1JLLB 4NYKA 4TM8A 3CZ4A 5K0FA 1TL7C 3WP1B 2GYUA 4MR7B 2V1UA 3TD3A 1FDRA 2FPXA 4FFWA 4ZJYA 4DSOA 3WB2A 3V4ZA 2PJZA 4W8GA 3V6MA 4EABA 4ZVMA 3TD2A 2CYAA 3WO0A 1FTYA 2HIAA 3UGTA 3A0HZ 2IYSA 3FIJA 1NSFA 3NAQA 3WNCA 2QBYB 1GA4A 4MDYA 3ROFA 1X15A 3DNFA 3BE4A 3FSGA 2Q9BA 1T2DA 2O8CA 3OT1B 3KJZA 4BS9A 4PEVA 3HCAA 1CN7A 2RBKA 3P19A 1E3MA 1V39A 5GOZA 3HLTA 3U31A 2QSZA 4R71A 3L7BA 3O75A 1Y66A 2QW8A 1OV9A 1VHDA 3GFQA 1P5RA 2BZSA 1BGWA 2Z4TA 4HTAA 2X0FA 3VRHA 3C8HA 3E9CA 3N2ZB 5EE9A 2AUNA 2CHVA 4I1OA 1RMQA 1OT5A 3ZXIA 4E13A 3ZHBA 1PUJA 1ENYA 2OCLA 4JJEA 2PWZA 4YXWG 1TO6A 1V9LA 2CYCA 5JNLA 1J2RA 2GK7A 3L0YA 2HVJC 4LDRA 3ZRWA 2WM2A 4JSYA 4WLUA 1KZ4A 5EERA 2O4CA 2PWYA 4AKTA 4J0IA 1NFFA 1W9HA 3GDHA 3IOBA 4FFSA 1DT3A 4DLAA 5J1SB 2Q6IA 4EF6A 2C8KA 1YC5A 4U9IS 2AC7A 3MGGA 1GKYA 3JQPA 3ZUGA 1YVRA 1N77A 1GADO 5A3SA 5ECGC 3QPDA 2WD8A 5D86A 4JI4O 4GRDA 2AR9A 4TGLA 3KAQA 2GNAA 3Q3VA 3AY0A 3CLSD 4LNUB 5D1HA 2EZ8A 1DOZA 3PP8A 1TX4B 4BN5A 2HO5A 2YZ7A 4YHBA 1Z9BA 3TCNA 2X5NA 4Y9TA 1OYVA 4AL4A 3UMMA 1BWRA 4I4NA 1SXGA 4CKEA 1LV8A 3E58A 1NZDA 3H6KA 2R7AA 3VR5A 1ZA1A 3EA5A 4CMGA 5GZ3A 3QLUA 4NYJR 3M7MX 3HJGA 2XZLA 5KYXB 1YHZA 5NLLA 3UUGA 3T54A 1VPVA 1DBVO 1KH1A 1PT6A 4HGZA 4LSWA 1XQYA 1MAAA 4BAYA 1I3KA 1UBHS 5BSVA 4ZCTA 3I2IA 3EEFA 3LFOA 5IT4A 3IMKA 1HQYE 2HA7A 2NO0A 2ODMA 2DFDA 4EQ6A 2J9RA 4C3ZA 4EG4A 4HS4A 4H15A 3RJZA 2AXTZ 3T7AA 5IANA 5L3EA 3B1KA 4M0KA 2FZCA 2P22C 3LPCA 5E9AA 3WIVA 4LBYA 4DV0O 4P7JA 3AF6A 3T7SA 4OI1A 5CN0A 2PMWB 3TI7A 1OWMA 2MJLA 4W5JA 2ZJ6A 3QVUA 3DHNA 3G0GA 4HWKA 3OKCA 2FTKA 3SBXA 1XEQA 1BS2A 4X91A 4QHSA 5A7FA 1TYCA 1JEAA 2UUOA 2QQGA 1EUCB 5E0OA 1V55B 3QSYA 1UBJS 4W7SA 1FVHA 4QVIA 1MO6A 4BO7A 1U04A 3GFSA 1GN8A 4INZA 4UCFA 4PN3A 1ZIPA 1Y6ZA 4US0R 2BFEB 4OXYA 3GDFA 3FTDA 3WL7A 2Q0QA 5AOVA 1G2PA 3ORSA 3Q3EA 3F2IA 1E2LA 4FKZA 2FWPA 2IPAB 1NBAA 4G86A 5E1OA 1WTCA 2F1OA 2E87A 4XIFA 4LE0A 5JNTA 2GDZA 5BYJA 4NFHA 4NCXA 5FUQA 1E66A 3SOZA 2TMKA 2VPTA 4HFNA 2CEKA 1PU2A 5BN5B 2RGNA 3T7EA 3WGZA 3OE5A 4PC6A 2MYPA 1T2NA 4LY9A 2YWCA 3KQHA 2AXPA 2A9FA 1KJJA 2YY6A 4EY5A 5EWJA 5DHFA 2ZB3A 1N7IA 5FAKA 3L0IB 3R0XA 1QJCA 1Z5PA 4F2HA 4YJ2F 4BKPA 4EJFA 1BE1A 1Z4LA 3IP8A 3EPKA 4GGOA 1OV4A 4KVAA 4P8RA 5DF1A 1ULUA 2P6PA 2OIGA 2HA5A 3R7SA 1MJGA 5FWNA 3E22B 3OZSA 5K1XA 5CDUA 2F43G 5CK5A 2PQMA 4YMSA 3RRZA 3GFOA 2KBFA 5BWNA 4JXZA 1F2DA 1EP3B 2RGNC 1DAOA 3B9PA 3E9NA 2EKQA 3L46A 1ZHFA 4XSHA 2JFZA 2Z3VA 5A4DA 1CT9A 2DF8A 4JBHA 5FJJA 3HQ4O 1J1ZA 4KQIA 2G7ZA 1N3IA 5C8YF 1N2SA 3MT8A 1H6CA 5AM5A 5FFMA 2C3MA 3T7KA 1D4OA 3RTBA 1A5SB 2QJFA 5KTYA 3VZRA 2BT4A 3PSHA 3GIWA 3V8NA 1SK8A 3WQRA 4MRNA 1KAEA 3R66A 2PHZA 4EGQA 2JBAB 4C7OB 1X1CA 2WY2D 1I2MA 2O8NA 4PE5B 4IZOA 3M2PA 3PVCA 3IMEA 4PAMA 4QM6A 2P40A 4KUEA 4FIDA 4BBJA 3M9WA 3CCEV 4RVUA 5CGQB 1CS0B 1SCNE 5KTSA 2ZIEA 3NANA 1WXIA 4LF7B 1RIFA 2HLNA 3EZLA 1U90A 5I7HA 1YIDA 2QMEA 2GPBA 1N1DA 5JO0A 1RYYA 4LRYA 4C3OB 4Y1RB 3RAFC 1E3WB 3U10A 1NZFA 3A1NA 1OI2A 4WDQA 4D97A 4OX9B 2E85A 3I6ZA 1R6XA 2GSDA 3FCSB 3D7KA 4FFBB 2ZRGA 3P8ZA 1PCXA 2ZJ5A 4A23A 4A5UB 3AG6A 5CA0F 2YWFA 2A8YA 2X6RA 3GCDA 3C3TA 1TMYA 1LXCA 1VP9A 5DOVA 3LTNC 1QV7A 2GFQA 2E3CA 1ISHA 2WR8A 5ALMA 1TPYA 2Z9BA 3SIUA 4DIBA 5EXSA 1YD7A 2BMWA 3M3PA 5HRAA 2VXOA 2YYYA 2AGAA 1J8YF 5BQXA 2P9TA 1U9IA 1V8BA 1GUAA 2GA9A 1T1GA 3M4XA 3JWGA 4YBZA 4P7GA 4Z3OA 1EVKA 2GYWA 3FB1A 2R47A 1Q0LA 2XMZA 4OP2A 3CRCA 4OHBA 3UEOA 4MVUA 3GPDG 4YP1A 4LVUA 1SU4A 1C3VA 4JI0O 5IJXA 2YYZA 4I6JA 3LY9A 3FD5A 1FRFS 4JB2A 3W06A 1JKIA 2GLTA 2AGVA 4Q16A 4LWSA 3AM3A 2J6BA 3GNSA 3FAKA 4R8VA 2D06A 4IVNA 1WDWB 2E74B 4PPYA 3U7QB 5COQA 1U9IC 2OZLA 5AKKA 1CJUC 1V1MA 1F9AA 3P9YA 2GM3A 2G08A 4BNIA 4YAUA 1L7PA 1RC0A 3V9PA 4G37A 3B12A 4BO3A 3O74A 2CL0X 2J3KA 4I5SA 1BQ3A 5F7ZA 4J7ZA 3E18A 4MUGA 4NTXA 2QUHA 1AB5A 4HH4A 3AEIA 5TR9A 1C9KA 1V1RA 1GKUB 4R84A 2WFLB 1SHLA 5H7XA 2FWAA 3IURA 3L8ZA 3IXMA 3GG9A 5ILGA 2BEUA 1E2NA 1DNPA 1Z6ZA 2WUGA 1Q12A 4HV4A 3AG4B 4UB6Z 4TWAA 1XEWY 2P0AA 1E1KA 3S29A 4XSGA 2XAUA 3BMQA 3TBFA 3CW2A 4C0SA 5DXJA 2O2GA 4WRRA 4Q7KA 2BFCA 1CIPA 2HB6A 4MKFA 3J81M 4CLXA 3CYPB 3IT3A 2CFSA 4HDOB 2L6LA 4MIYA 5JAMA 4XJVA 4PRLA 3N0WA 3OMXA 3DO6A 3QVOA 4X1YA 3OM0A 4ZI5A 5JH7A 2ZP1A 3CG0A 2IYOA 1RDFA 2QLNA 3NHFA 4BLSA 4HDSB 1K2WA 1ZCAA 1BWSA 4X85A 3NOXA 2WHXA 3RUPA 2J48A 2Q41A 4TXMA 2JEOA 4NMXB 3I2FA 4AWAA 1YL5A 4XB2A 4JQOA 2O8BA 5BR8B 5KX5F 1PFQA 3WMXA 2ZWAA 1E2BA 2P9JA 4DBLE 1XTQA 1XNGA 1FJHA 3SBDA 4J42A 3MT9A 4WFQA 2JIBA 3EODA 5DNEA 3ZN1A 4X3OA 2CGNA 5HSGA 4FFOA 2PUFA 1SQSA 2KE5A 4WCFC 1E0SA 3FZYA 4YRZA 3WKBA 1BDBA 4L4YA 1F7UA 4ENVA 2AMYA 1TA9A 5BWLA 1FQJA 1YJAA 2XZDA 2XAAA 2DFPA 2ZUDA 1MZFA 2HTEA 4EKYA 4A82A 1Y1RA 2PH1A 1AP6A 5I6DA 5HXUA 2NYVA 3PXBA 4DUPA 2ZYAA 1Q1EA 2FYTA 3SGLA 3E8SA 2KG7A 5EPEA 4UEOA 1RM1B 1Y5NA 1VCIA 3BH6A 2IH4A 3VTIC 3NC0C 2ZKOA 1LI4A 4W5QA 1Z28A 3LDUA 2VS0A 4MPDA 4R3WA 3HYNA 4KH0A 5CB4F 4E14A 1FRZA 4CKEB 3ABTA 1R10A 1DX9A 3WYCA 1PZNA 3UCEA 1DCTA 3L0ZA 2PD3A 3WK4A 1AIPA 1ULSA 5ARBA 2Q5EA 5K1ZA 5JPIA 1KNKA 3HVUA 4JSRA 2UYCA 1PVOA 2AHOA 2VG8A 3ZGLA 4L8GA 4RIHA 4QGBA 1KR5A 1IOLA 3OQBA 4MAFA 2BTOA 2WSMA 5EFZA 3FUCA 1TT7A 4NYMR 5KBYA 5DRYA 5I5GA 4GX1A 3BUSA 2WWVD 1RVDA 2IPMA 1B06A 2VQSA 3UJAA 1R4NA 4PYIA 5G0VA 3IPAA 2AEMA 1V95A 3O8QA 2H94A 2WA4A 3CXHF 1EHIA 3D81A 5DBIA 1RWNA 4H60A 2ZRNA 1CRLA 4QUEA 2JS5A 5ALXA 1KF0A 4L0CA 2JLXA 2C42A 3S99A 1RHMA 3IIKA 4X9QA 5JROA 4AIRA 4Y2GA 4GLJA 5K8JB 5DCWA 4F56A 1NJGA 4MVQA 4JFAA 2WF8A 4YMUA 1S72V 1ZC4A 4AF6A 1ZJ6A 3STTA 2R62A 4DARA 1V0JA 2PJRA 3ZWMA 4JKYA 4BY9E 3ZTTA 1W0JD 4LTDA 1D2DA 1L4KA 2NU9B 3OUZA 3SQXA 5IT9N 1PK7A 1QHHA 2QVLA 1H2XA 3AHJA 3QHQA 3ETEA 4PX5A 3OURA 5HIJA 3KAKA 3NKFA 1FSPA 1NVGA 4BT6A 4Y7CA 3WGUA 4QKQA 5I7RA 1SR8A 2DPGA 2C4VA 3O9OA 1GXSA 2W6OA 4DHWA 4F7DA 2WNHA 3TEFA 4GSKA 2IC5A 2GN2A 3OP1A 4OIMA 5DVZA 4IEFB 1C2YA 4F2DA 2B4QA 3PUVA 4GPIB 1E2HA 1SCKA 4ND1A 3WHPA 1NVXQ 4NCKA 5IYDO 2JIZA 4JEUA 1VL2A 1KMQA 2RBGA 4RJKA 3H11B 1DG9A 5AVUA 1XELA 5AJZA 4OKNA 3AF2A 5JJCA 2G9VA 3W9YA 4C81A 2UUBO 1T0HB 3CZ9A 3I2YX 2FEMA 5EWJB 3G82C 5CRIA 3N8GA 3KR2A 1H2AS 4ZFNA 2XUAA 3OE4A 3H17A 4FX5A 3R9IA 1QU7A 3FPBA 2C31A 2FG7C 2YFKA 1DPGA 3AHHA 4BZQA 4GHWA 5JWHA 5CB8A 4BW5A 3ZGOA 3OAAG 4KIJA 3HU5A 1GRNA 2H63A 5JD6A 1AXEA 2C0PA 4CCAA 4YY3B 2W90A 3ZU4A 3WWZA 3D5TA 1HDGO 2G7MC 1N4CA 3IAFA 3PCRB 4X00A 3P0IA 2HLPA 5EWMB 4Q1DA 2EARA 3GEPA 5DRTA 4H7HA 4TS3A 3KT3A 3OQVA 1NBMD 5CX1A 2QUBA 4DJFC 5E7JA 1ZY2A 1MOFA 3WNBA 5G1NA 3WYDA 1JVSA 3OX2A 3K0BA 2ECQA 3AUJB 3ELUA 2XASA 1R8YA 4UUBA 2QTAA 5JYDA 4CT5A 3PEEA 5A05A 3C90A 2ZRQA 1NQUA 3ZOPA 3HRHA 3G59A 3KC2A 5AOCA 5GWXA 1KWGA 1KDVA 1FFHA 1AS3A 4L16A 4FGLA 2FPWA 5F64A 3M8KA 1OSNA 2HT6A 2I29A 5ITWA 2LTAA 5FL7A 2RKBA 3LUDA 3DR3A 5ALZA 4KO3S 3H04A 5KTOA 2I6UA 3LDGA 4D4JA 3GUUA 1U3VA 3V7FA 5IUKC 1TFRA 2Q1YA 4RZ2A 1LI7A 4YX9A 2E76B 5B7NA 2PV7A 3JQGA 1PIWA 3AONB 3K72B 1DP4A 1Z2CA 3A2NA 2J31A 3B20A 3HJNA 2EATA 2NADA 5FLKA 4F4LA 3CCRV 2YCLA 4O4IF 3R3UA 4P7KA 1R8SA 2I66A 1ES9A 3AZPA 4W99A 4B6QA 3K9NA 1AA9A 5B1EA 3L5KA 1Q1NA 1Y7PA 5TGZA 1KEZA 4W9MC 1SQ5A 1UK6A 1MVLA 2CL6X 3N74A 4XWAA 3I6MA 2YNMD 2IU4A 4ONEA 2BH2A 2REQB 4KW7A 1I32A 4POOA 5IBCA 3KFLA 3SNHA 2V96A 4BWAA 2AW9A 2V4ZA 5B1AB 1JG6A 1KEUA 1PLJA 4RH0A 3MUNA 3BD8A 3DULA 4K03A 3MWFA 3AQ4A 1EVJA 1CTQA 1EFKA 3GA5A 4PTLA 2GK3A 1GU1A 3BA6A 5EC1C 1VRVA 1LDYA 3D6JA 4BNMA 3EDYA 4OHCA 5GQSA 3ZJUA 1R6AA 5E6SA 4KQ9A 3CUWA 1MXFA 4M1QA 2I2DA 4KSBA 4E94A 4J76A 3Q9UA 3ABUA 3B3GA 3OEHG 2HX0A 2FGKA 1XXHA 1L8DA 3OPYB 2Q7GA 5HM6A 2YS6A 1G5TA 4L9SA 2FR0A 4D4HA 4V2IA 5EIHA 4X5OA 4LWSB 5HXZA 2QV0A 4KDFA 1H69A 1FUUA 3I61A 4QUBA 4B3MB 1YV9A 4BQOA 1SCAA 2IQ5A 2AYYA 1V1MB 3BGVA 1G41A 3WK8A 5EBWC 1Y1PA 3ZUPA 1J9ZA 1HKHA 2UXCO 4M0MA 5EZ5A 3I4LA 4MRVA 4GMFA 1NTMH 1N32O 1U43A 3T5AA 1P9NA 4PDLA 2QVCA 1VSVA 5K0CA 1QZXA 2MR5A 5SY6A 4LRXA 2JCGA 1B8PA 1J99A 5IJZA 4BNTA 5COAA 1JKXA 3LWDA 4PLFA 1E1CA 3CRW1 4F11A 3SVTA 1S0VA 3KHKA 2Q21A 3HBLA 1JTEA 3QO8A 1HW7A 2OCDA 4L07A 1QFSA 1BU8A 4A15A 1ZEJA 3CC2V 3ENKA 2OGTA 2ANBA 1MB0A 1NR7A 3R0JA 3KQLA 5DW3A 3PKZA 2EHDA 3U1BA 5JCJA 4ZKIA 3BMQB 3EGXA 4KYVA 5BYAA 3AIKA 4Q7JB 1UPXA 4RVFA 3HVKA 4UD6A 2WKWA 3DCIA 1QVGF 1GD1O 5TMDA 3ZHRA 5CDYA 1LQTA 3DTVA 1Y8CA 1N25A 1YB2A 1T5SA 4FGWA 2I2CA 4YQYA 4X45A 4EB0A 2PZKA 3DFMA 1P0QA 3ON5A 1PUIA 1XJCA 3E48A 4JZ2A 3MTDA 2MMCA 4X1YB 3G5LA 4O4LF 2I78A 1S96A 5KYGA 1JG1A 3RUHA 5JH7B 2C2KA 3DLHA 2FP4B 3DGFC 5DEIA 4RV9A 1MNQA 4CVNA 3NIDB 1OYOA 1I94O 1REQB 2HRRA 4KJXA 4IRUB 4N54A 3Q1KA 3WGQA 1WB7A 4ICGA 4WZBA 1QE5A 2YUTA 4IYHA 4NB5A 5EP2A 3TPCA 4RFSB 2OD9A 3ZY3A 5LMUO 1XT6A 2OBFA 3S3XA 1RLTA 2O6LA 4KI0A 3ANTA 3THXA 1GL7A 2IHUA 2GXAA 4XAQA 1CUSA 2ZM5A 2NR5A 2GZHA 3WLTA 4BU0A 3NWBA 4K6KA 3A11A 4YDSA 1Z4PX 4ZT6A 3GGPA 2NNUA 1JU3A 2WHPB 3NNNA 1Z4IA 3C2QA 1U80A 3E27A 5JO9A 3IKFA 3U11A 3FUTA 3BCCH 1SGWA 2VT6A 2XITA 2Y0BA 4DW0A 5FA5A 2HKIA 5JR3A 1E9SA 3QHAA 4JI5B 1K3FA 5FL3A 3W7VA 2XEXA 4BE9A 2BI7A 1LR1A 5AI9A 4FM9A 1GT91 3HI6A 3PHHA 4CL8A 3NTRA 1P4RA 3K20A 2J3QA 2Y05A 2RHHA 1NASA 3D2AA 5MFZA 3IFSA 2Q73A 1G1XB 5DX0A 3ONEA 2JASA 3HKCA 2LBWA 3IE2A 4H3HB 2VSYA 3VZBA 1Y3AA 3KVVA 2PMBA 2L17A 4D41A 3S55A 3JQEA 1E79G 2KWIA 4C4ZA 4IEIA 3UC5A 1BRMA 3PE6A 2VDUE 1N0IA 4YDRA 2HWXA 4FTWA 4TKMA 1L5VA 2XODA 4YRRA 1H0KA 5JAZA 2X58A 4Y6LA 3C43A 1K8AW 1H1LB 1KETA 2CMHA 1UK7A 2LWIA 1YRLA 1VSUA 2ZZKA 3OFVA 4YT5A 3B53X 1UK9A 2GRJA 3U3MA 1SVSA 4I55F 10MHA 1QK5A 4TMXA 3O8QB 3SFTA 4MR9B 5LHIA 1E2UA 3I39X 5FF9A 1T5DX 1YCFA 3LHFA 4N65A 2E6KA 1C8LA 1BDHA 1DRVA 1YITF 2H4FA 5G40A 1KYQA 3ZW8A 4EHHA 3C8LA 4LF6O 4RLHA 1Z39A 3ZX5A 3EOAI 4UVEA 4QICA 4CM9A 1B3BA 3KXDA 4N0EA 1KSGA 1UINA 3SQMA 3O1IC 4M98A 2XCIA 1BX3A 3SAJA 1F1BA 4M7PA 2O3JA 2FYUH 1QHHB 4EI8A 1QX4A 3NKVA 1NMXA 5CLIA 4AZWA 5CURA 2I6FA 1VB3A 3HN7A 2AD1A 5HFNA 2AG8A 3DKRA 3PDWA 3N28A 3B38A 4HOYA 3W3AH 1MV8A 2Q7OE 1XV5A 2FE1A 4Z0TA 3IGAC 3REFA 1ZXBA 2XUQA 3N87A 4MKXA 4IKOA 3B8EA 3GFFA 1O54A 1JW9B 4PYMA 3H6HA 3K5IA 1WVMA 3AYXB 4WK4B 4G26A 3ZCRA 3E70C 1SKMA 1AGNA 3K0SA 1WAMA 4OREX 3TD9A 4K9LA 2LR0A 3W7SA 2FUEA 2OTLF 4BR6A 4IJVA 2XNHA 4RGYA 4LP8A 1QTIA 2UAGA 5F7OA 2ZR2A 2IM9A 4DRYA 3HB0A 4Y9DA 3NHPA 1P2GA 3SM3A 2MOKA 3WLJA 4CMEA 1Z7YA 4XLTA 2VUSA 2ZIAA 3KKMA 5TS3A 3D01A 1KDZA 1H9CA 1Q3HA 3OSUA 4LZJA 3VGPA 1SOWA 3ZIAG 3CH4B 1HNWB 5HNKA 1G1AA 4RADA 3BXEA 3M84A 4B4WA 2GBPA 1TVMA 5E3JA 5HMMA 3L1IA 1KO8A 1DTSA 4ZREA 4C7BA 1DKLA 4NL4H 3TMYA 2POQX 3PHJA 1WSBA 3KPUA 1CUYA 5CX1B 4QUAA 2HSWA 4EY6A 4J2TA 4XQ0A 5DYGA 1K4MA 1ZI8A 3CLTD 3RBVA 1YS7A 4YNBA 3K09A 5EVCA 3FWNA 1QUEA 1ADCA 1RW4A 1WBBA 3EIEA 3NDPA 3UPTA 2QT1A 4CMEC 2HWKA 3CN9A 2B82A 2Q3EA 2Q8PA 2LCIA 1OC2A 2Z2ZA 1KY5A 3I23A 5L3VA 4DLSA 1CIJA 2GF2A 1G21B 4NTZA 5H5NA 3QKSB 3ZGXA 3V7QA 3C15C 2AS0A 2FHSA 1F0NA 3OCVA 1RZRD 2I3BA 3SZUA 3AUYA 3CC8A 5BXZA 4PZYA 4WW0A 2LO1A 3C3XA 1DQSA 4G8DA 4RC9A 5FQNA 4EHBA 3ZCVA 1GZDA 3F7YC 2YXEA 3P9IA 4DYVA 1GCAA 4D81A 1BGVA 3CLKA 4UNSA 2E5WA 3CLUC 3D4OA 2GLZA 1W73A 3JQGB 3RA5A 1TQ4A 3HCRA 1M6VA 1C4OA 3K09C 4JH0A 4A1FA 4CG0A 4CL0A 1Q1ZA 2NLJC 2G6BA 1L4HA 3FI9A 5D2CA 4IGAA 3ONVA 5DYIA 2OY0A 2M6SA 4L6AA 4AKGA 4AROA 3JQAD 4GZ3A 3QVKA 1W35A 3WLRA 4I4TA 5JUWA 1MO2A 3TN7A 3QYPA 3LDCA 3LKBA 1E60A 1CR1A 1CJKC 1G20B 2BFWA 3BE5A 4CM6A 5TX7A 3UMSA 2CLOB 3P0HA 2O2HA 1BEZA 3M8AA 1QLWA 4HH3C 3GYGA 1NU1H 1MIOA 3T0GA 1JXQA 4ALNA 3WAJA 3VPCA 2O7QA 4KL8S 3FDFA 1UFKA 3KLMX 3AY6A 4MHOA 4EJ0A 3OZRA 5J2TA 3ABMC 3ESCA 2IYUA 3A9UA 4E5YA 1YDMA 2IY8A 4QTXA 1C3JA 1M34A 4UHJA 4X94A 1ODSA 4NCIA 2CKDA 2PLAA 3BK1A 4CQLB 1ZGGA 4B46A 1JR2A 4TN1A 4G9GA 4RK4A 1H6AA 2DBZA 1JQ0A 1XXHB 1L4EA 3C6XA 1V5EA 2C78A 1P45A 1YRAA 4AY6A 4WFHA 4FLZA 2HSEA 5J63A 4ZVNA 2B5OA 2W70A 1KHHA 4N23A 3HLYA 1P9OA 2RK3A 2B6NA 3SEFA 2B92A 2PS0A 4YCSA 2WYWA 2D1FA 4R7CA 5C80A 3HGTA 4ZCSA 5EZYF 1WCYA 1YH3A 1E2JA 3VO2A 4PPFA 2ZYVX 4IWNA 3LLVA 3H7AA 3PR2B 2AI1A 4JYAB 2YVAA 3VI3B 1UODA 3ERCA 3IPXA 1TADA 5CB0A 3LBFA 3LC1O 3BAFA 4MVJF 3QEMA 1BFDA 3VKUA 3U3OA 1CUGA 1OILA 2VDJA 2GEUA 1CQXA 3FIUA 2YL2A 4W8HA 4O1HA 3P94A 1NUAA 4DG8A 4AW9A 3T4UA 3KVRA 2P90A 3N8IA 2IBSA 4V3CA 2FWJA 2DU8A 3EGXB 3LECA 3SF8A 4DQXA 2IV3A 5JZSA 2AUTA 5C32A 2H1OA 4KXQA 4GDFA 3DTVB 1QHNA 1IFXA 2JDIG 1NM5C 4ZEXA 3BWMA 4N9WA 2UYHA 4I50B 3PNBA 1CV2A 1NVPB 4IFIA 1G8FA 2GEBA 1JHZA 1RD4A 3ILYA 1ZNQO 1KFJB 2B9VA 2Z1EA 5E6UA 2PT5A 4NC9A 5FX2A 4OMFG 4LE1A 4ES6A 3MXOA 4QGSA 3ZDAA 5HFMA 4V0KA 1KXZA 4US2R 4DR6B 4BT7A 4TZ6A 4DPMA 4LDQA 1VIMA 1U6KA 4WZBB 4X3CA 2ZBQA 3F7OA 3TOXA 4Y67A 5BVGB 1BX0A 1MX3A 2Y93A 2L19A 3NBXX 1UFVA 5KWSA 2GTIA 4QLOA 1EFRD 2OYSA 3H84A 3OCYA 2CXSA 3THXB 3C16C 2HMSA 2AJCA 3MC1A 2Q5ZA 3CV3A 4WBNF 2XUDA 3SK0A 2X7XA 3J7AR 1SC3A 3U3RA 1WY5A 3O3MB 1JG2A 2BBOA 3ZE1B 3S0HA 3Q3JB 3Q8XB 5KDDA 1ODLA 2YVLA 1IVYA 4HTFA 1KZ1A 4FB4A 1IPEA 3BWBA 4ETMA 1BN6A 1NNEA 4JUCA 1NATA 4XLLA 3P9SA 3NAZA 4Q4AA 3RR2A 1CQIB 5EJAA 3AWDA 5BYBA 3UAGA 5MFPA 1B8VA 4E5DA 3IBFA 2WPDA 2FU5C 3D9QX 3HXTA 2OCHA 4Y9SA 4IZHA 1HFWA 3TFWA 1N6LA 2Y0PA 3W7TA 2ALJA 4BTVA 1A9ZA 5DP1A 4BMDA 1COWG 1WV0A 1D5NA 1A82A 1W6UA 2BGRA 3H1LH 1FNJA 3HKCB 5INTA 2WTMA 3VDQA 2Y4NA 2UXDB 1BE6A 1NV9A 3HE3A 4L74A 5FTKA 4DR2B 3MOSA 2W6IG 2AFIE 1NP3A 4LKRA 3VQXA 1IXYA 4DR7O 1RXEA 1W1WA 3ZS8A 5F4ZA 1U63A 4NYMQ 4HNVA 5LPNA 3NORA 3U61B 5DMHA 4RK1A 3EDMA 2JFUA 1OXSC 1QO0A 2XCLA 4DDWA 3G4SV 2IF2A 4IQFA 3HPQA 1DWPA 4C0LA 4Y2UA 3IVXA 4OPMA 1NQWA 2XNCA 4JJGA 3D7SA 3QVGA 1H2NA 5EIEA 4UBMA 3BIWA 2P6JA 4G0ZA 4QOJA 3ZYCA 2VJKA 3IEXA 2HLHA 5EHZA 3Q40A 2GJSA 1NVTA 1SY7A 5EHGA 1U0LA 3ORYA 3B6KA 4C6SA 4JXKA 5LU9A 4OGLA 4NNOA 2A7WA 3AG3C 3OEEG 3VVMA 4YAJA 3ZS8C 1W4ZA 4V0MA 1VE6A 3F6YA 2Y1EA 4HH1A 2OVBA 2PGJA 4OBEA 3BWXA 5JRDS 5ESRA 5I7FA 1EX1A 2QA5A 2WBLC 5DGIA 1BMFA 2QY6A 1RWKA 1IJFA 4CKXA 4EAQA 1T5BA 3QK7A 1QWOA 3ECSA 5C35A 4B9AA 1U31A 3MDOA 2FZWA 3MTGA 5IK2D 1NN3A 2AOWA 4OHRA 1U0BB 4K9SA 2OBNA 4Y2QA 3PFIA 1JDNA 8LDHA 3F5WC 1JP7A 3TNJA 5FOWA 1T9KA 3H1BA 3H5RA 1TQ8A 1M2KA 1S8AA 1FPQA 2JEZA 4HR7A 3ZDFA 1AQ6A 3S6JA 4MP8A 1EBOA 5KU7A 1F23A 1AGXA 4M3NA 3UHOA 5JEDA 3WJPA 3ZBPA 4ZOLA 5FFNA 4KQEA 1NW4A 3NTUA 3EXAA 5CCEA 1Y3DE 5KOYA 2ATVA 4KQXA 1E5QA 1Z83A 1U2TA 3I56F 3H2SA 1RXWA 1JLHA 3JWPA 3OZAA 4BNDA 3CKLA 5EUBA 4RV4A 3GZTB 1TLTA 3IT1A 2ZT8A 3WWDA 1TZCA 1P4HA 2DYYA 1DIBA 3X43A 3VQVA 3RVDA 1PV0A 1CP9A 2W22A 3P0RA 4ZQFA 4CMKA 4JOCA 3TLXA 1HR0B 3W1EA 4CDNA 3CZ5A 5KKCA 1QLEC 4DV4B 3L6CA 4AN4A 3QLJA 2C5AA 1XK7A 3W04A 2NVWA 1FXWA 4DSNA 2JJ2A 1IEXA 3I5MA 1R3JC 2V7EA 4BIIA 1MABG 5F1YA 3E8BA 4AP6A 1GARA 3D3JA 2QKCA 2DFTA 3DMHA 4YUWA 2BI4A 1KP9A 4BVGA 2NTEA 3MB8A 5BSMA 4DMHA 3BDIA 4IG9A 4M53A 5KNDD 2QRKA 1YZKA 1WSWA 3PPVA 5ESXA 2VHTA 1YJNF 1T25A 4REQA 5LOVA 3U7IA 3UBMA 3WZ2A 3LGXA 2V7GA 2ZYRA 5HIIA 2ZRKA 1RC1A 4R6WA 3A0RA 2P67A 3ZVRA 3UK0A 1J95A 2KG4A 1UMBB 4U00A 3AKZA 4I36A 3AKDA 3OTOO 5LZ2A 4R8MA 3WK6A 2CMDA 4FBLA 2DPMA 1MOZA 3OFSA 2DHQA 1WPBA 3N2NA 3SYLA 1SVLA 3CCFA 2P9GA 4GRAA 2WE8A 4H0CA 3MMPA 3ICPA 2HU8A 3UMGA 1HE1C 4CLEA 4BVTA 3S0WA 3KQMA 3TS1A 3COVA 2GRUA 1IZ8A 1V8PA 1IMJA 1M6VB 3ABMB 2D5LA 1T4GA 1AKMA 5CLGA 2ZZMA 1AQYA 3G13A 1V71A 3BFVA 4MQLA 2EBFX 3MLAA 1GVHA 2G71A 4RZHA 3OH8A 5FI5A 2OESA 3E9QA 2OMKA 1L8AA 2OXEA 3OZWA 4L15A 4L8LA 2QGNA 3DL0A 3NFRA 3A1CA 4EPXA 4N48A 5HUJA 2P5YA 5K51A 3I6QA 1XZGA 3H18A 1L5OA 1C29B 4JC0A 1JIXA 4LYHA 5HKKD 4GOXA 4V03A 3HB9A 5BV2P 2QL7A 4DKJA 1H0SA 4OB6A 2YR0A 1IHOA 5J2TB 4XIYA 3T5MA 2YHUA 1UMDA 3CR7A 2HMWA 3HXLA 5CH3A 2DWPA 3FCCA 1M34B 1J9GA 1H2EA 2GN0A 1ZINA 3NKLA 3UMRA 3ZN0A 4ADSG 4ZALA 5TMPA 4PAQA 5BSEA 4IO1A 4P82A 4E5VA 2IJKA 1TFUA 1V3VA 2CLCX 1TA4A 1Z5NA 1OYYA 1SXJD 2UV8A 1YJ9F 2Q0SA 4G5QA 2WWFA 4MJ7A 4TX1A 2OZVA 4JBIA 2PEYA 3MGAA 4KK3A 5LM3A 4O1MA 3G2NA 1ONIA 4QU0A 2H8KA 2V5AA 3OZEA 4KGZA 2WV9A 4DG5A 3K8OE 4P0PB 1CQJB 3TG8A 4BLWA 4G4SO 3W7BA 3FBTA 1UXHA 1V5WA 2PZFA 5EPOA 4CS4A 1ZDMA 2I71A 5AQEA 2GT1A 4FU0A 3CT4A 2KTVA 3AI1A 3O73A 5T4BA 1OROA 3HDVA 1C9MA 2BZ1A 3KCQA 3DCJA 3P45A 2GK6A 1XR3A 2Q3CA 4DNXA 3O1LA 4XCXA 3NRJA 4N76A 4F2GA 4YRFA 3CE6A 1GZ3A 4PHCA 4F3TA 3NBAA 5I9NA 4N3GA 5LU8A 1J2YA 3G8YA 1RT9A 3PEFA 3EQ7A 2XRYA 4KNYA 2RIPA 3UK6A 4EI9A 4D4IA 3TTSA 4RYDA 4LJ7A 4PW0A 1U8ZA 4JLBA 3BZBA 5TJHA 4EY4A 2F3QA 3O1HB 2XVMA 3DW1X 2A9OA 3OQPA 1O96B 3STYA 9ABPA 1GGNA 3PJGA 5JTUA 5DWQA 2PA0A 4IYRA 3PQ2A 1VI5A 3UCFA 5HF6A 3IAUA 3WKEA 4ZC8A 3GN1A 1I36A 1LS1A 3BKXA 1E18A 2FX3A 2HF9A 4ZRMA 1Q8RA 1XROA 4RD3A 1D2HA 2RJZA 2P0EA 4KQJA 4ZYUA 4QD3A 2FUNB 3WJ2A 3V8PA 1S8NA 3U6KA 2PY5A 4E1VA 2I4MA 1N6PA 2HL6A 2EG9A 2ET6A 4IIVA 1GSAA 4ISCA 4JX9A 2H1FA 3A4NA 1ZO8A 3A3YA 1U3FA 4X8LA 5E6UB 4JR2A 1HTBA 4FCTA 1KY2A 1K8YB 4J0FA 3GJQA 3U4HA 1GTL1 5AVWA 1XEAA 1IZ7A 1YHYA 5COBA 1I7DA 4R2KA 3ZS9A 4Q6GA 2IU6A 2C9OA 3KX2A 5CA1B 5FWYA 4JY7A 4CL2A 3MSCA 1X14A 3KWMA 1XEFA 1WMEA 3KSUA 1V9PA 4Z4GA 1A32A 4D6YA 1RAIA 1WCIB 1AK2A 3LC2O 4CG3A 3TOZA 3S2FA 5CIWA 1F6DA 4DC1A 1N92A 1PTJA 4LXHA 5CG1A 2YC2C 3EDOA 4P6VF 3EY9A 3WJQA 4US1R 4KKVA 4H08A 1KBZA 3Q3IA 1R0XA 4YTEA 3DHEA 5FNVF 3H8VA 5AI4A 2Q28A 1LFDB 4M9QA 2PGNA 3KQPA 3GARA 1Z6QA 1Z73A 3F3SA 3CGGA 4Q4AB 3BJEA 1PT5A 3DZJA 5C1IA 3T6KA 1GQOA 3IQEA 5IYZA 2H8GA 4L5YA 3B2EE 2WJWA 1KXJA 4JAVA 2JANA 3CMMA 4LX8A 1N6KA 5FOQA 4K1XA 1KRXA 3QFTA 3BE8A 2C7VA 3SDLA 3P0EA 3QVMA 4FS8A 1QPBA 1O9HA 3C97A 2A9KA 3KXKA 2FB5A 1UDAA 4LI0A 3BULA 5KOIA 4TSFG 4HNHA 2FZLA 1JAHA 1PTJC 1KTIA 4DHEA 4A10A 3TK1A 3E9RA 1EUDA 2GETA 4X0EA 4MYCA 1Z4QA 4RQBA 4PG4A 1FZQA 5EGNA 2M9MA 1NUHA 2CKMA 4JELA 3DVQX 5AH0A 4JHXA 1E9CA 5LDDC 3HJRA 4Q4JA 2ZJ7A 2BH9A 2O0HA 2VZEA 3FRIA 2QMZA 4I1SA 4D9NA 2QLMA 2QD2A 4JAVC 5CIYA 1GKFA 3ANXA 5HK8A 2IYZA 2PZMA 2LJ2A 5AVOA 3KKZA 5AK0A 1AGPA 3CH7A 2FRXA 3E2MA 1KKMA 4Q3NA 3AIIA 3V48A 1WNFA 1LVUA 1GRVA 3IHWA 3QVGB 1M2VB 5T4FA 4KWHA 2O4UX 2BVNA 1LH0A 4ESOA 2CDCA 2O23A 4IQ0A 5BW6B 3U0BA 5LC1A 3ICXA 2AI2A 3PT9A 1NG9A 3D4LA 5H9CA 1NOKA 4TN5A 4OAQA 2PKWA 4ND5A 1ZN8A 4MWBA 1C7ZA 2JIOA 2WU8A 4B4UA 3AESA 3G88A 4KTVE 4MW0A 1OU0A 4LDAA 2WJGA 2VAVA 1IAQA 1TRHA 3FVVA 3KPYA 3WS7A 2CUTA 4CT4B 2XV1A 3A1DA 4CGYA 4UXJA 1Q2UA 1AA6A 2ZI9A 3R7AA 4N47A 3CLSC 2YC4C 1YU6A 3FLMA 1LW7A 1EFPA 1RRVA 3PB3A 2Y76A 1RPZA 2DOKA 4N5LA 4NJEA 2WVHA 3H9JA 1PR3A 5FTMA 2NACA 3WE7A 2W6PA 5B53A 1OBHA 2YZ2A 3WLQA 3HVRA 3OIFA 4IHAA 4MS2A 3QUSA 4HB4A 5KTKA 5BW8A 1OYWA 2J3IA 5KZMB 3QXJA 5PGMA 1JZTA 4WZZA 2X9LA 3UKDA 2WAAA 3D1VA 1KAGA 2WMNB 4CCYB 3I32A 2ZTSA 1PHPA 1PGNA 2OB2A 2ECFA 3P2IA 1U4SA 2RGEA 3NCTA 1OBVA 4ZOLB 3IB6A 5CPBA 3V4RA 1KKUA 2OCPA 4X7PA 2QVYX 2PT7A 4FT4A 3OAAD 3RF6A 3EPJA 2GWHA 4AX4A 1OLUA 1XZBA 3A6KA 1HETA 4IHJA 2QD5A 4UBLA 1SOVA 4M6WA 2WJAA 4K8RB 4TKVA 4WCFA 4NU5A 5BMOA 2O8CB 5EP3A 3ZNQA 1HOTA 4L5JA 1E1RG 2PS9A 3QF7A 2UUAB 4Z51A 3VOUA 5G2OA 3A26A 2IEZA 4CM3A 3PUYA 4AY3A 3T35A 4CLOA 4MW8A 2IZ0A 4DV3B 2NLOA 3C8MA 4PYQA 1O08A 3L8GA 3NHRA 1X3SA 1G3UA 2BCEA 4NICA 3TLAA 4RXTA 4Q4HA 1ZCFA 4Q66C 2AG0A 1QHIA 3JZDA 5KCZA 4DSZA 3A9SA 4D3XA 3HCDA 3HACA 2I03A 3VYSC 2E7ZA 2ABWA 5FI0B 3VDRA 4JNCA 2Z2XA 1OXTA 4OXKA 2O52A 5EC2C 2EG5A 3ZRWB 5ED4A 4REQB 4TQDA 5LOVB 2IOHA 2JLSA 4JTAB 3VSAA 4B3GA 1VGRA 3VSBA 2PKRA 5AJUA 3LHIA 4TL6A 2NV0A 3KZXA 2ZETA 2PCLA 5JFGA 3ZNOA 4XJSA 4E15A 5FV7A 5UKDA 3IEKA 1K33A 4KFRA 4X54A 2OBYA 4ZWNA 1J1UA 2IS4A 4AZ0A 3IKVA 5EZ6B 4ZOBA 4HFRA 4H1VA 2G9IA 4GX0A 3RT7A 4QO7A 3I5UA 4QAJA 3ER6A 2P9HA 3IV7A 1N2EA 3H5TA 4I1PA 4RESA 3RGBA 3K32A 5B4TA 1GZUA 3HC7A 4PLZA 2IYAA 4IWXA 1ZMRA 5CMUA 1IBLB 1JXAA 4Y2XA 1OJLA 1NDUA 2NU6A 4DRXA 3DEHA 4CIBA 5AI6A 3BYQA 2QRLA 5CX4A 3OUSA 1C1XA 4GUAA 4W9RA 2X8BA 4IMRA 4Y30A 1SXHA 3SWWA 2YVQA 3C3KA 2RONA 5BNFA 2YZKA 2XA9A 4LHSA 2MCFA 1RJ9A 4URYR 2Y0EA 1GTOA 4JROA 1MX5A 2QTBA 1CEYA 1GMGA 4EQ6B 1N6RA 3T1YB 3VX4A 1I24A 3KT8A 3VCZA 3NATA 4IGIA 1I01A 1TJYA 3TD4A 1E2IA 4QVGA 1UMDB 1MFPA 1D8AA 2VRNA 2OK7A 2IRWA 2DT4A 3P9RA 3V1TC 1O0BA 1XQXA 4GC9A 4IF4A 3V4FA 2CSLA 4URVR 1DHRA 4XE5A 4JXJA 3EVDA 1PV4A 4BJ6A 4GOJA 2B8EA 5DLPA 1KGDA 4JA2A 1JSLA 1X80A 2H1VA 4JX8A 4KUHA 4YUYA 2HS3A 1V16A 1M90W 5I7EA 2I62A 1Z36A 2R70A 1VQ7V 3C4QA 4JP2A 1I0ZA 3R74A 1O4WA 3RT1A 5A4JA 3E7WA 1SNYA 1G8GA 2AH5A 4G1CA 1ULHA 1GTJ1 2BMDA 2PT6A 2EAUA 1TNDA 3RROA 2QEXV 5B6IA 5K2MA 2W98A 1SB9A 4PA6A 4BFSA 3RS4A 2YWBA 1YI8A 3F6SA 1K1EA 3UJ8A 2XHBA 2XGOA 1ISRA 4C0BA 2P5TB 3AERA 3C8UA 4B35A 3KL4A 3IYLW 3KZNA 5FP0A 4WFIA 1X87A 4YIOA 4CFYA 4Z9AA 3P32A 2UVDA 2HMVA 1S5PA 4O63O 4DUZO 2BAGA 1XCOA 3OGIB 4BP8A 2IZ1A 1X2EA 4WY8A 3UOGA 2ADQB 4B6JA 3QVWA 4YRAA 1HE3A 1OD6A 4BKRA 1IN5A 3C3SA 3TVDA 1TM3E 3E15A 2VRCD 2PZGA 2FOLA 4EI2A 2BL4A 2W8BC 4PX9A 4UCUA 4MS1A 5BUSA 1TOAA 3NLLA 4ENUA 4BATA 4J1NA 1YB5A 2Q4RA 4QQNA 4UTVA 1R5NA 5CVEA 4B8WA 3PWTA 4TTSA 4M1YA 1SK9A 3CO0S 2FSVA 3ZHCA 2XUGA 3PCTA 4R81A 3RTEA 3D3NA 1SC1A 2FLVA 5IAKA 2WDPA 1WP4A 3FTEA 1S2NA 3ZWVA 4HLUA 3Q72A 3II6X 2GKGA 5FWYB 5GIPC 1RWXA 3RS7A 3ANYB 1JH8A 1O8CA 4QRHA 1P77A 3K9GA 4EPRA 2V6GA 1UWVA 2P4QA 3AKEA 1MOPA 1CEEA 4LQLA 3FPFA 1RJWA 1H4SA 4N21A 2L18A 4AF7A 3AR4A 1YZLA 4NP6A 1E98A 1R5OA 4U3JA 2OLJA 2DKOA 1E7WA 3UK1A 3WGYA 2Y1WA 2QE7G 4YC7A 2V58A 5DMXA 4DEXA 3AOGA 2VJMA 2FSVC 4BFUA 5KEIA 4ER6A 1FCJA 2GAOA 1BXKA 3IT0A 2W4IA 4F9FA 3NCHA 2NQTA 2WWHA 1EK1A 5IYZB 3KZCA 4HLUC 5KS2A 1VE9A 4G0MA 5AO9A 1PYDA 2I7XA 3DHVA 5ALDA 1X0XA 3N8HA 2VCHA 2J87A 3TH5A 3CBGA 1Q3TA 4UEQA 4YLYA 3VNBA 4HZGA 5G0WA 3OP4A 5B7GA 2AN9A 4GSYA 1FDUA 2VPPA 2BSKA 2EP5A 1CRQA 3SX2A 1GPNA 3K35A 3UYKA 1ZGHA 4QXOA 1AQLA 4WMLA 3WPXA 3CWQA 3IQFA 2JI4A 3K0DA 1KH3A 1Z5UA 4A8TA 5BW5A 1F2VA 1E79D 3ILXA 2ZXEA 2BHTA 1SWVA 3ID6C 5ER6A 4QWWA 4E4TA 2AXEA 5I47A 4UU8A 3G0OA 2GTHA 1T9AA 4OX9Y 1P9RA 3WWPA 4NFYA 2Q9UA 4MVMA 2YCBA 1D1SA 1VMAA 5DHAA 4DK1A 5ALWA 3A6JA 4AMUA 4DDMA 4CH3A 1QMGA 1AXRA 4RDCA 4ZT7A 5KQMA 1JSXA 3QU9A 2D1TA 3KE1A 4BW0B 4DSAA 3F71A 1PW5A 5CVCA 3NXKA 4F7WA 4NS4A 2RBEA 1COMA 4CG1A 1SG9A 1KQFA 3LDFA 1HUQA 5E7QA 1KNXA 3MZ0A 4IH9A 4RBNA 2IUEA 3UATA 1NZ6A 4ZI7A 2Z09A 4CW7A 5C81A 2Q29A 3K9CA 4Z8YA 1OBCA 3I55V 4WNAA 1RYBA 3TYXA 4R3UC 4DR3O 3PU6A 1P5HA 4FN5A 2OZLB 1V9CA 3B7WA 4LXYA 3SI7A 4MKRA 1U0RA 2SICE 3KWLA 1SQFA 2QX4A 1EFPB 3ZVKA 4UPDA 4QATA 3U9SA 3ZDEA 1X7YA 1FUYB 1LA2A 4KWTA 4NJEB 4OK5A 3OTFA 2W7TA 1MBZA 4UU1A 2HGZA 3LSUA 5DIFA 1T2FA 2WNSA 1F2TA 3U62A 1E1QA 4OI0A 3OETA 1C3OA 1MC8A 4J1SA 4LF8B 4ZZIA 4K1LA 1V1RB 3BY6A 1YZQA 4FINA 2ZYIA 3OGCC 3WGOA 5GY7A 1YNSA 2QGZA 5AI8A 1U0OC 2OM2A 4EY8A 3DF9A 4LGCA 2BEUB 4BO8A 3S68A 4L5AA 1W0JA 3TW0A 4JAUA 1N8SA 3S1SA 5GVSA 4E2XA 4FVMA 4DZTA 2C54A 4ZCRA 5B58C 1KO4A 1QUFA 2B8WA 2BFCB 2GPSA 4YRIA 5K45A 3BGWA 2FWIA 5J2UF 2ZE7A 1XDDA 3A6ZA 1YQUA 3DXZA 3ZEAA 4IHJB 1L7MA 3ZIAD 1FBNA 1MEJA 4TKVB 4WCFB 2HJHA 3I12A 5I01A 4ICIA 3P1JA 4H6PA 4Q1CA 3CKYA 4PYLA 4M1ZA 3BYZA 2PT9A 5LHGA 2MSKA 2XX3A 1PX2A 4Q9DA 1AUOA 1EE1A 4AJOA 4MJXA 3MUFA 3DFUA 1EWVA 3TM5A 1ZICA 4DK0A 3D4BA 2KPOA 4B3HA 1ZRSA 3MLBA 3L0SA 1M7HA 2RKWA 1T9HA 3W4JA 4PO8A 4ZMSA 2O8BB 4PNPA 4G0NA 4Q4HB 4JIMA 5B6PA 2F1RA 3IULA 1I4DD 2JRCA 1NI3A 1AROP 4FI3C 3A0UA 1XCPA 4ZCPA 3HLKA 3EWAA 4D57A 2P75A 1QOPB 3TFQA 3DE5X 2M2IA 5HZGA 4MWDA 1E2DA 1NXPA 1NUPA 2F55A 3TLKA 3HZZA 5HY1A 4B74A 2ORYA 3TTTA 1S72F 3NR7A 4ILKA 3V8EA 1OTHA 2ILTA 2WLIA 3QWBA 4G89A 2I99A 2FQ1A 3HXPA 3LQYA 2WINI 4PZUA 1RMTA 4K46A 4FFVA 5L7TA 2VJAA 3HY4A 2I8CA 1NBMA 4U8GA 3TGWA 2ZE5A 2VKTA 2OOKA 3A9RA 2KG7B 1TK2A 1ODTC 1WPRA 1C50A 4MQ6A 4PG5A 1Q7YW 2HA6A 1SKYB 4C5BA 3T12A 3RAEC 2FH5B 1YKFA 4INOA 4BMYA 5IJ9A 3H5NA 3ZBUA 4NYJQ 1YUNA 3R23A 2UDPA 3L7YA 1MPXA 3P2JA 3O65A 2NU6B 3K3WA 5EA2A 4Q3EA 2DJ5A 1C1XB 2REBA 2DHRA 3JQCA 4GCZA 4BKUA 5HOQA 1XTTA 5AJTA 3Q8LA 3ZU6A 1DVRA 1X8JA 4V1CI 2OZPA 2V1XA 3DVSX 1GGEA 3P4EA 3KXIA 3MHTA 5JY1A 2XUHA 1T0UA 1U0FA 5IFKA 1R4NB 3I2KA 2QZZA 2ZS7A 1NQ5A 5KO2A 4UEJA 3ECAA 1ZOPA 2IT1A 1EVQA 3J80N 2WZQA 1Y4DE 1A8QA 3CUUA 1CB7A 2BGTA 4M1SA 5IY5C 3T4EA 3NIGB 4D4MA 4ZT4A 1ORQC 3IVGA 1E64A 1AJNA 3RC7A 3L8MA 1U7HA 3DFIA 3JYOA 2YNMA 4WFAV 3MOIA 3DHYA 4ZEVA 1X80B 3E3MA 4IGFA 2C3OA 3BRCA 2JGIA 4CDMA 1BWPA 3GAMA 5GAJA 3WHLA 1BJRE 4EKEA 2PV0A 3U7RA 1NVWQ 3ITNA 4A0GA 1NL3A 3KCXA 1VQ5V 2WEKA 2IPXA 1ST3A 4B43A 4PBRA 4AO6A 3HWX1 2VDWA 5IDQA 3IBSA 4MKHA 4A8JA 2IJIA 3WLPA 2AIRA 3KLNA 2G1KA 4B7ZA 1E8DA 3BN3A 5ALLA 1K97A 2HMYB 1DT5A 5MN5A 1YK0A 3AILA 5ENVA 1GXSB 3A1TA 4IOJA 2UVPA 1N6IA 2FPLA 1DJPA 1E4YA 3G0HA 2PNFA 5H70A 3CE9A 1SIWA 3CF4A 1RA4A 2V7QG 3IBCA 4E4YA 1TDJA 4Q48A 2YNMC 4DXWA 5IXYA 1YR7A 2XQIA 3QA3E 4QGGA 2HU7A 4IGGA 1R3KC 1ZVKA 4ZTZB 4EYSA 3C1TA 4LSMA 4HLNA 3WKDA 4ENWA 5ALPA 3ES9A 5K99A 1GPYA 1TM1E 2QLTA 1OIWA 1MPTA 4YREA 3P9KA 4S0XA 1JBKA 2C9YA 4EG3A 1Z8HA 3ZWDA 1KK0A 3CCRF 1CUWA 3EYWA 2WA1A 4I5DA 4QSHA 1RCUA 4A8JC 2Y6VA 5K3AA 4UOEA 3Q7PA 4NH0A 1L5RA 3OLWA 1TF5A 4MS1B 3H16A 4IEEA 1JT9A 1ZR2A 4JJ7A 4ZGWA 1L7XA 3E53A 1ROPA 2DUMA 1JIIA 1JS1X 4IP0A 5J5AA 2YOHA 1Q82H 3HP4A 1T3ZA 4KTTE 1YS1X 5FBWB 4CIXA 3AI7A 1EDDA 3MGBA 1NOJA 3DOEA 5BN1A 2BEVA 3G23A 5CT8A 1OE0A 4PNZA 2QYTA 5H8WA 2LDBA 3H4VA 5C2JB 4KLZA 3C6ZA 4C4XA 2FQQA 3P96A 2IYXA 1TQ6A 4M49A 5AKEA 1X1QA 4JUBA 2EKLA 3CX7A 1V6AA 1AKYA 4DIUA 4U3JB 2HAEA 3H2GA 1I3MA 4H17A 1THTA 1U0JA 3Q7SA 3FKQA 1H4QA 3LBAA 3O4RA 2AC4A 1W9MA 4R8LA 4TTVA 1NVBA 4JLAA 2QNRA 2N1BA 1L7AA 1WD5A 2KB1A 5CLLA 3OQ1A 4RSGA 1UBMS 3QVSA 3T9CA 4B6GA 4JNKA 3VC1A 2XLCA 5BPFA 3RE3A 1PR5A 2PH5A 5LGNA 5IEJA 1MNGA 2HKOA 1MSWD 3ITEA 1J23A 2CHTA 1XL0A 1SEPA 2BSKB 5DNCA 3T1OA 4IDOA 4Q34A 2COEA 5KHAA 5F33A 2V7BA 2WLNA 1N2CA 5T64A 4KLRA 3Q11A 4G5FA 2W6ID 1OZHA 3CN7A 1RAAA 1ZVQA 4CN8A 1X1SA 1XRJA 3MN1A 2YUIA 3OOEA 4EJMA 5LVAA 3DOHA 3CC2F 2ZWOA 3NIBA 3OBWA 5A5FA 3GXBA 4PC7A 1VIAA 4RQFA 2FFBA 1UJNA 4QQFA 1ZVJA 3OFJA 5K0TA 3NVAA 1V8DA 1YZUA 5JCOA 3M6IA 1TK3A 1NW9B 5JZBA 1T9DA 2BJHA 4LJSA 2P4KA 4P3YA 1XMPA 4X1IA 4UOZA 5CXUA 4QIWF 1H47A 4FFRA 4RHEA 1E8MA 4UDNA 2APJA 1X92A 5CJPA 1S5JA 5HX7A 2QPTA 2C61A 4PPQA 1ZKMA 1MHTA 2WAMA 1JHMA 1D0IA 1H6BA 3HCBA 3JSXA 5A6VA 2Y92A 1P6QA 3MTAA 1DB3A 3E9ZA 3B3AA 2AYXA 5IAGA 2H57A 1T4CA 1RXCA 5E6SB 2R8XA 3AG1C 3OEED 4DCVA 4ALIA 4DILA 1EX9A 3E1SA 3CVOA 1TKAA 4M9UA 2YXZA 2EIMC 2R7NA 2WZDA 4FQ8A 1G9XA 4ZI7B 2JEXA 2A3NA 2I22A 5EJFA 3E8XA 1HNZO 4MWGA 3WFZA 3WMRA 3RBAA 3U4AA 3M99B 5JCOC 1B74A 4L8JA 5JANA 1NX6A 4B8YA 2F9LA 4QOIA 5CDSA 1UDCA 1EQAA 4JI6O 4A0QA 3B70A 2GVIA 1DF4A 3PUWA 4LRSB 1QKJA 3Q85A 1XCGB 1FLDA 4OY3A 4TWJA 1NM5A 4C3UA 4FSDA 5JXWA 3LCCA 2A79B 4ZJUA 4JP8A 3RYFA 1HY3A 1BCCH 2QDXA 3SIRA 1O1YA 1F2TB 3EDRA 3ZI0A 4CH5A 4HNTA 1IQRA 2HEIA 1RP7A 5LB4A 1Y6XA 5EE0A 3NNDA 1SZPA 1E1CB 2YXNA 1O4VA 3DXYA 3F6CA 1CUAA 4KV7A 1LQ2A 1LKZA 5LCXA 1U11A 3U56A 5AQ1A 1Y80A 3ZBTA 3TSYA 1XHOA 1L8QA 1SZJG 1PJLA 2I6TA 3W3AA 4FLFA 5H68A 1Q19A 2DWDC 1V41E 1YR6A 2CVOA 3BPZA 3AVTA 1EZVH 1AJQA 2QM8A 2HMTA 5T57A 2JFHA 4I8XA 2J0UA 3TOSA 1JZQA 2AWNA 1GTG1 2PWBA 2OFXA 1PEDA 1JJFA 3C41J 5KVSA 1GAJA 2IXAA 4UTRA 5T8KA 4UAGA 1JU9A 3TL6A 4YUXA 1LF5A 4PZAA 1SURA 1Y34E 3N59A 3IUNA 2X42A 4BGEA 4G6ZA 3F7MA 4MW9A 3OZCA 1BHBA 2R5NA 5GTHZ 4GM1A 4ZU1X 1P1FA 2EZ4A 4MQUA 3M5WA 4G1EB 1Q1GA 3WLAA 4EEQA 2FZKA 4WFBV 2FFJA 1LLUA 4YXWD 3EUWA 3ABOB 4MV4A 1PNTA 2Q46A 1TMOA 4A91A 2ALEA 3CPQA 3DOUA 2HQRA 1EDEA 1ONNA 4RVSA 4C22A 1TVCA 4J03A 1UEIA 1GQFA 3KAJA 5JJBA 1TEHA 3M1IA 2A5FA 5JZVA 2GPJA 4HFJA 3RWMB 3EZ7A 2IHTA 3BAAA 2Z01A 2VS1A 5T8KC 2Q8VA 2QVXX 2VL7A 2OHWA 1P33A 4QM7A 2F59A 4MI3A 1LPPA 1RWWA 3C4VA 3F6RA 4G9EA 2ZIWB 1RWMA 3C7DB 5AHOA 4FOOA 4OLAA 2XAGA 3PTLA 1LS6A 4PO3X 4BDTA 5A7HA 4MB0A 1Z56C 5HP4A 1DEKA 2JL1A 2DYSC 2VJLA 2QDKA 1SBCA 5BUCA 1QIKA 2Y4OA 2HXSA 1UCFA 3MRVA 5K3FA 2YQZA 5FI3A 5ALIA 4HRAA 2X6TA 2IOYA 1CERA 1BQ4A 2PU5A 5IJ9B 4B73A 4OHOA 4TQFA 1ZP6A 5CJJA 4W82A 2VEOA 5IWAB 2O3UA 3SXJA 2ACVA 4UVAA 2HDWA 2ZB7A 1RZRA 4C06A 2J85A 4HRVA 2QWPB 2PUAA 2ZB8A 4K0KB 5FCDA 1EFLA 1QWSA 1RPRA 3WKAA 5JY6A 2PUCA 1YVUA 2H85A 3SDSA 1BVRA 1T9BA 1DRWA 4XOIA 2BEKA 1P60A 4A6PA 3CLTC 4LDNA 2GHQA 2P30A 2VT3A 3JZFA 4AHCA 2JFWA 2XYGA 1JR3A 3I5AA 5F51A 3BTOA 3MWEA 1E63A 4C89A 1GNVA 5ENZA 1JTVA 3D43A 4KEAA 3RTCA 5JCXA 3WFJA 2ORVA 2E9SA 9ATCA 1WULS 2C5GA 3D0KA 2IBTA 1VQ9V 2IHKA 3H2HA 3JQAA 1D0SA 4BASA 4EYGA 4ZHWA 3NTVA 2IPLA 1W41A 1DINA 1N8NA 1C1HA 2DQSA 1VQ6V 1U9JA 4Q24A 5DWDA 1BQEA 1FNMA 3QU5A 4ZV4A 3IJRA 3UJ9A 4F1JA 1PPJH 1NBEA 1N2OA 1DIOB 2D4HA 4JLPA 4MV1A 5JAUA 2MK3A 1Z34A 1JDPA 4EMBA 4JB8A 2VDWB 5BQOA 2DPYA 5BSKA 3QBEA 1YMQA 1DPFA 3R8CA 3OC0A 1IWPB 3NXSA 3O0DA 1X1TA 3KYIB 5ALSA 2QR3A 4CS2A 4JYPA 4DA0A 3L0BA 2ZJZA 3CMAV 4MVJE 1ZH0A 1ND6A 1KFKB 4GO1A 3HR4A 3H3JA 4FJ1A 4FLMA 1DKRA 3W7WA 2BUCA 1V2HE 4P0TA 2P6MA 1K5HA 4L0MA 5EMMA 3FUWA 3EB9A 1LVGA 5BQFA 1DXHA 3L84A 4WDRA 4JD5A 4M0CA 2DR3A 3AY7A 3FWYA 3QPUA 2XBLA 1SERA 5JNVA 3HCOA 5DLEA 3MTEA 3KJKA 2X4IA 4Y6OA 1EPUA 5D87A 3CZAA 3QO5A 3GLHA 3AP3A 3LKDA 4LFBB 5AG2A 4ALKA 3GT3A 1GCGA 5LD2C 3EXHC 1HNXO 2JA2A 3WG9A 4FPPA 3FUVA 3DONA 1NZJA 1USVA 1USIA 3O2QB 1FNDA 3RSSA 4F04A 1NVUQ 2D3OW 1PYOA 4FCWA 4IFEA 4YVFA 2FE4A 2GILA 1UBEA 4KP7A 4OAPA 1E62A 1HDRA 5JCPA 3MFQA 2CL5A 3HYSA 4BO9A 3I52A 1FE8A 5K3OA 3UV7A 2R6R1 1ISPA 4F4IA 4HWPA 5FT9A 2WA3A 4PA7A 4EKNB 4GRIA 4J0GA 1W2GA 4QBFA 1ACMA 5IKPA 2YASA 2G1UA 3E03A 3KJNA 3U4QA 1PNRA 2O0JA 3P2YA 4PIMA 5KNDH 3AQIA 3WC4A 4RUEA 3RVOA 5BY2A 3AWIA 3KOWA 1PDOA 2YY7A 1J7HA 3U7EB 3OX1A 2JCVA 2GB4A 1JNXX 1QVGU 2ZVDA 2XSZD 1CUXA 1XO1A 3ER9A 2VWQA 3OUFA 4RF4A 3UPDA 5ALRA 4IUDS 3VGJA 1V96A 2OSBA 1NNLA 5C9ZA 3LE8A 4AJNA 1EFRA 4FYHA 2XXBA 1IY1A 4HAZA 3UJPA 2VAXA 3ZZMA 1Z0FA 3L1VA 3WHKA 3K31A 1QGZA 1N2CB 4BIUA 2ZUWA 5BSHA 5EJGA 2GCGA 1B6QA 1CF2O 5A4AA 3VR4D 3AG1B 1VI2A 3CEIA 1YB1A 1K2VN 1BJTA 3OZVA 4N8DA 3MRXA 2HFJA 4I4TB 4OA8A 3EGIA 1U65A 1DIAA 5B1BC 2O2JA 2O5RA 4AS1A 1SUDA 2YRXA 5JBQA 1M1YA 2ZI5A 4NU6A 4LZLA 4UUAA 1YRWA 4EELA 1X7WA 4RPKA 1MIOB 2PUDA 2HADA 4GYCB 5EJ9A 1AJPA 4X1IB 2JAHA 4XARA 4DA7A 3HCPA 3I30X 2CL7X 5HFLA 1M83A 3FYUA 1SVKA 3OU6A 2FKAA 2H16A 1DDIA 4CTKA 2V03A 3NHKA 3QP9A 1T4CB 2FSFA 1JH9A 2PMPA 4LH6A 4AJ1A 4LBEC 3DKKA 4RJLA 1WXWA 1TQDA 3SEAA 1PK9A 2WUEA 1E61A 3VHLB 3WXMA 2PZEA 2O3RA 4V0OA 3FOEC 1D6JA 1SCUA 1OX6A 1WDMA 1S3IA 1SRQA 4A92A 3WGIA 3TQSA 3PJRA 5B57C 4B80A 5U1PA 3BD6A 2NNLD 3GD7A 3FYUC 3REQA 3U09A 3OCUA 1TEZA 4PX3A 3UYLA 2A0KA 3FNQA 4CMHA 1FU7A 3O93A 2COKA 4ZTBA 1R50A 4HAIA 3M6FA 1H0HA 1T3GA 2XQFA 4QO8A 4GGMX 4ZYYA 2B2CA 3AUUA 1QQTA 1ETHA 1ABFA 4MV3A 1LI5A 2VPWA 1DADA 3C6MA 3M6UA 5DGHA 4LS3A 1UBSB 3QEMB 1TAGA 2ZCVA 3FNGA 3HYTA 2B21A 1Z33A 4LJAA 2OHHA 3K0AA 3UT0A 3E5HA 1U0NA 4W5TA 3HWRA 1DV1A 3IXLA 2GEVA 4HHEA 1SUWA 3HPRA 1S2LA 1SVUA 5JFTA 2GLXA 5P21A 4L08A 3E82A 2JHCA 5K6AA 3SF8B 1QF9A 1J8QA 2QP9X 2R6ZA 4R9SA 1ORDA 1DC7A 2VH2A 4RM2A 4DWWA 4X84A 2J0UB 3UXEA 2X1VA 3K59A 1E1RD 4ZAXA 4PLTA 1VXOA 5EXPA 2H2IA 1YA4A 3DF7A 4BECA 4OH7A 5YASA 4AT1A 1Z82A 2NO1A 1GUYA 3W0LB 5AJWA 3ZMZA 4LPKA 4ERHA 4MITA 3EORA 5B5SA 1WPXA 3G4SF 5HCIA 1YDHA 2JFVA 5TRTA 1VGVA 4U6SA 2UVQA 4RW0A 3FR7A 3PJEA 1IXMA 3AI2A 1HDCA 3CPWF 2JEYA 3ZDYB 1VQ4V 1TF2A 1XD2A 4G4JA 5K6AC 3AVOA 3K9SA 2GMWA 3CWBH 2IQQA 1KJWA 2PLWA 4HEQA 2XKAA 3RAGA 2ZRIA 4OQLA 2EGGA 1E3SA 1NJ1A 1EI9A 3PLAE 221PA 4HBNA 3TQIA 3OIVA 1R1MA 4ZAGA 1F6WA 3L04A 1IUPA 1N6OA 4ZVPA 4F8EA 4QYXA 4AI8A 2F9FA 3Q3CA 4HTFB 3FFBA 1A7JA 4N7MA 4RFLA 4B33A 2DCMA 2WICA 4Y6SA 4UVIA 1UK8A 1Z4MA 5DISB 3RAJA 1A3CA 1FOEB 5GIOC 2Q6OA 3F4LA 1U0TA 3ZZUA 1QIGA 4P35A 5JZOA 1NVDA 3F8WA 3L79A 3TOCA 2PYJA 4B3TO 3ZHZA 4PLWA 2WAOA 5IJWA 4P86A 2Z6VA 1JDTA 4IWYA 2GJ9A 4TMZA 4QTZA 3FOWA 4FE4A 3AR9A 4MXDA 1JR9A 4L9WA 3FBWA 5I7AA 5KNDA 1Y3IA 5FUVA 3NDRA 4M99A 4IT5A 1WE2A 5EESA 4ITVA 2A0LA 1ZUNA 3EQ9A 2WB2A 2Q1XA 4N4AA 5LQSA 3OKFA 3CWZA 1ZN9A 2EJBA 3PR3A 3DLTA 1XHLA 4HWGA 1BAPA 3AG3B 3BMOA 2VHVA 2Q3LA 1NFQA 2OECA 5I8ZA 2Q8QA 1RS0A 4OFWA 2VF8A 3I8OA 5TEVA 1DEOA 2QR4A 4XIJA 1HF3A 1G18A 4ARBA 4HG2A 1RXIA 4BQIA 4ZXFA 3DM5A 4J0CA 1KYZA 1E20A 3I4CA 2R68A 1ZRNA 4WINA 2NZVG 2R86A 4Q12A 2AJBA 5E8JA 4PC2A 2WSYB 2RNBA 2OGSA 3WAGA 3GBPA 2E18A 2GJ8A 5E9JA 3HADA 1ISIA 2CJYA 2C8LA 3Q7QA 3WGLA 5JMPA 1VL1A 1I2DA 3WB9A 2Q7HA 3AR3A 3ROXA 4HUQA 4D7AA 3THWA 4CM5A 3EVCA 1JQ5A 5JS1A 3UMBA 4DPKA 4QTYA 2X4GA 2CDNA 2R6GA 4QTTB 1CVLA 3X0DA 2FKNA 2EX0A 1H66A 5FPKA 1Q1AA 1BSMA 1S7CA 5EKTA 1UAAA 1YBAA 2X9GA 4PLCA 3OX3A 1OXVA 4LHWA 1TJPB 5HKKA 1YFKA 1Y0BA 4ACBA 3LRPA 1WUTA 1FEZA 2OV6A 4RE6A 1XBIA 1FAFA 4IGKA 1W5AA 2BFAA 4QOFA 2I2AA 4QXQA 3FDJA 3W2TA 4M8IA 1VQNV 4OBWA 3G6EV 4GXRA 3QMPA 2ZCUA 1ZGJA 4YR9A 2HSDA 3EUFA 1RZVA 2H4XA 3WDSA 1G8YA 5LL6Y 1ZWKA 4DSTA 4PFJA 5HS6A 2ODBA 1SXJA 5HZKA 1R12A 4W7HA 1O6FA 1DZIA 1QLEB 5GONA 3IELA 2VZ8A 1LPMA 4DCTA 3TLMA 2Q0OC 1FXKA 2D7DA 2HCBA 3RFVA 2N48A 2P4HX 2JGKA 5E9QA 3CIOA 4D56A 1XCLA 4L87A 5DN9A 1X9GA 2G82A 3JQ8A 2F3TA 2MU1A 3H13A 2CWWA 4BNDB 1GTSA 2OORA 3VNSA 2HMAA 4ZVRA 4GUNA 1VQVA 1R27A 4NX2A 5IRCD 3R3ZA 2DFKB 4S0ZA 2HW8A 2BZ0A 1SXJC 5KYYA 3QA9A 3TFOA 3PRJA 1S2GA 1AUXA 2ZTLA 3Q3HA 5A9TA 2XNSA 2QB5A 4Q3OA 3B2NA 3I62A 1KYOF 1T2UA 1FXKC 4UREA 5EIXA 3WLLA 4NXMO 1ZN7A 1PGJA 4P3NA 1DGQA 1ZCBA 3AFOA 3G67A 4KAAA 3G7SA 5EKDA 2PJUA 2OD2A 4ARVA 3E7FA 1IV3A 2OOSA 2QS9A 2EGHA 4Y6RA 3U4QB 2OORC 4TZZA 4XW2A 1YGPA 1KZ9A 2X4DA 4DV1B 4P84A 4PAGA 2QIOA 4UNRA 1UKEA 3LPLA 5F9MA 3FF4A 1CY2A 4S2UA 3LNMB 3ENVA 5H80A 2R11A 1F4MA 4ER5A 5KVQA 3A0RB 1Y81A 4M4SA 1MF7A 3LX6A 4MDFA 1ODFA 5EJ8A 4K2AA 1B8OA 4GD3Q 3D3KA 3QWFA 2DKNA 2LVBA 1WUHS 3WB1A 4GBJA 4OEHA 3FOCA 3O8DA 1QFZA 3IP3A 5CM8B 2NYRA 1I1OA 3LUHA 5ECYA 3ILSA 1IBMB 3A2KA 3BS4A 1IQPA 1FP7A 4NHOA 4RVNA 4QNMA 5THKA 1FMCA 1GAWA 2VNIA 4G5RA 1ADGA 2I3DA 4TT3G 1OH5A 3WMFA 3WYAA 1M2JA 3GWKC 4B0OA 1WNSA 1OWLA 3JARA 5ARDA 2PDAA 1NW3A 1M1YB 1MTZA 2V0CA 1NX9A 2R6CA 4J9UE 3T1HO 4M0PA 2WOOA 4TTRA 5CM2Z 4DLYA 3O9ZA 1D0VA 3QO7A 2CE7A 3DEYX 4MTOA 1T9GR 2JAOA 3D8RA 1RQ2A 1ZCZA 5G53C 2VPQA 1W4LA 2EFYA 4WPGA 3FYUB 1QHYA 3DEAA 1V3QE 2VDMB 5FWAA 4WY2A 4IMPA 4YR7A 2ID4A 1OLXA 4RCYA 1VQ8V 1A5BB 3VMMA 1XU4A 3PZBA 3OEWA 3KKKA 1RYHA 1M5IA 3OEHD 2OA0A 4G9BA 1TTPB 4QYTA 2GJ4A 1BRTA 1MMFB 3K03A 4CS3A 3ND6A 2RC5A 2B69A 1RZUA 2J0SA 2P62A 1QIJA 4EFKA 2ZDHA 1W52X 1DOAA 1MAHA 4OO3A 1JMYA 5DB4A 3EHDA 3A4VA 3HDYA 4RTKA 4YIKA 3NTLA 2V7TA 3CJTA 3OQHA 1H0RA 1UEXC 4WN3A 3VU1A 2AF4C 1NE7A 5AKLA 4WOPA 2V98A 2VF7A 1ZU4A 2EOAA 2PBZA 3KKQA 2W8BA 1W29A 4H6XA 4CIAA 4C7JA 1XVIA 4IJMA 3OOWA 3INRA 1ESZA 3CCEF 2EIXA 3NEJA 2JJ8A 4JGGA 4Y2JA 4FM2A 1NRWA 5E3HA 1QP7A 1Y7IA 5ICSA 3CUYA 2IEDA 1KPGA 3K0AB 4LCBA 2ZJFA 4FS3A 3RC3A 4C6TA 2QRQA 2BFPA 4IX1A 4AJLA 4QARA 2DFVA 1RI2A 1H3FA 4E7PA 3SKYA 1SD2A 1US6A 3QU4A 1H2SB 2VO1A 1XI2A 1W59A 2C2MA 1DXQA 3ETQA 3IOMA 1XCBA 1I1NA 2W00A 5TS2A 2JRIA 3QUQA 4RQEA 2HK9A 4NV1A 5IKEA 1FNNA 3M5CA 3EIQA 3SPGA 5LMZA 3NALA 3OCJA 1T0JB 1HP8A 2V4DA 4GWKA 3IIMA 1Z6AA 2HJDA 4L3VA 1G4AE 3STHA 3LMKA 1L4GA 2OO7A 3BSSA 1E5TA 1ZONA 3AW8A 4K6OA 1A2KC 3L49A 1DXOA 3FKSG 3P3NA 4H0NA 4LBWA 3SJBA 2ERYA 1C7JA 5ALUA 1JR4A 2ANCA 2WTAA 4DW8A 1VF7A 3EFHA 1FFEA 4MUIA 3A4LA 2X13A 4RSRA 4HUJA 2P9CA 2VUIB 1BIFA 1YQWA 3T0IA 3WIDA 1JJOA 3PCXA 1KI2A 2DWEC 1ZOLA 1Z88A 4GLOA 4EO9A 1PJZA 2VIIA 3PNMA 3MJTA 4BIOA 2IDJA 1FYWA 3IEIA 2WYUA 4DJAA 1YBHA 3BGDA 4KNWA 4G0VA 2CEAA 5K9ZA 3IKMB 4E11A 3BXOA 1Y6FA 5DGTA 3OCWA 2OV3A 2EJVA 3SJBC 5L3QA 1C9DB 3UW1A 3ZRSA 4Y18A 4HX5A 5BWOA 5A2QA 3DBRA 5F3WB 1JHQA 4BFYA 2WT4A 1OHHG 1SM4A 4KMMA 3IUJA 1Y74A 2HJSA 3COSA 4PGHA 5IN4A 1LK7A 4BP9A 2V9PA 1EUDB 1Q0TA 3A10A 2GBLC 1E7YA 4GR5A 1MX1A 2O5EA 1N5LA 3ZWOA 4X60A 3ROMA 3BMOB 3E9EA 3P2MA 1M8GA 1PLLA 2GBFA 2VCYA 4YRPA 2UZ0A 4Q4JB 1Z15A 3LUGA 4C20A 3PHGA 2CTRA 2IL1A 3LWRC 3A1EA 4QWMA 4D8WA 2ZUVA 3VQWA 3D7LA 4UHCA 4NCJA 2NO6A 4BCDA 4GX5A 3IPRA 2P5UA 4RCZA 4PHGA 5JSKA 4FP9A 3A1WA 1LFAA 3QG5A 1SC6A 2UZ4A 4KHPO 3WTCA 1ARZA 3SR0A 1DGSA 2DTDA 4BLOA 3THWB 1L5FA 3HBMA 3H2BA 3HEMA 5THQA 3DAOA 4YB8A 3CEAA 4URWR 3Q15C 5CFLA 2P2LA 2VZLA 2X4LA 1PVDA 4UBIA 4M0FA 3AESB 5F4BA 2ZLBA 4X41A 2PR2A 4ILEA 1DZ3A 4K6CA 3ZDCA 4DR1O 1XQVA 4TYPA 1DF5A 1JN1A 1GZ5A 4MPRA 3N8NA 1TIBA 2AW5A 1GO0A 3ZNNA 3TXYA 2XNJA 2HRCA 5JMOA 1XIVA 4LNHA 2A67A 2I8AA 2EQBA 4DCMA 2BOVA 1EWKA 4X71A 4RZXA 4IDPA 4HZ3A 2V9YA 3T95A 1OWOA 4Y2VA 5JH7F 3LK6A 5J4KA 4DCSA 1FFDA 3R5XA 5ALJA 1VJDA 2J7PD 1JAZA 2V7QD 3DWIA 2RGCA 3KUDA 3GT0A 2OT3B 4ESEA 1W5EA 4K81B 2I9KA 2H1IA 4F5WA 2KKWA 1SXJB 4EUSA 1YJQA 4RJIA 3HL0A 4BYMA 5GONB 3P9PA 3B8MA 5FPHA 4IXNA 3DLPX 1Q7EA 5DNDA 4TV9A 4G0XA 4R6XA 5EZQA 4NFLA 4XSVA 4NBLA 3LX4A 1MQAA 1WBDA 5B12A 4EPYA 2G9QA 3DOIA 1ZRHA 2QSUA 5REQA 4WT7A 3L8HA 1YZBA 3R5HA 4GR9A 3U4DA 5LUBA 5KQPA 4WJZA 5AW9A 3MVEA 4KWEA 1MGPA 4UBNA 1Q50A 1NU6A 1P1KA 2H1LA 3CRAA 5FTWA 3FNIA 2BGMA 3JQ8B 3VYSB 3B9BA 4LJRA 5FLXM 4MGKR 4B44A 3TIIA 3SHVA 3KLOA 1OLUB 4JVLA 3U3KA 4M6WB 2YI9A 3EW7A 4MDHA 3UOWA 2ZRMA 4NOMA 5FTLA 1HNNA 1JIQA 2BCJQ 4EM6A 4X95A 2J6HA 5LQJA 5AJXA 3ZWBA 4JVMA 4W5RA 1PXWA 2WYVA 4Z1MG 5FUBA 3GLKA 4QBGB 4CLOB 3C7CB 4PC1A 4FLWA 2WF5A 3PYLA 1ORHA 2K2QB 1QHXA 1Y33E 3TZLA 4COOA 4J9VA 4Q3LA 4HGRA 3KSMA 1GO1A 3P4YA 2O14A 3LWBA 1HWYA 3H2YA 3UUWA 2ADPA 2Q0AA 1E7MA 4I5IA 1SC4A 4QBHA 1EGHA 1J2TA 1D2NA 4MA5A 2ZJ1A 4QOSA 1W96A 1RBMA 1D03A 5GZ1A 1G8KA 2X6BA 4DBVO 1XDBA 2HRUA 5EWRA 5JHGB 1VQ7F 5F5XA 3VVLA 3S02A 3HBNA 1Q77A 2QUZA 1FP1D 1CYEA 4DM7A 3JD0A 1GN2A 4A73A 3AEKA 3ELCA 1K0FA 1FVOA 1VYTA 2CLIB 2SECE 4CF6A 2XKJE 2VEDA 3OTHA 4F72A 3DAHA 1EZ4A 4I1IA 4FGKA 4AZ0B 3BF7A 1KRHA 2YIJA 3TQQA 2HS0A 1DS6A 4YQFA 4QE3A 4PTZA 4BAUA 2PKXA 4AMVA 5G4UC 1HKUA 5E38A 3SNKA 3OLVA 3WSVA 5JRZA 3HJUA 1X39A 1JEQA 1RJGA 4DRXB 1SVNA 1SC5B 3LNNA 4BO5A 2YBEA 4N5DA 3AGQA 4BJHB 4YAFA 5BSUA 2Q1SA 4R83A 1NRJB 1YAHA 2Q6KA 2OGUA 2QP3A 4JI4B 1GPH1 2AMTA 1RJ9B 2IY7A 1CJVC 2GDJA 1XI1A 2W2PA 2HRZA 1F4VA 1I6KA 1XGKA 4CMIA 1WZEA 2BO1A 5TPWA 3U3XA 2PUBA 2D2CB 1Y1QA 3GG2A 4UM9D 5SYMA 1RYNA 3RARA 5L40A 1BE0A 5CVVA 4WNIA 5L3SA 3HEBA 3B52X 3EF0A 4Z53A 3PX2A 1T0KB 3TL2A 1KFCB 3VOTA 2DRIA 3AC0A 3CNOA 4PXSA 3JXEA 3HHEA 4FMTA 3USZA 3VDXA 2VA9A 1LDBA 3KZ1E 3E61A 3FPEA 1EIWA 1N1GA 1T3SA 3FPSA 4FDUA 3WLMA 1OAAA 1CP3A 1RHJA 4CUKA 1KYYA 2Z5UA 2YICA 1V16B 4CIVA 4CV3A 3W8EA 1Z8NA 2IWHA 4PWZA 4XVCA 3MD0A 4MB2A 1I7FA 3RYHA 5B3JA 4DV0B 2WFMA 3QPWA 5A1JA 3WICA 2ATIA 4G27B 3RUIA 1XN4A 3DTNA 1F51E 4R2IA 1FJGB 4X8MA 4HLDA 3GX1A 4LAFA 4YDQA 2W8BB 1IONA 3NIFB 5LMNO 3PUHA 4JK3A 4ABTA 3H1HH 5DHTA 4W5NA 1TK9A 5HUQA 1JLRA 3UXMA 1XA4A 3AERB 3ZV5A 2OHXA 1PFWA 1NDHA 1A2OA 3LQRA 4GF5A 1J4AA 1JQBA 1WZ2A 1O6BA 5T41A 1E9FA 1JQLB 4C6TB 5CP8A 3L0CA 3U81A 1Q16A 3ROEA 2ZQZA 3OCZA 3LPNA 3GAZA 5B3JC 2VQFO 2JDID 1H2LA 3KQUA 4MRAA 4RIGA 1E96A 3I28A 1LK0A 2IHZA 3VI4B 1H2GA 4IUYA 2ZPTX 2C4TA 3IQWA 1GYQA 1Q7BA 4AYTA 2CFIA 3GJ5A 1XZLA 1KEPA 1KD1H 3LWQC 4GC5A 3LLMA 4WK0B 4EK9A 2FCRA 2BM0A 2EX3A 2B5UA 4TZKA 4EG1A 3MIZA 2O1WA 5TSDA 3MJSA 4JP5A 5TC4A 2ZUBA 2K87A 5EKSA 3IMGA 4NZNA 3A25A 1NUTA 2Y1FA 1YJ8A 1SPBS 3UGJA 1CG6A 3BMCA 2JAXA 2RHJA 3S4YA 3E3OA 3K96A 3GLGA 4Q3AA 3WBFA 2H4HA 4B0PA