4I4TB

Crystal structure of tubulin-rb3-ttl-zampanolide complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 158
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i4tB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i4tB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i4tB01
4IIJA 5CA0B 3JAKA 4O4LB 4ZI7A 2VAWA 1OFUA 5JVDA 4U39A 4TV9B 4X20B 5KMGB 4HNAA 4KWEA 4YJ2A 4LNUB 3JALB 3HKDB 5LA6A 5IJ0B 5JQGA 5LP6B 4X1YB 3M8KA 3RYHB 4EI9A 3JAWA 3HKBB 4IIJB 5J2TA 4EI7A 3JAKB 4ZI7B 2BTQA 5ITZA 3VOAA 4XCQA 4O4JA 4TV8B 4IHJA 1TUBB 3RYIA 2XKBA 3RYFA 5JQGB 4I4TB 3M89A 5EIBC 4I50A 3HKCA 4ZOLB 4O2BB 5FNVB 3RB8A 2R751 2RHHA 3RYCA 3E22A 2VXYA 4O4JB 3N2GA 5BMVA 4IHJB 5LYJA 3VOBA 4F6RB 3JASB 5EYPB 1RQ7A 4I55A 4ZHQB 3N2KB 3JARB 4I50B 5GONA 4X1IB 2Q1XA 5CB4B 5IJ9A 4EB6B 4X1KA 3RYCB 3E22B 1W5BA 5EZYA 5JH7A 1JFFA 3N2GB 3WGLA 5LYJB 5JVDB 1W5EA 5LP6C 4E6EA 4HNAB 3JATA 4TUYA 4YJ2B 4I55B 5LA6B 5KX5A 1RLUA 1RQ2A 3V3TA 1FFXA 3WGJA 3HKEA 4O2AA 1W5AA 4X1KB 4FFBA 5LOVA 3JAWB 1SA0A 5CA1A 5EZYB 2VAPA 5J2TB 2BTQB 5ITZB 2R6R1 4YJ3A 2RHOA 3RYIB 4TUYB 3JATB 3RYFB 3UT5A 4DRXA 5J2UA 3WGNA 5JCOC 4O4IA 1FFXB 4WBNA 4B46A 1TVKA 3HKCB 4FFBB 5LOVB 1SA0B 3ZIDA 2XKAA 5CA0A 4O4LA 5EIBD 4TV9A 1FSZA 1Z5VA 4YJ3B 5BMVB 2GVIA 5KMGA 3WGKA 5M7EA 3HKDA 3UT5B 3CB2A 5LP6A 5MN4A 5C8YA 1W581 3RYHA 4M8IA 5GONB 5IJ9B 4O4HA 4U3JA 5IYZA 4TV8A 5JH7B 1W5FA 1JFFB 3ZBQA 4EI8A 1TUBA 1W59A 2VAMA 4I4TA 4DXDA 5KX5B 5MN6A 5C8YB 2BTOA 3VPAA 4ZOLA 5LXTA 3HKEB 4O2BA 5JCOA 3WGMA 5FNVA 5MN5A 3ZBPA 4O2AB 4B45A 2RHJA 1Z5WA 4O4HB 4U3JB 5CA1B 5IYZB 4F6RA 3C8LA 3JASA 5EYPA 4X20A 3VO8A 4LNUA 3JALA 4DRXB 5J2UB 3N2KA 4ZHQA 3JARA 5IJ0A 4O4IB 4WBNB 5LXTB 4X1IA 4X1YA 5CB4A 3R4VA 1TVKB 2Q1YA 3VO9A 4EB6A 3HKBA 2RHLA
chains in the Genus database with same CATH superfamily
2XAAA 4I9HA 4NR1A 3EA5A 2P4VA 3QJGA 3SXUA 1Y5LA 2RGRA 4BB9A 3PRYA 3V1NA 4ZZ0A 1BHBA 4R8VA 4L78A 1W0JG 4QYIA 1PGQA 2MINA 2P2ZA 3VR4D 4B17A 4RD2A 1Z0DA 3PR1A 2MSLA 5KOJA 3GLGE 2IQ5A 3LS2A 1S4QA 4J4HA 1KEEA 3G82C 3WMRA 1QP0A 4KSBA 3U7HB 3L4BA 1S0UA 2Y8EA 5T3UA 2GWHA 2COEA 2HRYA 3ESZA 5FLKA 4KQJA 1X7YB 4FX2A 4I6EA 3SPXA 1TF2A 4P4UA 3CBGA 2VDVE 2RJNA 4DREA 1M6HA 1H6DA 2A9KA 4PYOA 5FWXB 2YY6A 4RVHA 4W5RA 5G40A 3CRMA 4TLBA 4OMCA 3A6PC 5HM6A 4BNIA 2DG2A 4YRFA 3EXHC 1WD7A 2W4MA 1TI7A 3OE4A 4F84A 1VYHA 4FCCA 4TYQA 1NSYA 4GDFA 1J99A 1DAGA 4UM7A 5CA0B 3LX5A 3ZGXA 2CLKB 2I67A 1MQ8B 4WNAA 4M1WA 1UZAA 2H92A 2PWAA 3E61A 3WA7A 1V9SA 4AWXA 4EUKA 4DQKA 4FWTA 3PUHA 2QM7A 2O06A 2ID8A 1NUSA 4ZCPA 4GDMA 5L4NA 1GYQA 5TMPA 3STHA 2OXRA 3QP9A 2AGAA 4MVXA 5LP6C 2HQSC 4HY3A 3SIVA 1SR8A 4XIJA 1SURA 5BSUA 4AL4A 3L8ZA 5EZYB 3QITA 1FYJA 3H8WA 4Q4HA 2Y4TA 4KIUA 1RZUA 5AW9A 5G0UA 2ODEA 4KR6A 3DOOA 1Y3DE 1RLMA 1RPTA 2P4SA 3RRNA 3KZIZ 4HYTA 1E0AA 1XU9A 2EFYA 1ADYA 5IUKC 4E33A 3HTXA 1Q92A 1RI5A 3MDSA 4CH4A 3IESA 5DSZA 4DR7O 4EFMA 2QTFA 2YWCA 4EJMA 2Y69B 2B2CA 4IMPA 4OB6A 4II7A 2GAJA 3TI9A 3KKZA 2JGMA 3RS2A 2O8VA 4FEYA 1A7UA 3L1IA 1PDOA 4K0RA 3OZUA 4OH7A 1AB5A 2OZLB 3KKPA 2CL0X 2JC3A 1PWYE 2GV9A 1P17A 4JJ4A 3QEMA 1F4NA 2IEDA 5C31A 1K89A 4YFYA 2GOYA 2JLCA 1L5MA 3NEPX 1QFYA 5T4BA 1L4LA 4OO3A 1Y76B 3WYNA 1YDGA 2QRVA 5H80A 1AROP 1EFPB 2RDCA 3IUMA 2FZWA 3FB5C 5M5BA 4PZLA 1K2WA 4JKIA 3SJAA 2PS0A 1BN7A 4BT3A 3R7NA 4I5IA 2QR5A 3CCSV 1USKA 2V1XA 1E9RA 1NVPB 4BFSA 2ZI6A 1R9MA 4RD6A 2OBLA 3EXEB 2D5AA 2OVBA 2D62A 5EI5A 4PIVA 4WEQA 1NJGA 3ZU2A 1S72V 3I2HA 5BVGA 4PC2A 1PVOA 5G53C 4EW1A 1FUIA 1QF9A 3NBZC 5DIFA 3J81A 4ZVOA 3ENQA 4MVSA 2VZ0A 4MA5A 2QEQA 3WMWA 1P1KA 3U4QA 3T4UA 1TX4B 1Z4IA 3WK9A 2DFLA 3ITEA 2W6JA 3IUBA 3A05A 4TRNA 5IANA 3IAHA 4N9WA 16PKA 4U6NA 3LHDA 4GBGA 4NK4A 2NT3A 1N57A 1T29A 4K3VA 4DM7A 3SVLA 4EGJA 3OTHA 1ZW6A 5DSXA 1F6DA 4YHHB 3IIJA 1CJMA 3USES 1C0EA 4FB4A 3RV4A 1GGVA 3JQQA 1E2JA 1VMDA 3E53A 2B4AA 1U11A 5HG0A 3INTA 3PGVA 4PVCA 1WCYA 4MROA 4OA8A 4RXUA 1JEDA 3ZV6A 1XNQO 2MSCB 5TMBA 3ONFA 4BN5A 3B6MA 2I4IA 5FI3A 4D4LA 1SA0B 3F2IA 3OPYB 4V0QA 3CX4A 2X6TA 2V3WA 4WFJA 3N5KA 2RHTA 1I01A 2CLHB 2XNKA 1SEVA 1T1JA 1N2IA 1ITZA 2NUAB 3GR6A 1EXMA 2C4MA 4A6XA 5DNVA 1A9RA 1SFRA 3MUEA 4YGXB 5HF8A 3DSQA 3L4BC 1EBUA 5G4LA 4ALIA 1OFVA 5FBLB 1EBBA 2G0NA 1U4SA 1CB7A 3TFWA 1JAXA 1K3UB 3AIIA 3IR7A 4B4UA 4US2R 2FW7A 3KQOA 2ZJBA 3P0EA 3BFVA 5J59A 2NM0A 4Q0MA 4RPKA 1R6KA 1KZGB 5E8JA 2E85A 5HDQA 5HXAA 3EPRA 1B41A 3NVKI 4NWIA 4EY6A 1SQXH 3E70C 3DQQA 4EABA 4L4UA 4KXXA 5AJTA 4RA9B 4HNAB 3ESQA 1BS2A 2VI5A 4BLTA 1ZL2A 1I5YA 2WLNA 1YOVA 1L7MA 4JYZA 1KP9A 1Z0IA 4LH7A 3N1UA 1COWA 2NNUA 2XTZA 2P69A 4CMIB 3OC0A 1ZOLA 3SFZA 2OCIA 3ZHTA 1WZIA 3GJ3A 2Z8YA 3AG6A 1W59A 4LOIA 2OZEA 1HZJA 3ADOA 3SZUA 1SZPA 3B3AA 4B45A 4QATA 4YCAA 3FUWA 4YRJA 2M1XA 4D02A 1K27A 4CLRA 2NT4A 3FI9A 4YASA 1TMKA 1Z4JA 2X8AA 1GTMA 2Z9CA 1G18A 3CLTD 3QVMA 4X00A 4HX9A 3E0XA 4MMYB 2NYVA 1R9GA 1SBQA 1K73W 4Y2RA 2WSIA 3JQEA 3Q1LA 4MWBA 2N42A 1INLA 1MD9A 1MZFA 3ELBA 1ZCJA 4RHCA 3QVOA 2V7VA 4J0GA 5IYDO 3K3PA 4PRKA 3HB3B 1OT3A 3HCNA 1NHWA 4HJRA 4ZPXA 4ZCTA 5TX7A 1OB2A 1AGXA 1MTZA 1W1WA 4BTLA 2CVFA 1QGUB 1YAJA 3FB4A 2G4LA 4ERNA 4MOWA 4DEXA 3EFBA 2H1RA 2UYOA 5KKNB 3RYTC 4KQGA 1QZUA 4FFDA 4MS2A 4US1R 4M9CA 4YB8A 2XQIA 4Q1VA 2FX2A 1K3EA 2W6IA 4LF7O 4TMYA 1RM1C 4XM0A 2GBPA 3DC2A 3QXJA 2P11A 2H7XA 3MJFA 1O8BA 1FJHA 5FD8A 1ZCZA 3DCIA 1R1DA 2EZUA 1PJTA 2Q62A 3HKDB 5DBEX 1C1YA 1H9AA 1GNLA 2P27A 2ZWVA 3J81k 4NMWA 1UPUA 1KP2A 1WMAA 3CC8A 1V3VA 4L8YA 2GKGA 1RYBA 4UKDA 2QS9A 1R18A 2BDTA 3NM4A 3AILA 3DM5A 3KXDA 2VA9A 5JNSA 3IO3A 3SJAC 1ZLXA 1I30A 2VJYA 4NCIA 3HP4A 2P6RA 3G71V 3LBHA 3RE3A 5BWNA 3LCJA 3NP7A 4L4YA 3UWDA 3BCSA 4JI3B 3TTSA 5JFTA 4UXNA 3N53A 4HLUC 4B4WA 3L6BA 5C3UA 1NN5A 4FBGA 4AQYB 2VXCA 2OCYC 4YY3B 1VE1A 5A4MS 4KU4A 3VC3A 5F2OA 4FFKA 5H7XA 2ZSHA 4J0JA 3VR4H 1U40A 4D8YA 1IV1A 4S1VA 5DT9A 4UW9A 3JQ8A 3NH6A 2PAAA 2G25A 5EE0A 5IE9A 4FR2A 1EAMA 3BL5A 1KBHA 3M5CA 5IBCA 1CS0A 1S7GA 5A2QM 2LW7A 4MQLA 2WMYA 4X1KB 1Z26A 4FLTA 3SYCA 1CP2A 2WIAA 1KH1A 4HADA 2PO5A 4EMBA 1BMTA 2OZBA 1PPJH 1YMQA 2VRZA 2B5OA 4JI0O 1X0XA 3A58B 1GTG1 1GM7A 4R50A 3PJDA 4AMZA 1XMOO 4BLPA 5ELLA 2CNBA 3NKVA 1QUEA 2GUGA 1YDWA 1YTUA 4DB2A 4DV6O 2P41A 2FMHA 4NE7A 4NYKA 2LO1A 5IPFA 4MW3A 1C9EA 3LKBA 3K8OE 1L5RA 4B71A 3KCXA 3LYUA 4LA4A 3SP1A 1FX1A 1R0SA 2ECFA 4XZ3A 2XAQA 1KTVA 1AHIA 1CK2A 1Z39A 3TR5A 4EBBA 4TV8B 1VCNA 3B70A 2I66A 5L3QB 4NYJR 1Z4KA 4MRPA 2P90A 3R65A 3K20A 4BRWA 4R7TA 3DEYX 2RGAA 1BS1A 3QU9A 2VT7A 1RR6A 5AESA 5FHRA 1JR3A 3FDXA 4DDTA 4FFOA 4Y2UA 4QXAA 1U65A 2GETA 3L92A 3OX4A 3BJRA 3CMAF 3NHKA 2DR2A 2JVKA 5JARA 2JBAB 5B8FA 2VSNA 3IDSA 3VZCA 3W9BA 3W8DA 4RVOA 1SXJA 2W2LA 5DIZA 3LDHA 5AJYA 4DJ5X 2AQHA 1R3UA 2FI1A 4J16C 1TL7C 4ME6A 1TKBA 2REXB 2NN3C 4Q3OA 4RVUA 1D4ZA 2GKSA 1ILWA 2YS8A 2DPGA 3Q98A 1K4KA 2PX6A 5BXQC 3WKAA 1K5QA 4YDQA 5K51A 4DYDA 2G76A 2WU0A 3WWZA 2YWEA 4V1CA 5GAPK 4I3GA 3RC1A 3HDHA 1TIBA 3NIBA 2E18A 4CF3A 2IY8A 2G9QA 3I2IA 3H5NA 2YZMA 5IKEA 4OV6B 1MF7A 5CDGA 5FXMA 1YF3A 2R5WA 4AI6A 2WY2D 5K7SA 3HTNA 5H2FZ 3E9CA 5DWVA 3UXMA 1SESA 4DBVO 4KR2A 5BSMA 3T7TA 2P1DA 5CHYA 3NYQA 1CF9A 2HEPA 2B8JA 4KCGA 3KELA 2C95A 3O8BA 2OO5A 2VF4X 4E2YA 5KYKA 4BXOA 3DMGA 5SY6A 1VGVA 3BRQA 1OX4A 4J42A 4E4EA 3HZRA 4RQUA 2HGSA 5JVDA 2OZPA 3VISA 1PK9A 1FS0G 2REQA 4N5DA 5DHQA 1XVVA 3MGGA 1KI3A 4BN0A 2AOUA 4A23A 4NJEB 2J3HA 1UBOS 4ZEVA 1VQ1A 1GRCA 1S8AA 2SBTA 5K6AA 1SU6A 4BUCA 1ZTEA 4J49A 4OJQA 1F38A 1LLUA 3MBKA 1XNGA 1TQ8A 3V1YA 5AI0A 2X4IA 3IE2A 5LR6A 3NIGB 1VBKA 2OKCA 5SZKB 5FV4A 2KG7B 1XBIA 2XCRB 2HQ1A 2OYCA 4R05A 3RVRA 5C8DA 1ST2A 3VKGA 3O0DA 2QUIA 2P40A 5B6JA 1RXWA 5E38A 1L7QA 3BERA 1R6DA 4ZHYB 3KZ1E 3PBKA 4BVAA 2OAP1 4OFZA 5JW6A 1OI4A 5JJLA 2QX8A 1U5BA 4IV5A 2XT9A 1MVOA 5GGXA 4DTIA 3AYZB 2W6JD 3DZCA 2I34A 3UB3A 3KJJA 4MUXA 3GDWA 1OYOA 3IQXA 2EDAA 1GZ4A 3EZNA 4AJHA 3GUVA 4UXJA 3GVPA 3BWXA 3NAGA 5BT9A 3B53X 3ZJTA 4I9UA 4U7FA 1A5SB 4R0VA 4DSUA 4ZGWA 1NBAA 3FD5A 4RZXA 2P7IA 4BQQA 5KUKA 1C2YA 4QNRA 1ZK2A 1KMIY 3B1VA 2PX0A 3C43A 3FY4A 4NH0A 2CKMA 2CJFA 1W5EA 4LN1A 2R3SA 4EYQA 1J0XO 3IUPA 1LVGA 4HDNB 3TNJA 5CHEA 4ER5A 4NJOA 3K8QA 3QY0A 2E37A 2HMVA 4NU5A 1A7KA 5HA5A 2A7QA 4B6QA 4YJHA 4FJ1A 2I6FA 3FTCA 5HY1A 3IGAC 1POWA 1M2VA 2C2BA 5TEWA 4KO4S 3BCCH 4B7AA 3V4PB 2VH1A 1H4SA 4QTZA 4NP6A 5A4JA 4RHXA 2VQ6A 4JYBA 4ZCRA 3OTOB 4MIEA 2HMUA 1Q17A 1S4MA 4TZKA 3U7JA 3S81A 2VF2A 2XAFA 1ANKA 2J6HA 4QDTA 4GNRA 4ITUA 4Z4FA 3QHQA 2C00A 1DTEA 4U7DA 1K0FA 3D8HA 4UBKA 3O8QB 2CL7X 2BE7A 3KD2A 3RSZA 1DKLA 4JELA 4J07A 2YKGA 3HA2A 1XV2A 4BNVA 3DCYA 1SETA 2N0SA 2VHWA 3LUTB 4QEDA 4UD6A 3G80A 4R4JA 2ZZNA 1IPHA 2C9BA 3FDFA 5LOVA 5JCPA 3EUFA 3ZI0A 4U0KA 3QVVA 1K3TA 4X9QA 4ENSA 4MB0A 2X7HA 4XWOA 4X44A 5T5QA 3F67A 1BCRA 1G8MA 1MXHA 1PJQA 4DZZA 3A6JA 4OKSA 5F1KA 1ZKMA 5CVCA 1S02A 1IZYA 1XRGA 5JTTA 4HC4A 2J08A 3T1HB 2HP0B 2NTVA 5FFFA 1XD8A 4RCZA 4U9IS 1XZDA 2R62A 3RNLA 1Z0KA 4ARCA 1KGSA 3Q5EA 5I9SA 3NPAA 4UDXX 2BFBA 3G85A 3PUWA 4EAQA 2EBOA 4FYJA 5JSKA 3AHIA 1OXTA 4CFYA 1QF7A 2EKBA 1ISPA 1GH6A 3P2EA 3R3XA 2BMJA 2GCEA 4MKIA 3EFEA 3P96A 1XLWA 1FFBA 2ZUTA 4QUEA 4R8CA 4TMKA 4LV8B 5K8IA 5IXYA 4JL6A 5J4LA 3E9MA 2V6IA 3P0RA 5KHHA 3G0GA 1W93A 4E3ZA 3ZWMA 4IDAA 5KOHB 4HAXA 2EX4A 1VHWA 4X24A 1VJDA 2B4KA 3T9DA 1QYXA 4PRYA 4PC1A 3R0IA 5JD6A 2VS1A 2W6ID 1T4CA 4AJ9A 4GBED 5DH9A 2FLVA 2FETA 4MVJE 2PFSA 4LFCO 1G6Q1 3JWPA 1A0OA 4QOHA 1UPAA 1H85A 4EO4A 1YNOA 3S6JA 4MRVA 3C9UA 4PBRA 2Y93A 2J48A 2OC9A 3C1UA 3GELA 5CNJA 2AFIB 2OWOA 3MRXA 4BJ3A 2OILA 4JBYA 3CMCO 1U81A 3ZIAA 4FN5A 2CSXA 4U00A 3O4VA 4B5KA 3BFPA 3UMBA 4HLNA 1YV9A 2H51A 5GANK 1Z2PX 1VGQA 2W37A 4E1VA 2RGYA 2R1TB 2ZQ5A 3ZVKA 4Z3OA 3LXRA 1GDHA 4Q15A 3L70H 4Y1RA 1OZHA 4BVFA 3OLWA 4UVBA 1C8LA 3EC1A 4A26A 4MR7A 1RQNA 2IITA 4EW2A 2G28A 4N1AA 1V5EA 4R6WA 4YCMA 3QKSA 2H1HA 3RS8A 3MYYA 4RPJA 3DOCA 1U7PA 1E1YA 1WVGA 2I0FA 1VJTA 4MYDA 3O4RA 1F9AA 4HX2A 4CH3A 1NBOA 3I30X 1JE1A 1Q11A 3UHJA 1A9XB 1G9TA 1XQYA 2QQGA 1T9AA 1S7CA 1NBMA 3VOBA 1R66A 2EGHA 1E3MA 2JD0A 4YAFA 2BGKA 3CZ4A 2CLMB 4REQA 4ZK2A 4YCBA 5AW6A 1NT2A 2DZDA 1V8BA 4B7XA 4UUBA 4BNTA 4IDBA 4HDQB 5JZVA 4M54A 3E48A 5FTWA 4DLRA 1VL1A 1SK9A 1GU1A 4ZQHA 1KYTA 2XIJA 1TXGA 3N8GA 4NMHA 5CIYA 1LPOA 5CX1A 3B20A 3P4XA 3B78A 1RBYA 3BA1A 1Z0ZA 3PI7A 5DK4A 1DRWA 1TW3A 3M5PA 3B1KA 2EFEB 3AP1A 1NYLA 1GRNA 4J0EA 2C0PA 1MBZA 3EXFB 3MGAA 2BY4A 2O6LA 4XWTA 2QU8A 3TTUA 1H0SA 1JD1A 4PYMA 2QTVA 1U28A 4MW6A 1Q0SA 9LDBA 4DTCA 3C9SA 5L7TA 4TXNA 2PSFA 3FYSA 4LE1A 4Z9YA 5CBGA 2UVDA 4G0VA 3S68A 2I2XB 3DAYA 4PO1A 4AS3A 1SZCA 3A3PA 3BGDA 2GK3A 1FJGB 1AKQA 5ALPA 6ABPA 4DIFA 1EZJA 4Q3BA 2QKAA 1UM9B 2AMLA 4AP9A 4LSGA 3ML1A 1PZGA 1XQ8A 2Q0XA 4Y9SA 2HDHA 4LI0A 2QRLA 3UJ7A 2H1IA 2ATXA 4B3RO 1EUYA 3KT3A 1GA6A 4P80A 1A5AB 1HBJA 1BX1A 1SXJD 2W2LD 1CR4A 3G7SA 5AP9A 2OP1A 1L5NA 1X7OA 4YXWA 4ZYLA 4FWBA 2NIPA 1XYYA 2OCPA 4Q9LA 5HIMA 3QE9Y 3ZGVA 3GN1A 3ZEDA 1PO7A 3SPGA 4L8WB 4OX9Y 2YI8A 4JI6B 2NMUA 4A6DA 2H3HA 3I5DA 1VSQA 3DJFA 1FNCA 4ZHQB 1YJXA 1A8IA 1MFPA 1W8IA 4MYUA 2YZ2A 5HMLA 4NR0A 1O0SA 2CVOA 1WBBA 2B5VA 4C29A 2F8SA 3UMMA 2AJCA 4B62A 4PIPA 2R84A 2ZVDA 4YAKA 2HF7A 5C8VA 3QOFA 4FSXA 2HF2A 1ZJJA 3LQFA 4AK9A 1XPUA 3VXKA 2VNHA 2ODMA 1R8SA 1EXWA 2FZ5A 3CCFA 4B32A 3RQSA 4UTPA 2VJDA 1EEXB 2I6TA 4NZNA 4DR2B 1IB0A 1T9CA 3DPSA 5BOVA 3BZWA 5HBRA 2R4UA 3ELDA 2IZ5A 1PV0A 2ZNJA 4LDNA 5L7WA 2E1RA 1BAPA 4M46A 1MH9A 4JEUA 2EBUA 2QG4A 2JFWA 1R4MA 3E7FA 1ZXXA 1SWVA 2CJWA 4URVR 3CLVA 3LDUA 4L9RA 4Z9AA 1WTAA 1JH8A 4JBWA 3TPFA 4C07A 1I4TD 1UQTA 3PK0A 1ULUA 2FXIA 1SAYA 5B3SC 4JA0A 1Z4QA 2QLTA 2A0LA 1RKBA 5TT1A 3O73A 3CRQA 5KTPA 2CVPA 3I3SR 1MAUA 2JJ2G 1FP7A 4O3FA 5KHKA 4UE3S 4OVKA 2EV9A 2VOEA 4URWR 1ZP6A 2GEJA 4FLYA 1PGPA 4CKBB 1P2TA 3H5IA 2ZYVX 4UNIA 2AE2A 2JFBA 2VRCA 2DH6A 4F86A 5AVOA 2P9ZA 3IALA 1FBTA 1I2MA 1BX3A 2VYVA 1ZVVA 3LSQA 2Q07A 3K5OA 1C4WA 4YAJA 1Z5OA 4KPYA 3R2JA 2IUYA 2IW3A 3V8MA 3CCUF 3ZE7A 2H6LA 1M90W 3CUKA 4JC0A 1AJEA 4B2LA 2ALEA 3KLBA 4JLKA 1LPAB 4KXYA 1Y0BA 4GE0A 3GXOA 2AQIA 2VQEB 4DLWA 3IL2A 2FMUA 5CEJA 2AV6A 4EUFA 4ESVA 4ITVA 1YZ3A 1G3MA 2NX2A 4GH5A 3I4FA 1HEIA 2WUEA 3AT1A 3KJIA 2RHJA 3HWRA 1GL6A 2A5YB 3QV2A 1EM6A 2VBGA 4DBLE 5B30A 3G8CA 5FPOA 4OK5A 2RHLA 2DHQA 1DLJA 1O96B 3SIPA 4RTQA 3T52A 2VWHA 5JJEB 1JBKA 3Q7QA 3CINA 4BMOB 1T6NA 4A5OA 1KMNA 3I9LA 1CZUA 3L0ZA 3UBTA 5JNRA 1WS6A 1YFKA 4ENWA 2ZZMA 2JLBA 2SICE 1P6XA 3R9WA 1E18A 2J4DA 3Q85A 2I5PO 4E51A 3ACBA 5AVWA 2JVDA 3UKDA 3ZLVA 4BT5A 4BP8A 1QTIA 5DHRA 1N3IA 5DNDA 4IOMA 1K33A 3CH4B 3ON5A 4DIMA 4Z1MG 4NDZA 2BEWA 4YT8A 3LCCA 4PGFA 3CZAA 1CQJB 1QYCA 4ND3A 6ADHA 1YBAA 5T4HA 1UC5B 4CF6A 3FB7C 3GDFA 2YI9A 1XZAA 3TS1A 1DXYA 3QUWA 1NW6A 5DX0A 3M0EA 2E5LO 1KKCA 3SMVA 3VQXA 3R41A 3JYOA 5EJFA 2H1CA 1Q0RA 3UAGA 1T9GS 3QYPA 5JD3A 4RD3A 2E4AA 1ZC4A 2W6MA 2PXHA 3ABKB 4FGZA 4G5YA 1R7RA 1G5TA 3M82A 1SD5A 4ZPJA 3GG9A 4PR3A 3RD5A 2FLWA 1IDN1 3NP9A 2C7BA 1WQ4A 4DMKA 4K5QA 1CUCA 2VNAA 4QBFA 3VKWA 2A94A 2WTNA 5L3BA 3KLPX 3I6IA 3GZNB 1E32A 5BV8A 4CEJA 2A9RA 1KDTA 4WX2B 3TVDA 4EHLA 4R41A 3VMFB 3OG9A 1A5ZA 4HQ0A 4LBZA 1KMIZ 4NBTA 2PZAA 4Y9TA 4OLJA 4GMFA 5BNZA 3BG5A 1XUOA 2HDOA 4OHMA 3PFKA 1X7HA 1Y74A 1Y80A 1TJ4A 3VPAA 3FGOA 3PCXA 1OCCC 4X84A 5LQMA 1DCKA 3CXCF 5FI5A 3SFTA 4EVQA 3IP6A 3TIGA 3QYJA 4DK0A 3JCZA 5TQ2B 3QTLA 3GA0A 4IY1A 4YRRA 1OBHA 1ZI9A 1DZ3A 2PUCA 4BR6A 2ZT6A 1T2FA 3WG7C 3EXHA 4CDNA 4YAEA 1EVKA 3UOAB 2V96A 2BD0A 4E7PA 1KXJA 1AZTA 2PZEA 2PS9A 5JFOA 3LWNA 5FKJA 5LMUB 1L7VC 1OCRB 1DC5A 1GSHA 3KB2A 5J5CA 3WADA 1J5XA 3TB4A 4PHZA 4BU0A 5LHIA 4JLJA 3WJAA 2J5KA 3ZIAD 5FTLA 3OZRA 3S2YA 2IJKA 4LBWA 2V6JA 3LNCA 1XRJA 4M53A 3SS8A 4CH5A 2CLEB 5GZ3A 2V54A 3L0SA 2JVJA 3CJQA 3UT5B 5LP6A 2HQSA 1POXA 3S29A 3FJYA 2VJBA 1E7YA 3CYQA 1AY0A 2QW8A 4FHZA 3KBOA 3T5DA 4B4KA 3BEHA 3ROGA 4UBNA 1DKPA 5IVIA 2PHNA 4HLDA 4WFEA 3VTKA 1IWPB 4KIGA 2ST1A 5CTAA 1EX7A 1QIIA 3DB1A 3LO5A 2ZTSA 1KEPA 2VT2A 3D4IA 1PEDA 3KKKA 1GTOA 1V8PA 3HB1A 3RVLA 4BMPB 3GCXA 2FAXA 3ZHYA 2MSWA 3PHLA 2PRSA 1RSOA 1SD1A 1NBMD 1RU3A 4R8KA 5AVXA 3NR2A 5D1NA 1N3BA 1ZM7A 3ILVA 4QASA 4YJ3A 2HP3A 2WKQA 3OUSA 3CCEV 5IUJC 3P1JA 5EG5A 3SC3A 2ZETA 2W4QA 2FEPA 2ZS7A 4D8VA 2OQ2A 3IDOA 5LB2A 1RXVA 4YLYA 2W0FC 2G08A 4BY9D 4IYRA 1U7WA 1M1XB 3NJRA 3TDMA 2X6CA 1NN3A 4L9SA 1GPH1 3P9PA 3BMQA 2WWFA 3GVMA 2D5BA 1XMVA 3R40A 3QVJA 1GN8A 5T64A 1G8HA 3DZIA 2Y66A 3HJNA 3GBPA 2ZBRA 3R4VA 3U5ZB 3UK0A 4R2LA 3IB3A 4W7HA 1TM5E 4L7VA 1XO1A 2KG4A 3B2QA 1M73E 1RCUA 2VF7A 1QZXA 1JYEA 3U44A 1DXOA 2G8LA 3AJ9A 1DC3A 3UXYA 4WKOA 1I3MA 4JR2A 3KYIB 2X13A 4J94A 4ESEA 4FOLA 5A6SB 5DT2A 4JLNA 4WASA 5CLJA 2YV1A 4BFYA 3D4NA 2C58A 3DC6A 3RIMA 4E03A 4CR6A 3TRFA 1XU7A 3MWGA 3M33A 2NTYC 1RFGE 4CLEA 3EXIA 5FQOA 1PSZA 1SQFA 2O0JA 1W76A 1ISSA 3SU8A 5EZYF 5BR4A 4OFWA 1YDHA 3EVKA 3HGMA 4E12A 1P73A 2QKSA 2GPBA 3LRXA 4JI2O 3FBTA 1SF9A 1IPEA 3NM6B 2W43A 1JILA 3EE6A 1W9MA 4CG2A 4KUHA 2J1LA 3WLHA 1ZESA 1JQEA 4DJDC 3TLYA 1F0KA 4P6VF 4OHXA 1JDSA 2AVDA 1WR8A 2IHZA 3PC2A 1E9FA 3GB9A 5JTUA 2CBGA 3OJLA 2JGFA 4YRIA 2BAGA 3IBCA 2Z8XA 2EIKC 1N92A 2WC1A 3WSVA 2BGLA 4B3SB 2BO1A 2NPFA 5K8TA 2JIOA 4H3VA 1N2CE 2VRWA 1E9BA 2P4QA 4POAA 2H7YA 3W1WA 5ITZB 5IM4A 2I7XA 1SQPH 1FLDA 2DFTA 2XWJI 4MA4A 4HH0A 2H7CA 1HSZA 2XA2A 5T3YA 2ZTHA 1CD5A 2QD3A 3QWBA 1JR9A 1H6AA 3TCNA 2IEBA 3L1KA 2G3YA 3E7DA 5CJ2A 1UOEA 4X95A 3CCBA 3WDMA 4O2BA 1OTXA 3MTQA 2ZBPA 3L07A 5A7GA 2ZCEA 3OPYI 4AKTA 1XMJA 2IHJA 3UCSC 1P0MA 2CTRA 1Y4MA 2H16A 1SUWA 1KY4A 4C2BA 3AZPA 2D74A 4RY9A 3GFBA 1HRDA 4JZ2A 5J3JA 3ZK7A 4G0YA 2ZIFA 2B7LA 1YITV 1AS2A 1SZTA 3AINA 3ZXXA 3K9BA 4WZBE 2NOAA 2BDEA 3VDNB 4ARBA 2WIFA 5TB5A 1R12A 3A27A 2IU4A 2E5WA 3UK2A 2ZDQA 1RQ7A 3RTEA 3GMSA 2ZOSA 3AVQA 2C98A 1S5HC 3DE4X 4WNCA 1EB8A 5C8XA 2QTPA 1LD3A 1F7VA 1J0BA 4UEWA 3K08A 1C9KA 1JBQA 3M3HA 4B48A 4L95C 4D43A 4F9FA 2OD2A 2R48A 5JBIA 4DQVA 1Z68A 3QLEA 1V9CA 5A04A 4KUEA 1UK9A 3C1TA 5I4BA 1M1NB 3WYCA 4WBNF 2QJWA 5IAOA 2FZKA 1Q7CA 3HN6A 1TT5A 1H2BA 2ZI7A 4BZQA 3SQWA 3BTSA 4B34A 1R5BA 2EJRA 1HX7A 3MWJA 1S5JA 4FYPA 5LZ2A 5HK9A 4G4XA 1TQ4A 2XTAA 2PR2A 4DR4B 4XE5A 2YWDA 1IEWA 2A7XA 4UBLA 1XXHA 2VRCD 1UKYA 2OFWA 2RARA 2VYQA 3FDIA 4CM9A 4Z53A 2VYVD 1QHTA 1T24A 3SQNA 2ZSUA 3PC7A 3QNMA 3MXOA 2DAPA 3FDZB 4MP8A 2FPOA 1BN6A 5CX4A 1G1AA 4XEUA 1SVNA 2X0EA 4QPCA 2RMKB 1ZVMA 4DYLA 1P60A 3I1JA 3BMCB 4LV5B 2EIMB 3T4ZA 3E2IA 1E1RD 4PHFA 3ADBA 2YQ5A 3Q40A 1XTVA 2R6AA 4NCBA 3C6BA 2B92A 4TMZA 2O3QA 3U56A 4TV9F 3G2MA 3JARA 4B83A 4D9BA 5YASA 1I4DD 1FFAA 2HSZA 2KM1A 3FD8A 1LA2A 1NR5A 4W6QA 3ZJYA 2Y1FA 1JAHA 1D1TA 2JFPA 3P0ZA 3PHGA 4KQFA 3I5YA 5KVAA 1ZM2A 3RADC 1BW9B 4ZT2A 2CE2X 2Z5FA 3V80A 2J09A 4C0JA 4YP1A 1VHDA 1JQDA 3I0MA 2V98A 3HRKA 3CZ9A 4BUJA 1P39A 3C7KA 1SJ9A 1VE7A 2JARA 3D6HA 3CEIA 4CMGA 2FZVA 3W6PA 4JTAB 2L19A 4NOLA 3L9XA 1PW5A 2JFHA 2Y1DA 4LBYA 4YQYA 1KDYA 7GPBA 1K7SN 1LBEA 1Q3EA 1NQTA 3F74A 1I4OA 3WK7A 4CLXA 3FLAA 3B1YA 1DQPA 4P7FA 3ANYB 3LWZA 1J8QA 3F5QA 1NIPA 1E9AA 3JZAA 3ZUPA 4S2EA 1NMQA 1AV7A 3GDGA 2EKQA 5BNTA 1VQOF 4H4CA 4LXXA 1L0NH 1KNKA 3PQ4A 1YHNA 2PU7A 1Z17A 4HLUA 1DQSA 3C6QA 5AJWA 3X44A 3IMPA 4LIPD 2XXAA 3KYCB 4R2HA 3VUFA 2J5QA 3EVBA 5F9FA 3UMJA 3F6SA 2JLQA 1Q0TA 3NO4A 1I10A 4PGAA 5CB4F 4R8MA 4XDGA 3ZCUA 1UL1X 4AUKA 2C59A 3BD7A 1QCYA 4KI7A 4MVJG 3I23A 1Q3KA 3PUIA 3Q7RA 2JGNA 2FYTA 4NI5A 5ITWA 5CMUA 1AQLA 3R24A 2FWNA 3KQNA 2BTUA 3F5DA 3ZVRA 3H2KA 2RHOA 3JWGA 5B1AB 1ZL0A 3N0WA 2CLIB 4G8BA 3ZIUA 2E6KA 3GD7A 2HNAA 3NBMA 1EM8A 3ABOB 2R65A 1SN7A 5EXEA 2RHDA 2AS0A 2FSHA 1J20A 3EZ9A 1KDOA 2O4UX 4DQUA 3Q0EA 2OD7A 1BMFA 3R0PA 1U1FA 3FMGA 1T1SA 3X3HA 3D2AA 4YRPA 1QOQB 3NDJA 3UMFA 4YBRA 4ZXFA 2WV9A 2A88A 1CRLA 4RELA 2DYKA 4S1NA 4RLQA 3QHDA 4JNCA 3H9EO 1IV4A 1G21B 3KUCA 1E2QA 2YFQA 3L8FA 4ZALA 3AG3C 3NUZA 4O25A 2UYNA 2CLOB 2ZI4A 4NJMB 1QQBA 2I76A 1E9SA 2JNBA 3V33A 1DB3A 4NYMQ 1J5PA 3QYAA 4ESOA 1WP9A 5IZ4A 4KR7A 5EGSA 5LGUA 3ABMB 1BE3H 1JPXA 2QE7G 5J2UA 3H9CA 1J9ZA 2AQKA 2WKSA 4DYHA 1QQ6A 4EF4A 4JV5B 4PHGA 2D0IA 4R83A 2PUHA 1VKNA 4TOIA 3TLEA 3AR7A 3O95A 5B1IA 1WBDA 1X9IA 1ESNA 3H0CA 1CP9A 3VU9B 3IKLA 1J8VA 1PG2A 4F93B 4DVGA 3RF7A 1YC2A 2QP4A 3C1OA 5KNCA 3KQVA 3BMNA 3VSEA 3VBCA 4J16A 3C7CB 3TZKA 4JI5O 4KEAA 4XIGS 3GUUA 1SCAA 2Q6KA 4Y30A 3ZW8A 4DPMA 4QOIA 2I2WA 3VC1A 2DPLA 1UT6A 3IP7A 1GR0A 3MTGA 4BC1A 5TPWB 3HJFA 5J63A 4C7JA 1YIJF 1CUJA 1LW6E 2NU7A 5F5NA 2C88A 1E2LA 1VM6A 3TE7A 1AQNA 2WJZB 3A6EA 4GCZA 1UP6A 3QJYA 1RXIA 3DDNA 2RBEA 4AJPA 3AEYA 3TTTA 3OQIA 2CXXA 2QLLA 5BMVB 4H6VA 4FE4A 3G1UA 3QVLA 2Y0DA 5D6OA 3GUHA 2Z2ZA 1L1QA 1UMBA 4WI1A 4LC0A 3B9RA 3GOHA 4Q9HA 3WQQA 3OY2A 4W1RA 3MNFA 1DVRA 2D8MA 1N5JA 4L8VA 4UCWA 1GZ3A 3FOFC 4ZDWA 3IC5A 1GPUA 5JSUA 1IK4A 4ZU1X 5LBUA 3LWVC 1LNSA 4G67A 4NV3A 4EGAA 7REQA 1V8ZA 1QVAA 4TWJA 5A9SA 2VHEA 5IT9N 3KC2A 2ZBEA 1AMOA 2C7RA 1QB7A 1YE5A 4YWHA 3BDIA 1E6UA 2HPHA 1Q6YA 1QHHA 1S96A 9ATCA 4BFXA 3GLIA 3OTFA 1V48A 4UULA 4E14A 1YJAA 1QK5A 4G5GA 2PFKA 2DFNA 1N36O 1G5PA 1CUFA 1P7ZA 3AMVA 2WYWA 2HVKC 2ZQMA 3K1ZA 2JCGA 2YHIA 3EAGA 1C4XA 5GM2A 1Z6TA 4FPXA 4D9CA 1U7OA 1RWOA 1HDGO 4DXDA 2ATCA 4LF4O 1NYTA 3AJRA 4H2DA 4ISCA 1YDEA 3N2KA 5DN9A 5DYWA 3USCS 2YRWA 1TJ3A 3Q3EA 1EFTA 2IYLD 4AJEA 1US8A 1HNZO 3O38A 5DYYA 4TT8A 4J0QA 4MP6A 3DEIA 5E7MA 2X2EA 3BXPA 2QJ1A 3RLFA 1ZISA 2AC7A 2WU3A 2Z0AA 1Q86W 4UZFA 1ODCA 3A1WA 4JT9A 3EQ8A 1GN4A 2F90A 2JI7A 4KVAA 1NQUA 1M1ZA 4WKNA 1NFRA 1YUNA 1VQNF 3T7IA 2IYSA 1EBOA 4OKNA 4HEJA 3EGOA 4FYHA 4OI0A 1BFUA 3T12A 2E48A 2NNLD 4AAYA 4JSTA 2AOXA 3AG5A 1Y6GA 1DV1A 4LDQA 4FKMA 4RTMA 4HLQB 2FB5A 2HX0A 4NKRA 1X1DA 4M1TA 3LUKA 3P2YA 4HSEA 3GNSA 3AEKA 2D1QA 4CLOA 3RG8A 3V6MA 3R7LA 4MXDA 5B1OA 4PLHA 4DM4A 4WLFA 3FAZA 2ZR0A 4BKPA 1TAHA 5DCYA 4JL8A 4B31A 1P2FA 5FTMA 1IURA 1L4FA 1YB5A 2Q0SA 3H4TA 3CMEV 3DMNA 1NUAA 1FFYA 3NBYC 3CE2A 4M9SA 5D7NA 4AHCA 3TW6A 3I9NA 4CKEB 1RBZA 3MCAB 1JTVA 3QEKA 5E0OA 4BJHB 1BX0A 4I6JA 2GNOA 2Y1XA 5INTA 3FBGA 1D7AA 2JRCA 3B6EA 1MA1A 3RRXA 4NAVA 4TVBA 2A86A 4E15A 4UE6A 4PN7A 1MABG 1IRIA 4CI0B 4D8TA 3GLTA 4O2AF 3KEOA 3VU0A 1RRCA 4HYQA 5FO1A 2VWPA 3CC7V 3LSYA 4C14A 5K0BA 1XXLA 4BQNA 3T3OA 4X61A 3LGAA 3GF4A 1T0UA 1M66A 4DE5A 4BMNA 1IHPA 2AJLI 3BQ9A 2Y99A 2D2VA 2XDQA 1DEAA 1KAGA 3LDDA 4M0KA 2J9GA 2CVZA 3BSSA 4C87A 2ATIA 4QQFA 4ITRC 1XWWA 4IHAA 1Q14A 3DZBA 1AH2A 5AKYA 3HJGA 2M98A 3WP1B 2VTBB 3F5MA 3F7TA 3IOCA 2OORC 4B2PA 2HVYD 4IV8A 4YRLA 1AN0A 4MS3B 3CZPA 2BUAA 4XR4A 5BWCA 3AHEA 4CM9D 2X1VA 1TD1A 4R6XA 4QDXA 1U0RA 1JHVA 5FOVA 2BGJA 5KHOC 4QPDA 2WHYA 4ZAGA 3THWA 4UARA 1TT7A 5DRYA 1TGYA 4LHXA 5BQ5A 4M38A 5E2BA 4DR3O 1C81A 1D6SA 1J2UA 2R66A 1O9HA 1VDMA 3VYRB 4LWOA 1WPRA 3NOVA 3SF8B 3ZLBA 4LJ5A 4KXQA 1AX9A 3UHOA 1YKFA 2BFNA 4IFTA 1UZNA 3FZQA 4IX9A 2KQUA 3MA0A 3V97A 3TQRA 4HAMA 1KJNA 5B1BB 4YV1A 1NNLA 3VQYA 1D4FA 4JBNA 4A8JB 2I6SA 3HNRA 5HF5A 1HA3A 2PPLA 4FGKA 5G4VC 1JSLA 1XROA 4WVLA 4OX9B 1MOFA 1SU8A 3FN4A 2ZIWB 2VQDA 4Y9UA 4BVSA 3BD8A 4JLUA 4N8EA 4ZDJA 3ZWBA 4DIUA 2HREA 2HA5A 1DGSA 1W41A 3C16C 5JNVA 4U9UA 2O8DB 1ULAA 4WCFB 1YXMA 3THSA 3HJWC 4RV4A 1KNQA 1HMYA 2NZUG 3LT4A 3LOPA 4CYMA 2JIBA 1RLTA 3L7IA 4JYCA 3CJHA 4DANA 2XEXA 1M2EA 2JBWA 1UBHS 2WAAA 5EXXA 4NUTA 2WINI 4LY3A 1TJNA 1ZR2A 4EB6A 2IEYA 1DUSA 1XLUA 1GPNA 3F47A 2M6LA 4DZTA 2B9VA 4OBBA 2PANA 4UEJA 2O2IA 2EFGA 1QGED 3BD9A 3CF0A 3VDRA 1VI5A 1Q16A 1H1LB 2XYRA 4UBIA 5DI3B 1YIAA 3A6HA 3EEIA 1USUA 3K92A 1JLHA 5AVKA 2FKNA 2G8NA 2WR8A 1Y6XA 1NL3A 3E8HA 3RHZA 5EB0A 3U2QA 4RS4A 2V7EA 5KVVA 3T06B 2ZS8A 4RH0A 4OQDA 5EKDA 5H16A 1W5AA 2ZE7A 4DMGA 3FPFA 1HK7A 2WP8J 5F7ZA 2A2ZA 5DI9A 3QLUC 1NDQA 1WUYA 2TS1A 1E2HA 3PE6A 3EIOA 4HPWA 1DFGA 3KHNA 1Z4LA 2WRZA 2DWUA 2NO5A 4TT3G 2MYNA 5KYUB 2N04A 2FPIB 2WWYA 3IEVA 4D9KA 4E5YA 3BL6A 1TMYA 4BMDA 3Q9SA 3PF8A 5TR9A 3OQMA 1O0CA 4QRHA 1IIBA 2F95B 3JD2A 3DMYA 4BVHA 5CR9A 4RXTA 4X64O 2ZRJA 1BMFD 4NENB 3VZQA 1PGNA 3FWHA 1YR6A 3ONEA 3L7QA 2IS2A 1VIBA 1SBYA 1Y5RA 1CQPA 1T2EA 1N8NA 2MT9A 3DA8A 3JVUA 1CJSA 3IP5A 4LUCA 5IT0A 4EPYA 3OQNA 3TZEA 3D3JA 1I13A 1VQ8F 2PSDA 7MHTA 4OMFG 2OCHA 1T25A 4CT5A 2GRAA 5FDFA 5HRAA 4FBMA 2OCBA 4A8HA 3DKKA 1MVNA 4L4RA 1GAEO 4IRUB 3LVBA 2J3QA 4CU5A 1TJ5A 3A9UA 1PNQA 1XTKA 3VKVA 4ASUG 2E9SA 4QLOA 4BW9A 3RYHA 1NDHA 3OCUA 3AK1A 4GX0A 1PK7A 2G80A 1IOWA 3W9UA 2R1VB 4GX2A 4TYYA 4CN9A 1Z5WA 4YP0A 3G5AA 3BJEA 1XU4A 5I9TA 2PWPA 5DTIA 4JVSB 3TGWA 1IJBA 4BKUA 3PQ7A 4FHCA 3OIFA 1LX6A 2J9YB 5KOYA 5KNCD 1AXGA 1WZEA 1GP2A 4KQ9A 3ZN2A 5H68A 2AYYA 1K4MA 1JX6A 2X6BA 5K3EA 2HU5A 1E9VA 5DLEA 1P9OA 4DRYA 5C53B 1CUAA 5L3SA 1I14A 1QF6A 2HK9A 1EWRA 1HYGA 5ESRA 5D3ZA 2OIGA 1GWNA 3VQTA 4PCLA 1G3IA 5JWRA 2OCGA 1Z7EA 3M4NA 3PQFA 3N7UA 1COWD 3EMKA 3ABLB 2XUZA 3K8ZA 4DMCA 3GJ4A 2HWWA 3CCJF 4X9XA 1HYEA 3OF2A 4MVYA 2GN2A 2P5UA 2J9FB 3NAZA 3W5IA 1XCMA 3KYDA 4MUHA 3OM8A 5TLSA 3OO1A 1GNVA 2IOHA 3ASUA 4LHEA 4GYCB 1K4YA 4ZOLA 2GTHA 1J1ZA 3CCRV 1T5IA 1CV2A 1T0AA 4K9OA 4GMDA 3TQHA 4ILEA 1TVKB 1QUFA 3IMEA 2G38A 5CGZA 1GSOA 3M4YA 1IUKA 2VJLA 5LBTA 1JV2B 1KGDA 4UTNA 1VHJA 3DVQX 4MUGA 2NO6A 2K6GA 3L7DA 1O7JA 5EQFA 3A4NA 1R1MA 2ZBQA 2UZAA 1TE2A 1YFZA 4MV6A 3V1MA 2XF8A 3LLCA 3R9IA 1HEUA 5FADA 3IBTA 5HJEA 2AHRA 4REMA 3MT0A 5AFSA 1K34A 4XB2A 3PJSK 2V9PA 1MGPA 5KAIZ 3DWIA 4PDLA 2QSYA 2OY0A 3UUFA 4P3XA 1VBMA 4CDMA 1PD3A 4V2IA 1C7QA 4E11A 4E1AA 2YIDA 1IN8A 2NUTA 5KDDA 2O23A 4ENUA 1IQUA 3WJ2A 3TPCA 3DXZA 4WDRA 1KY3A 3K0GA 4UASA 1ONNA 2CFOA 2GZDA 1MUUA 3T38A 2W71A 3RRZA 4DWWA 1Y9ZA 3A4YA 4J4BA 1XK6A 4FILA 4GPIB 2KMLA 4OBXA 3WNZA 2H0QA 1ECCA 2P3LA 2O8EA 4EX7A 1BWPA 4O33A 1FUUA 3FPIA 3LLVA 4ZK7A 1A71A 4E5MA 4E09A 4L4XA 3FG9A 2OYSA 4EEQA 1SBIA 3E83A 3H75A 2Z01A 2NXNA 4MT8A 4P7GA 4I55B 1XTTA 2QM0A 3Q4HA 1QQCA 5HS4A 2HIMA 4PX5A 5BXZA 3K0CC 2OQVA 1JQKA 1FE8A 1N75A 2AL7A 1QOPB 4R1TA 2YW9A 1MG1A 1R0YA 1WF6A 1FW6A 2Y1WA 1W5FA 3CXHF 2QWOB 3BK2A 4LXHA 3R0VA 4H60A 2WHEA 1FOEB 1GCAA 4MX8A 3KJEA 3U3XA 4UEOA 3LSSA 3V00A 3MCUA 2JGJA 2PVPA 1UK8A 2WWGA 2QKCA 2UUBO 2DY0A 2ODNA 4FC6A 1GLNA 1R4ZA 4GQIA 3A7EA 4X3OA 1KKUA 4DIKA 3RVMA 1JDBB 2NZXA 1PDWA 3DB2A 2FLKA 4D80A 3K6SB 5D51S 4F2WA 1G8PA 1LTKA 1QX4A 3CZRA 3OONA 2GD1O 2O6HA 2ZR7A 5CH5A 1ES9A 1AURA 1Q3TA 2YUTA 3IBFA 3CNBA 3SF0A 2V7UA 3GVIA 1BYUA 1C9DB 5DBHX 3L7YA 1U80A 3UGQA 2QTTA 1BU8A 3D8CA 4Y1FA 2C5BA 4QLBA 2IZ0A 4KHPB 4BO6A 3W5VA 1IXBA 5L4LA 3RNOA 3LRTA 3U60B 1TDJA 5GWXA 4DRZA 4C03A 4JN6B 4UCFA 4TVOA 3LTEA 1PR9A 3EEFA 1REQB 4N41A 5IFKA 3X2QB 4KH0A 2P9QA 1Q82H 1JJOA 3T15A 2XZDA 1N9GB 4WOBA 3RSHA 4Q4AB 3LKVA 3L1HA 2ZATA 4DUZO 3SBXA 3O2SB 1R0WA 2A8YA 2XUMA 1TEVA 4FYVA 1NM5A 4B80A 5I8ZA 3IHWA 3OPNA 1RRVA 4NS1A 3DH0A 5IJWA 3FRJA 1NZDA 2ZBUA 1Q1QA 1TU0A 3OCYA 1ORDA 2H57A 2ZULA 3BICA 3R3ZA 1C2TA 1OX5A 2VBCA 2ZIOA 1G7SA 1ZNWA 1JR3D 3KQTA 4GKKO 4PZAA 3O84A 4H3HB 4JMLA 1R0CA 1I3CA 5FQNA 4R68A 2FG6C 1HE2A 1KI4A 1ZSVA 4QTTB 1N5MA 1PXWA 2P79A 3HKEA 2HHHB 2IX3A 5BN5B 1YXBA 1UDXA 3WJRA 1P0QA 1WU7A 4OLHA 3OT7A 3A6GA 5BSHA 1BWSA 1YB2A 3B77A 2UZ3A 3HKCB 3NETA 4AICA 4RJKA 3CS3A 5KKCA 3WQSB 4IFBA 3F0GA 5JYCA 4ZGGA 5ITVA 1BJRE 1XA4A 4PWZA 3ZGLA 8MHTA 1JR2A 1Y7LA 3MINA 5HFMA 1QYWA 2HMTA 1ID1A 3IDAA 4RZ3A 2OR3A 3HUDA 5EUMA 1JDTA 1S6YA 1EDDA 3O1LA 3IKVA 2P62A 1KR5A 2ZM6B 2KBEA 3ENKA 4LXYA 3K1AB 2ZRAA 4IFIA 4M7RA 4WFFA 1NG1A 2GAAA 4UMVA 4TSFA 2RH9B 3BZUA 4BLOA 3U16A 1M56C 3ST7A 4QO8A 4QFMA 3DOJA 4EQ6A 3BORA 3OKFA 3ELCA 3MHHC 4GRDA 4MV3A 4WGGA 3QYFA 5JYDA 1E2IA 4PGGA 1UFYA 3SR2C 4KGVA 1KP3A 4L3OA 2X3YA 4FFBB 1PVVA 3Q6IA 1XD9A 2PGNA 3A1FA 1OBVA 4KFMA 4UCQA 3GCZA 3L6RA 1JLRA 4MPRA 1M8GA 3QF4A 2ZNIA 1J2TA 1M0EA 2ITDC 1MDBA 2CYBA 3U4CA 2WLIB 1CUDA 1EX6A 2CJPA 1ZIPA 1RQXA 4GL2A 4RDCA 3KIZA 1TYCA 1U3CA 5I8PA 2DFKB 1KMQA 4CQLA 3B3QA 4D4KA 3AHHA 1D2RA 2R6JA 3OQ6A 1ULZA 4JT4A 3RDPA 1GO3F 2UXXA 5BYJA 2VRNA 3GMTA 4MKXA 1K6EA 1DWPA 2EOAA 1U1CA 3CONA 1MAWA 4W5OA 2IU6A 1R27A 1L7RA 1B8NA 2YH2A 5A3QA 3CRVA 3HUFA 4MAFA 5AM1A 3EIXA 1VTKA 3JQDA 3E8MA 3HYLA 2UYYA 2C3PA 4KL8S 4UPEA 5GONB 3QKUA 1JN1A 3ZDCA 5I5GA 2REBA 4LDJA 5AUQA 1K4DC 1SU7A 3O75A 1Z34A 2J85A 4G0OA 2YEVB 4IFEA 4CL2A 4W1PA 1E4EB 1JWAB 4FSDA 4ZT3A 4TWBA 1QH9A 4BS9A 1M34A 3J7TA 4FVMA 3HKBB 3ICEA 4LZZA 4RORA 4PCVA 2M2IA 4KE6A 4MTLA 4S0XA 3MMNA 3H04A 1MU0A 2OK7A 1XD2A 2BCCH 3RC8A 4HLCA 1L9XA 3BSWA 5L6MB 3KHUA 1HDXA 3HJUA 2ACEA 1XALA 3PDJA 1UOOA 5EJIA 5DISB 2ETVA 2OBXA 2X58A 4XUCA 4YA6A 4C6SA 4PX3A 1HT2E 5HF9A 2XVXA 2N05A 1XJWA 1F8FA 2WF9A 2GCOA 4K8XA 1SRYA 4RE6A 2C54A 4BYGA 4KQMA 5JZOA 5J4VA 1YJWF 2F4VB 3R7SA 5AHOA 5D3MB 3EUAA 4IH1A 1UDCA 5J43A 4EA9A 3GHZA 4U7TB 4RV9A 4F2HA 1Y4DE 4HDSB 2N1MA 3CPWU 1B42A 2HK6A 4UMEA 3M8KA 4PRZA 4Q00A 1BCCH 3TLBA 3CD6F 2NLOA 2NGRA 2EGGA 4QQKA 1WXWA 1MGOA 2WABA 3DQZA 3O9VA 5JANA 2Y0BA 4BBJA 4ZJUA 1DPFA 4MDYA 5M04A 1RHQA 2ZDIA 4NQRA 5K6TA 2Q9UA 1JFFA 1X7XA 3IQIX 5FRDA 5I7OA 1DUIA 1GAWA 1AQJA 4HB3A 3WNQA 3ZMUA 1NM5C 1NU8A 3VTAA 1CWUA 4ZO4A 1W5TA 2C5GA 3DS8A 3CMMA 2PKXA 3OQJA 1U8TA 4PZYA 2D7CA 2ADMA 4P5DA 4YQFA 4WFIA 1XG5A 5H4GA 4CCYA 4EB0A 1HYBA 3RRFA 4BVTA 1COMA 1L4BA 2ZIAA 5E9WA 3OBYA 5JISA 4Z2AA 3VNSA 5I9NA 1QYRA 4RPCA 1DK1A 4CHGA 1ZEMA 1V7CA 5AM4A 5EYPB 5FLEX 3S2UA 2Y4UA 4I4CA 5JH7A 1ZICA 1XNHA 1QLWA 5ALDA 2RH4A 2IOFA 1WCIB 1AOXA 5SV2A 2J4FA 4DGSA 1GOTA 3ZUGA 3RTDA 3GP3A 1SCJA 3DR5A 3H1GA 2CF6A 4K28A 4KDRA 4FWIB 2GHIA 4JI8O 1P3DA 4YDHB 1ZITA 5CFLA 5EZ6B 4R2JA 2GN8A 1PSDA 1AGNA 1XB2A 2YTZA 4L8LA 1DJOA 1DI0A 4H7JA 1W44A 4L0MA 2Y0EA 2XQJA 2PXXA 2WFMA 3GFTA 3ICOA 4DLAA 4L8GA 2VATA 2OKGA 3O26A 1VARA 2QVBA 3HLKA 5BQ3A 3T7SA 4BX9A 1E96A 3E9EA 4FSHA 2QLMA 2DN9A 1JG2A 1WMEA 3EPPA 1Y9DA 3IJPA 4FCVA 1BXKA 3KOYA 2VJPA 3PTZA 3F5SA 3QBJA 2Q5OA 2HQOA 3IDFA 4JF3A 2RGCA 5KYXA 3W0LB 4RZ2A 2R85A 1ZJWA 1UPXA 1OV6A 2YWRA 3GPCA 2J6CA 1SUFA 3EG9B 4HB0A 4KK3A 4YAOA 2FX3A 2XAUA 3DBRB 4ZBMA 3DEKA 3SJ7A 3K9CA 4REOA 1HTWA 3V6LA 4G01B 4R1MA 1GRJA 2DKNA 3QENA 3ZOKA 1CUBA 4B2IA 1YGPA 3C85A 3WV5A 4BBZA 1WDTA 4HV4A 4RQTA 621PA 3SICE 1KYIA 4J10A 2Y3IA 3JSLA 4J9VA 3UJ6A 3H8JA 3SS9X 1CC1S 2QTRA 3N2IA 2OCLA 3C48A 1E6WA 4R2WA 1ENYA 3JQ7B 1E6LA 5HW0A 3GJ6A 1M74A 1JA1A 3B52X 3R5XA 1G98A 1SUSA 3II6X 1HNNA 4DW8A 4HXFB 1KNJA 1ZK4A 1WNTA 3EGXB 1OH5A 3WVNA 2R751 1M8FA 2VP9A 4FMDB 3GJ7A 3Q3IA 4ZVTA 1I33A 2XT0A 4GVLA 5L51A 4LGMA 5IMBA 2CFTA 2IOQA 4DV3O 2JJYA 2CUTA 1KC3A 1RZ3A 4RKFA 2P2NA 3E3MA 3WGUA 3MDOA 2BGNA 1DBWA 3M1IA 2GILA 4KFUA 1NVGA 3AJ8A 3QHPA 5DPMA 2C5SA 3KFVA 4Z9BA 3OPMA 1MA0A 3NHMA 2O0HA 2J9ZB 1VJGA 3ZDEA 2O7NA 2GJSA 1BD3A 1L5SA 2F43A 2D4AA 5FL7A 4FFPA 5CA0F 4JB0A 1TLLA 3ND7A 2BFDA 4ENVA 3I7TA 5CEFA 1GUZA 2FJPA 3EZLA 3C14C 4PYIA 1B8UA 2BBOA 3NBUA 2W6OA 2J4CA 3YASA 4UHCA 1U7ZA 3ZHBA 2R6GA 1PR5A 2FUKA 4QT0A 3LTNC 4WOKA 3CCMF 3R3HA 4KXUA 5HGXA 4F4JA 1FP2A 2C97A 5CDUA 1J4AA 1AKVA 2QI2A 2CXHA 5A5GA 4X60A 4EYKA 1B0ZA 2R00C 4C3ZA 2XGSA 2ICAA 1H9CA 2HKOA 3RR2A 1HDYA 1WO8A 5HE8A 3Q7PA 3F6EX 5C5CA 4NARA 2SECE 4NH4A 5EWMA 2ZUDA 1TYDE 1B6TA 3GEGA 5BSVA 2FR8C 2ECPA 4BX2A 2JHGA 4KPUA 4KAXA 2ZDIC 2HA0A 4Q48A 4YXWD 4Q12A 3LQ2A 1SBNE 4D9HA 1CBUA 4X20A 4XXHA 2Z6AA 1EX9A 3OJWA 4G4JA 5EKUA 1G3RA 4C89A 2XCLA 3B7PA 1NF2A 2R6ZA 2D6FA 2DPHA 1WE2A 4U2EA 1DAPA 4JK3A 4L9AA 4OXSA 3BXEA 3EISA 4XQ9A 1M2KA 3DMTC 3STUA 1LI5A 4DQDA 3K0FB 3QV1A 4HSGA 2PL9A 3L71H 4M36A 2DFVA 5C34B 4HHEA 1E2DA 4XVQA 2W8BC 2YRXA 2PUSA 5IUNC 5MHTA 1J49A 1Y9JA 1FZTA 4TSFD 4OHPA 1NKTA 5L3GA 3L05A 4KZKA 5K05A 4M1EA 2I8LA 3QWHA 1J7KA 2XVMA 4L27A 3DWFA 5E4JA 4Y6RA 4K86A 4UCVA 5TQVA 3ROQA 4BASA 1IXZA 1HP8A 3FVTA 1UFQA 4LBVA 1L7EA 4KVGA 1TM7E 1TEZA 4BDSA 3OP4A 4OHZA 5DN6G 3ADDA 1H42A 1V4BA 2QTZA 3ILSA 4EHKA 4D6PA 3OOWA 4XFJA 1YNSA 1D5AA 1UPBA 2M6YA 4L51A 4CIVA 1W0KA 3NGXA 1E2EA 2J46A 2PZLA 5EE9A 3SDBA 1MG5A 4JJEA 1KH2A 2X4LA 1AGPA 1Z16A 2Y0IA 2RIRA 1QOZA 4IDGA 3VPCA 4AYWA 3L7CA 4RMHA 3GRUA 3L8GA 5IWAB 2VNIA 3TFOA 3F0FA 1SC3A 3IBYA 4Q4CA 1KVTA 3G02A 3AK2A 4L2IA 4OM7A 4BATA 3L41A 1PL0A 3ROEA 2C83A 2IZ1A 3K15A 2IZ7A 2H85A 2XUKA 2PMEA 1DTWB 3R7FA 3ZJ5A 2YUAA 1M6WA 3T3PB 1ZXBA 4FJ0A 5AXCA 2FRVA 2XKAA 5K8UA 4MLDA 4MEJA 1PWXA 3D3WA 1KKMA 1J5EB 2AUNA 5I4KA 1AUXA 2PLFA 4BO0A 2PUJA 2BYTA 4M6WB 4BFVA 5C8YB 3N86A 5E1MA 5HWSA 2CUGA 4HAYA 5C32A 3K71B 5KLVH 1VI2A 5DNYB 1ZA1A 1SZQA 3ZE0B 3MJ4A 2QNBA 3ROXA 4QYXA 3JAKA 8OHMA 3F0DA 2PGLA 2HDWA 5HEKA 2PM8A 2P68A 1X80B 4M1OA 1K5HA 3UMSA 3I64A 2HWUA 1X3SA 1WX1A 3SJZA 3PWKA 3KX2A 1JDNA 1JB9A 3FNQA 4LXQA 3IELA 1MAAA 4G85A 1J70A 1KZ4A 1K9SA 1T4DA 4WZAE 4LY0A 4DLBA 5KAFZ 3OZWA 2IYOA 4G63A 4F5WA 1QJCA 2NZ8A 3DE2X 4Y2QA 3W34A 4KE8A 3O1IC 3MELA 3LW7A 4IRXA 4ANFA 4I7ZB 2GARA 1LY1A 2XX3A 1KO8A 4UBJA 1R4NB 2O5VA 2HHAA 1SKQA 1WIWA 5FNVA 3X2FA 1GO1A 2RHRA 4RK1A 3OEHG 2CTPA 4PZ0A 4BV3A 1B3QA 3LPLA 4DNQA 3EFHA 2A14A 2X3UA 1QK4A 2R8PA 1SG9A 4PFJA 2E3CA 4PI0A 1XTIA 3Q2IA 2Z3WA 1F8XA 3EF0A 1NFQA 1JG6A 4GKJB 2J7PA 2IV2X 4XWWA 4TYWA 1TZKA 1F17A 2BEVA 3GJYA 1T10A 1W36B 2B7CA 3E5HA 2JASA 3T4XA 4ZEWA 3LI2A 3HABA 1JHOA 3HN7A 3WV4A 4Z5XA 3OU2A 2B1JA 4CMCA 1QCCA 4GPZA 2GX6A 3GY0A 2Q69A 1NI5A 1F2DA 3NHBA 2IYRA 3MCWA 4LOJA 4G5QA 3DBIA 2A4KA 2G1JA 3EARA 1JIKA 3Q8WA 1KYXA 3V1LA 4C6TA 1X59A 4M8IA 1VQ6F 2GZMA 3WMXA 1HH4A 2GBLA 1PIWA 4AMGA 3X43A 3ZRXA 2B20A 3VGPA 2BFFB 3K1YA 1N5DA 2MR6A 3PD1A 2QWNB 1YZLA 3VC2A 1UDWA 2B37A 4F2GA 5HYVA 4CL0A 3I39X 1YCDA 4G5RA 4CPDA 2AZXA 1H8HG 2IUTA 3VOTA 2VUSA 4Q7JB 3VZRA 4DT1A 3O8LA 2PV7A 3BZBA 3OX2A 1XMPA 1GQRA 1DJLA 4GOJA 3A1CA 2W2KB 4L9WA 3MXTA 4OHUA 5IN4A 4AY5A 3L4EA 5EFOA 2E74B 2NUPA 2Q3DA 2Z4RA 1PNOA 4GKBA 4KPGA 4L87A 4V03A 4JCOA 4XYGA 4ECAA 4ZWNA 4DCJA 4IYIA 3FLBA 2G0TA 2VOJA 4R5MA 2YICA 1XNRB 5A3RA 4IICA 1CXZB 1QU7A 2GA8A 5EESA 4MKRA 3D7NA 3W4KA 5IYZA 1YQNA 4FINA 1JU3A 4RULA 5DASA 4H6XA 3I73A 3H6KA 4RTRA 1NV8A 5K3FA 4TTTS 2W22A 1RI3A 3T7DA 1A2BA 4LI3X 4AXXA 1KZ6A 3AXTA 2AOTB 1KPHA 3BQMB 4G1CA 1NJ8A 1Z82A 4QGHA 4MW2A 4HWOA 5DEOA 4ZQIA 4E4YA 2ZVQX 4KNVA 5ADUS 2IYYA 5C8ZA 2RGXA 2G5TA 1E1CA 1BYIA 5DXFA 5A2QA 1AB6A 2FSVC 2AMTA 4O2RA 2OORA 2H5EA 1Z2CA 3H01A 4G8CA 1S2OA 5AXDA 4H0LB 2CHTA 3U7QB 4UFPA 3RAFC 5DLPA 1XOUA 1JSXA 3I2KA 1QGAA 3UVEA 2PS3A 5FUXA 2WWXA 3D81A 5L45A 4BO4A 4O4IB 4C0WA 5FAKA 5F51A 4RGYA 3RVJA 4RGQA 3C45A 5AK6A 1BCSA 3WWCA 4YJDA 2POCA 3SBDA 2JPDA 5KTSA 4KHZA 1FFTB 1XDBA 2GCPA 4HXEB 3ILYA 2NZ2A 1UT8A 1BEZA 1R5JA 4A2PA 5I7HA 4HZIA 2YYAA 4F9EA 3ND8A 1SIWA 4UUAA 2QI9F 1GD1O 3TTYA 3NI2A 1NZJA 2CLFB 2PE5A 4PYKA 1ZN8A 3ROKA 1Y1KE 4UM9B 1O03A 3TX2A 3K7EA 1AVMA 1RVV1 1TO1E 1Z47A 4NK5A 1V55C 3P5BA 9LDTA 3N75A 2Z1DA 1JKJB 3NHZA 3CUWA 3QA3E 3B8EA 2A1UA 1QNFA 1PW7A 3ED5A 5FCDA 1HFJA 1VHLA 2IE0A 1GK9A 1PK8A 1QVRA 1VYVA 3N0TA 5BN3A 3KJFA 2PZMA 1YL5A 4QTXA 2J9XB 2I1QA 3WB9A 3ACDA 4HAUA 3M4ZA 3RSOA 3S2FA 1DO2A 4D82A 1PWZA 1OFGA 2UAGA 2AFHB 3Q6NA 4GLBA 4EGSA 3TLXA 5FL7D 3O93A 1SY7A 1U7DA 4TV8F 1MMFB 2F17A 1UFKA 1JX9A 1U04A 1G8AA 1K7XB 3WB0A 1IBKO 3RFXA 2UXNA 3ZU4A 2R9VA 5JUWA 4RHEA 1QRUA 3THYB 1DCFA 1NC1A 3NYIA 2E3JA 3M4XA 3FYHA 3LMKA 4FDUA 3NUQA 5C9ZA 1DRUA 1M5UA 4NG5A 1KY2A 4GWLA 1QCEA 1KJWA 3W2HA 4DUYO 1V2GA 2DUUA 1YVUA 3HFRA 2IXDA 2QN6A 3JATB 4ZI2A 2OG2A 4ZREA 1VDZA 2E4ZA 1TAUA 3VVLA 4C0LA 1BHJA 4WFBV 2VQFO 1PHRA 4G1UC 5IH7A 2FWMX 2IV7A 4RXMA 1IBLO 2IZZA 2R9RB 3VBBA 4MKHA 1QIDA 4Q3CA 1JT2A 5JFGA 2A9HA 3QLUA 5HWEA 1KZYC 1Q1BA 3J7AR 2ZUCA 3IP9A 4B35A 1JIXA 3ZMZA 2OXEA 3UBMA 4MINA 1CJKC 1EFVA 3B38A 3BIJA 3V8QA 5C7YA 4X88A 4EI9A 4JP1A 3HACA 3WLAA 1G66A 3HZHA 1DDGA 2UU9B 3LNTA 1VHAA 2GBLC 1P9RA 4TPKA 2YYSA 4BGVA 1PKXA 3ZCPA 1UBKS 4G23A 4TL8A 4YV7A 1I6KA 5SYAA 4QOJA 4AO6A 4GKVA 2QM4A 4D9GA 1K08A 3CX5F 2ODWA 4DLKA 1TTHA 4YRZA 4NQ3A 1F8GA 4DCMA 1P8JA 5EIOA 3ETEA 3BPSA 3E23A 1FTWA 2GBOA 1KO7A 1R8JA 3WK8A 4CKWA 1DEKA 2XNDG 3DVAB 4IVNA 4LRQA 3AX6A 2EEZA 3T5GA 2F2TA 1LKZA 3HDVA 5FPQA 1ZJZA 1Z22A 4H6PA 5ECDA 3PPVA 3N0XA 1NU1H 4IJUA 4J29A 4HRYA 4YRGA 1WQ3A 2TSYB 4H4DA 3DNPA 3H1AA 1X39A 1LPSA 1UFVA 3CLUC 1OV4A 4Q39A 1ZLZA 2EJTA 2HV9A 1W0KD 1YR9A 2FW1A 5IJ0B 2HC9A 2H7VA 4RDIA 3UB2A 1VP9A 3G0HA 2Q7OE 1IBCA 2EX0A 5I7EA 1G60A 4ENRA 1V8FA 1YI0A 3GPIA 1VPLA 2CDAA 2V0NA 2PTHA 2QX7A 4A91A 1RMYA 9MHTA 4I19A 4IUDS 2PIAA 4UD2A 2RGGA 4X97A 4BFWA 4OXYA 3OKAA 1EVEA 1V16A 4BNWA 3O47A 4RIFA 1CRQA 1JQ3A 4HDCA 2IYVA 3EXG1 2O48X 3ZS9A 3E9NA 1HMPA 3BYZA 3DOUA 3HMKA 4E7OA 1H22A 3BIFA 3GU3A 2O8FB 5ALTA 4U3JA 3SQDA 2JFOA 4FE3A 5DHAA 2CHSA 3T2MA 3AU9A 5HUQA 4C0XA 4M8NE 2CH7B 5DHTA 5G4KA 4IZHA 5GJCA 3RSSA 4CEHA 3CUVA 1GV1A 3STXA 1L4YA 3OBBA 3VH2A 1XAIA 1I4LD 2DUJA 1B4DA 2I3DA 4CIBA 2IZ6A 1IOZA 2WM2A 4HUTA 3ZLTA 2WJGA 1JG3A 1ZUNA 1OTHA 2RIPA 3MRVA 1GZ7A 4MJLA 4HTFB 4LRXA 5NULA 2ZRQA 4RD1A 3OJEA 4E6EA 5M29A 4GZ5A 3I4LA 2JKYA 1MOPA 1OYVA 4BO2A 1AXEA 4YUZA 4JUIA 5KNDA 4TKVA 1GADO 1MIOA 4FLUA 2ERXA 5LD2B 4B3TO 3DOIA 4QVIA 3OOSA 2J6IA 3C3TA 5JCZA 4KO1S 4QEKA 3H11B 3M84A 3LX8A 3W7AA 4LHSA 4QBKA 4NQZA 2ATKC 4UJ3A 4EY8A 4BLWA 5JRDS 1B74A 1Z83A 5AKLA 5CVJA 2D3TA 1VE5A 4I5GA 2BSKB 5H6RA 2O07A 3K96A 2Z4TA 1XR3A 1VJ5A 1RJGA 1U7TA 3DMHA 1P62B 1N1GA 2GYVA 2HV8A 2OAGA 4MA0A 2DULA 3Q8XB 2B36A 3JAMM 1S2NA 5C5DA 2J7PD 3FZEA 3NTXA 5K5EA 2QAGB 4COOA 2XMDA 4OU4A 2NXCA 3FGPA 4Q9DA 1SC5B 3JXEA 4DR6O 5CDHA 2UUCB 5FO0A 2HD4A 3QE0A 1BWQA 3GH1A 1MNGA 4TXMA 4XCXA 3IJEB 4MR9A 3O1JC 3ONDA 5EHNA 1X38A 4UVDA 1M0TA 1QDLB 3K0CA 5BSFA 1Y1SA 3AG1B 3W7SA 3LDFA 2SCUA 4CTNA 2JLSA 1UAGA 5DEIA 2BBTA 3AERA 1Z28A 4KIFA 4Z2YA 5A71A 1NUHA 4LYJA 1L5HB 2QUKA 1CNMA 4YCJA 3VPXA 1A2KC 2H31A 1EFUA 1NXWA 2RH8A 1TQ6A 4AG5A 4ZV7A 4QVGA 1LFAA 3PXAA 1I4WA 1L4UA 5H8WA 2F8TA 1FIUA 4K2HA 4X1IB 2BM8A 4X92A 2ZSBA 4JZKA 1QH0A 3QBVA 4ZKDA 1TKAA 3FGNA 3DKPA 4LJ9A 5EWLB 4NTYA 2OTLF 2R8ZA 5AW5A 3ICWA 3DXRA 4KMRA 1QYVA 5AM2A 3KS9A 4W82A 1K8QA 1THZA 4PYJA 1F1BA 3O4HA 2G1PA 3FTEA 1TUBA 3RKSA 2WFLB 4FLMA 5LXTA 2ZPUA 4MHTA 2LFSA 1XTZA 3OUUA 3W7UA 3M2TA 1TZ2A 4EPRA 4JWKA 1XCBA 1Z0AA 5TF0A 5KOIA 1P3Y1 1Q0ZA 3STZC 2DRIA 1LWOA 3IPXA 1ZS9A 3D8TA 4ZT7A 4JD5A 4WDQA 4XJXA 1KS2A 3IUJA 2I2CA 3CRNA 3B2EA 1MA3A 5DNEA 5LQNA 2OGZA 1R8QA 5I5EA 2F9MA 4DEVA 4FKZA 5IDJA 4D0NA 4WH0A 3L7MA 4P31A 3BB4A 4HH3C 1U2RA 1ONBA 2CMDA 2PUGA 4QXQA 3RVQA 4RPHA 3C9RA 3EVZA 2JK0A 2YN4A 2ZTMA 5C5EA 2WA4A 2NSYA 4MQFB 4J43A 4YIOA 4I55F 4RHFA 1OLUB 3IKJA 1LUWA 4LPKA 5ERYA 1W57A 4P35A 1E64A 3H4MA 4C5AA 3K9SA 4KYUA 1HG1A 1HDZA 5CNMA 3IOMA 1K9VF 3ABZA 3EQZA 1PT8A 2P9GA 3RUPA 3D43A 2F8LA 3X1DA 4XJSA 5K0JA 3AOGA 3UWPA 3HWWA 5KDOA 3N3AC 3EPLA 1G2PA 2BCEA 1W75A 3DYIA 5KTTA 3LZCA 2C84A 1IHUA 4DHEA 3QI7A 1V4VA 2LCIA 4JHXA 4UTRA 3NTLA 2WTBA 4Z49A 4JXZA 4U2FA 2PKEA 4KGZA 3EYWA 5IBPA 1JHYA 2YXPX 4IHJB 4DDWA 4PO8A 3KR9A 4J41A 3PNKA 1X1CA 1YTFB 3Q5GA 5AVUA 4BRZA 4P4SB 3F8TA 5T4EA 3SD7A 4EB3A 2PT6A 1V96A 1ZUD1 4JI1B 2HRUA 4HRAA 1CUWA 3FNIA 3FJ1A 2Q1TA 2VDOB 2ZIGA 5EJAA 4PV7A 5JO9A 3WS7A 1Q84A 4FTWA 3UH0A 1GSIA 2G9RA 1E20A 2OHVA 4CM8B 2EWMA 4R51A 1UMCA 5FFNA 3FOCA 4IINA 3MQ4A 1M6VA 3TOSA 1DQNA 1MCZA 3ZK9A 5ILQA 1GV0A 5IDVA 2HXSA 5KYYA 1C7RA 1EZZA 2R7LA 4GI2A 3FFAA 5DZSA 1KI6A 1UBNA 4FT2A 1JRLA 3AEXA 1WB7A 5L3RA 4X8OA 3NVMB 3TAUA 2PQ6A 4O4JA 4AURA 3WE7A 3K9WA 3DBLA 2JAQA 3CCQV 1V9LA 1E1RG 5FBKA 3BA6A 2EKPA 2GEFA 2RNBA 4MAAA 3X1KA 3VGJA 2V7WA 5I7VA 5JMTA 1X7ZB 1JHUA 2O8BB 1KU9A 5KHAA 5EIWA 3DTTA 5L3EA 4JP3A 2NLJC 3IX7A 3W5SA 3BMOB 5E2IA 2IJIA 2XMSA 3WYDA 3EJ6A 3WZLA 1IPAA 5FLYA 4J1SA 4Z4EA 3WAKA 1WJZA 1SXJE 1DMRA 2K4MA 3IR6A 4YMWA 4Q3NA 4KSYA 3VJMA 1L1RA 4J0HA 4ZZIA 4OXNA 1XKQA 1EXDA 4YRCA 3D2BA 4P34A 4AZ3B 4IDQA 3VOSA 2EU8A 5EJ4A 1U9JA 2QN3A 3M81A 3SHWA 5A3SA 5TE9A 3FCXA 2YHUA 2PKWA 2WJ4A 3SHVA 1WSWA 4IF6A 4ZHQF 2D2XA 2LUOA 1YCGA 1XWFA 1TC1A 2WG0A 3JQAB 1Y67A 1Q3HA 3FFBA 3PE3A 3ZWWA 4UQPA 4FX5A 4J9ZB 2Y92A 4CM5A 3OR7C 1RYYA 1WPGA 3K16A 4EA7A 1LB1B 1UINA 3GEPA 2IEZA 1ODFA 2FPSA 4WE3A 1IM5A 3CURA 2J31A 3T0GA 2JGUA 2XUGA 3PFGA 2DCUA 3ZCXA 2LW1A 3AEQA 1O4WA 3BEDA 2YOGA 3N5CA 4M9XA 4DSAA 3A3KA 3G6EV 5G02A 2XYGA 5DDIP 2JNWA 1FSSA 1QQAA 2QZ9A 2IV3A 1IZZA 2WF5A 4CMJA 1PGOA 5KTMA 2EC5A 5ALGA 4R54A 1I1OA 1KC8W 1NUQA 5HQ3A 3QEAZ 4RD0A 4OREX 4IQGA 3HVJA 4LF5O 4AWAA 2IP4A 1VG1A 3THXA 2CGOA 1QS0A 1FDWA 3NVDA 4AU1A 1EUCA 3C3DA 1V5IA 4MWSA 1E5LA 3PWSA 4J80A 1T2CA 1WDWB 3FLEA 5CFNA 1LQUA 1FTGA 1XCLA 1SQVH 1MPXA 4DV5B 2XUAA 3I9FA 1W25A 3FAVA 4PLWA 2O2SA 1UQUA 4XB1A 3CCSF 2LVBA 2Z57A 5D5HA 3PFFA 1Y89A 3P4EA 5JU6A 4ZK6A 2HAEA 4A73A 4JBGA 4LQCA 2NTEA 4D74A 4PLYA 1GO2A 4CTJA 1C1XA 4IVQA 1FKAO 2GN0A 2NVOA 3TCXB 1JDZA 3RREA 1S72F 1TPZA 3E18A 1KYYA 3AH8A 4ZAXA 2AW3A 4DNXA 4H13B 4CEIB 1YQXA 4DV1O 3M9LA 4CZ2A 1HT0A 3E3AA 4C22A 5H1YA 5LWQA 3ZBUA 1CSEE 3LT1A 3BXFA 1SC6A 1ECJA 1SUPA 1G9SA 3AFIA 1H94A 4X1YA 3L0PA 3G7NA 5K0FA 1L2TA 1FU8A 2JZCA 3NR7A 3T8YA 1PL8A 5B7NA 3KPYA 1VOTA 5HE9A 3ES9A 5CIQA 1QG2A 1YE3A 4EH1A 3LIIA 3SJUA 3OFVA 2RHHA 4LK3A 5D6NA 1XL0A 1HV8A 1N1MA 2VDWA 1ZMRA 1RP3B 1RNLA 1AQYA 3QX3A 2K7ZA 2EIJC 3E7XA 1TFUA 2NVUB 3TETA 2WWWA 1FFWA 1P5FA 2FFBA 4BC0A 3VYSB 4HNTA 3RROA 3GC6A 1F2VA 3KSMA 3PQ5A 2B1IA 4EO9A 4KO3S 4X54A 1SH7A 1GILA 1JQAA 3TB6A 1Z2DA 1DO8A 3TUIC 4D2IA 3AHJA 1TPYA 5LMNB 1XFAA 3PNSA 2ZYSA 1IBSA 4OI4A 4G0XA 4OQ4A 4MLCA 1LVHA 2CYAA 1LC0A 1TTPB 4EBFA 4BAZA 4O4LB 1CULC 3PQ3A 1QM5A 1U6KA 3G6WA 1Z0FA 1UKEA 5DNAA 2ZRCA 3TBFA 3G89A 1UK7A 3NHSA 1E7KA 3PF9A 3H9VA 2FPRA 5DTQA 3FMPB 3OZVA 4TTQA 1XTRA 4BLRA 1X8XA 4W1SA 4AI8A 3F7OA 3F9RA 4MGZR 3RJ9A 5L3ZA 3DDUA 1DEOA 2DJVA 4UUJC 4BNZA 2VZLA 3WKDA 4A27A 3K9QO 4B81A 1E79A 4I66A 2GTIA 4EHIA 3ORRA 1VQPF 3TGLA 1Z6ZA 4RMJA 4U2GA 1OA1A 1C3VA 2IYPA 1C9MA 2BFOA 1BKDR 3BRWA 3BYQA 3DVSX 4EKDA 1BDJA 1IXMA 3GP8A 1ZI6A 1SG6A 2ZINA 4I3HA 2I7VA 1U02A 3T9AA 2GDZA 4DLXA 4ZCIA 2A30A 3AHCA 2APJA 1NUUA 1YJ8A 2X1MA 1GGNA 4FYYA 2R2GA 4OKIA 1ZWZA 2BP7A 4W5NA 5F76A 3WL8A 1SO8A 4EA6A 1XC7A 4BVLA 2PG3A 2QTMA 2JDIA 4JGSA 3QBTA 4QEZA 3BVPA 3L7AA 5DWQA 4Q7KA 4CR7A 1LRJA 1FP4A 2WIBA 3DV2A 4FQ8A 4Q6BA 2QIPA 1TZBA 2H8EA 3EQ2A 2PR7A 5FR1A 3P45A 4QJ4A 1QP8A 1S3GA 3HL4A 2JJ8A 4ZU3A 3IV6A 3ROMA 3KL4A 1X1AA 2PH3A 4RHUA 3VO2A 1WPXA 5B1SA 2M6SA 2IOFK 1GZDA 4Y8VA 4JQYA 5T57A 5LU9A 1JEYB 3WWYA 1MG0A 3A70A 5LB4A 2PI5A 5E6RA 5KYWB 4CMAA 1ZQ9A 4L8JA 1BHSA 2LCFA 1K06A 1IXKA 1SKMA 3EG5A 2Z8ZA 4WHMA 2X5KO 4JTCB 2IA5A 2IY7A 1RRGA 4G2NA 2VT6A 3CUUA 5AO9A 4HXGA 3C5VA 3MHTA 5ESXA 1OFIA 2D1TA 2MHCA 4ESHA 3JALB 4X8HA 3U1TA 2F6RA 3V2UA 3HSKA 1RKVA 2QDKA 1L8LA 3QPVA 2BIFA 3ZN1A 1UZMA 3UAYA 1L8AA 5CDYA 3HU5A 4W7SA 2C99A 6Q21A 3OSUA 3MGCA 4EG8A 3AF0A 5LDGA 2Z95A 1KSGA 3ET4A 3FB8C 1QQ5A 3OW2F 2MTBA 4OGWA 5AHKA 3MOSA 4ID3A 4M0FA 1O6FA 3ZU6A 2EG9A 2NAPA 4ALJA 4PFQA 3QK7A 4MI9A 4JVMA 5IHXA 5KNCH 2IYNA 2X76A 1UBRS 3QMWA 2Z6UA 3SE7A 2GZ1A 4CS3A 2R00A 3H5WA 3L4SO 3IHTA 1VMKA 3HGQA 4OHFA 2XRZA 2Q2WA 1LI7A 2H29A 1YE8A 4JJ6A 3B8NA 3ANTA 4LNUA 1P0FA 1HURA 4IWNA 3WXMA 1FP1D 2FR8A 2EAUA 3S1LA 3VZPA 3NHWA 2JIQA 3N9IA 3VHQA 4XCVA 3WRVA 3W4JA 3S27A 1Q6IA 3B4SA 3CX7A 3QZUA 1XDUA 2WE7A 3HB5X 2OCKA 3AF5A 3DE1X 3UMGA 3NT2A 2HXGA 4J7ZA 1NBME 4F3TA 5LYJB 4HR7A 4FMDF 3IEXA 2PGGA 3DMTA 5A5VA 5MDHA 4EHFA 3U19A 4ZO8A 2AHOA 2B98A