4I4TB

Crystal structure of tubulin-rb3-ttl-zampanolide complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
420
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
molecule tags Cell cycle
source organism Rattus norvegicus
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
total genus 158
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i4tB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i4tB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i4tB01
5JVDA 4U3JB 5J2TA 5JH7A 5FNVA 5C8YA 4EI9A 3CB2A 4FFBA 4F6RA 4I50A 4X1KB 5IJ0A 3VPAA 5LYJB 1W59A 2VXYA 3HKCA 4O4HA 2R6R1 5CA1B 4TUYA 4LNUB 4EB6B 4X1IA 2VAMA 3WGNA 4YJ3A 4EI7A 3JARA 5KX5B 5C8YB 3RYHB 4KWEA 3WGKA 3RYFB 5IJ0B 4ZOLA 4I4TA 2VAWA 4ZI7A 5JQGB 3M8KA 3WGLA 2GVIA 3HKEB 4HNAB 5CA1A 3ZBQA 5LA6A 4TV9B 4X20B 5JCOC 2RHOA 3E22B 4IIJA 3JAKA 1JFFB 4YJ2A 1SA0A 3V3TA 3JAWB 5J2TB 3VO8A 4XCQA 2BTOA 5BMVA 5KMGA 1TVKA 3UT5A 5LP6B 1FFXB 3HKDB 4I50B 4X1KA 3JALA 5CB4B 3WGJA 5LP6C 1RQ2A 4O2AB 4O4LB 5LA6B 5IYZB 4IHJA 4O4JA 1W5FA 3JAKB 4B46A 1TUBB 4DRXB 5ITZA 5EIBD 5IJ9A 5EZYB 5LXTA 1SA0B 1OFUA 3JARB 5JCOA 3N2KB 3R4VA 5BMVB 5LP6A 3WGMA 3ZBPA 5EYPA 5J2UA 3JALB 5CB4A 5LOVA 4WBNA 1Z5WA 1W581 5IYZA 5CA0B 4HNAA 2R751 1FSZA 4O2AA 1RLUA 5ITZB 4U39A 4TV9A 1W5EA 5KX5A 5MN5A 2Q1YA 5JH7B 3RYIB 4IIJB 3JASA 4FFBB 4F6RB 5GONB 3ZIDA 5FNVB 3HKBB 4DXDA 5KMGB 3HKEA 4O2BB 5CA0A 5LYJA 4O4IB 5LOVB 3JATA 1W5AA 4LNUA 3E22A 4EB6A 3RYIA 3VOAA 1RQ7A 1W5BA 2RHLA 3JASB 4YJ3B 5LXTB 4ZHQA 5JVDB 5MN4A 2XKBA 3HKBA 5GONA 4ZI7B 5JQGA 4O4IA 4ZOLB 4O2BA 3RYCB 3C8LA 4TV8B 2RHHA 2VAPA 3HKCB 3VO9A 4U3JA 4EI8A 4YJ2B 1Z5VA 4M8IA 4B45A 3N2GB 4X1YA 2RHJA 3JAWA 4I55B 5M7EA 4WBNB 1FFXA 1TVKB 3UT5B 4O4LA 2XKAA 3RYCA 2BTQB 4IHJB 4O4JB 5EZYA 3RYHA 5IJ9B 3N2GA 1TUBA 4X1YB 4DRXA 3M89A 3N2KA 4I4TB 2Q1XA 3RYFA 5J2UB 4ZHQB 4I55A 5EYPB 4E6EA 3JATB 3HKDA 2BTQA 5EIBC 4TV8A 4TUYB 5MN6A 4X20A 3RB8A 4O4HB 3VOBA 1JFFA 4X1IB
chains in the Genus database with same CATH superfamily
1I9GA 2IJGX 1Z0KA 3ILSA 3C85A 2H6EA 3ROMA 2IDZA 1ZAYA 2UUBO 1ECBA 3HP7A 1XJ0A 4KLCA 3PVCA 3S81A 2HW8A 4UVEA 1DRUA 1I2ZA 1V45E 3JAMA 4WOJA 1OAKA 1E58A 4X9QA 2ZWAA 4MW3A 1VHWA 3GEMA 5MFZA 4AWAA 1PGPA 3RU7A 1DTSA 2Q2QA 4CDGA 4ECEA 2VS0A 4KBYA 2CE7A 5D85A 1P61B 2BHNA 4O1IA 2QG4A 2G9VA 4CIDA 1KETA 3THWA 1X80B 4QYSA 4PAGA 3CCUV 3TLXA 3UG7A 3N5KA 3G2MA 1YI2F 4HNAB 1J8QA 1US6A 1VQ7F 1ZZGA 5CLQA 3TNYA 1VLVA 2ZKOA 1AMUA 4JIGA 4L8FA 3ASNB 4WESA 2IIBA 2H57A 4ENWA 4NVRA 1EBOA 1KO8A 3DE5X 4KE7A 1R0CA 4PNPA 4BWYA 3OTOO 2A0KA 1US8A 3DFKA 3P52A 1PFGA 3U6KA 3T1YO 3BDAA 5JXJA 3ZQKA 1NVUQ 1O94C 3E5NA 1PNKA 1I6MA 3PTLA 3RWRD 3WBFA 3QA3E 3N2LA 4QTXA 3OM3B 4G4WA 4PGFA 3D6VA 4NR0A 3ZVMA 1GO3F 4Y8VA 2COKA 5JDIA 5H9VA 4FMCB 3HNPA 4R2WA 4FKZA 2XUGA 1EM8B 1TEVA 2J3HA 3OMWA 1N57A 2G4CA 5KA5A 3G2JA 1HMPA 5H83A 3M6VA 1FSZA 1NVPD 2PSFA 1Y3DE 3DUWA 3JRNA 2ZBGA 2CLIB 2QB5A 1QVRA 3IV6A 4WY5A 4CCAA 3A9TA 2ACVA 2V4UA 4WH0A 3H1KH 3CMEV 4MPTA 2RARA 1ULTA 3I0MA 4RVHA 3SK0A 3BT7A 2XUZA 1DTWB 1K5QA 4FQ7A 5B2ZA 3DCYA 1UFVA 3OZEA 5I8PA 1I3CA 1OXSC 3G8CA 1MG5A 1MTZA 3UC5A 1V2HE 4EFMA 3GARA 1JJIA 1WXHA 3JWIA 5JD3A 3SSMA 1O95D 2B20A 4PA7A 4CMIA 2ZUFA 2VKQA 4UDXX 1UDBA 1OQAA 1H3NA 5B1IA 1D1TA 2BFCA 2DG2A 4GI3A 4EYKA 5TLSA 1D5AA 2ETXA 4BRZA 3STYA 3RBVA 1HYEA 3CM0A 3Q3VA 4Q3LA 1RIFA 2QDOA 2X3FA 3IGFA 4ALKA 3NFYA 2AOXA 2Y99A 2PBFA 1VQ5F 1JR3E 2H4ZA 1N25A 3GFPA 3QLUA 2ZT5A 4MICA 4ZZ2A 2CJWB 4XA8A 3RVBA 3WSTA 5K2MA 4BFWA 4LRTB 5K3FB 3IIJA 4P54A 1OFGA 1JPVA 3AV3A 3S1SA 2EZ4A 2BOVA 3QPDA 1WHTA 4DCCA 1W0JA 4YCSA 1CQPA 2AC2A 3OZCA 3H84A 4J1TA 4PPYA 2Z9CA 4GW3A 3CH7A 3QI2A 1IN1A 4DLNA 3U7JA 2CBGA 2BM1A 5H80A 1GG9A 1E2GA 3S70A 2A86A 2OCHA 3VVLA 3W5DA 4BWFB 1T9GS 3ZEAA 1UOOA 4RKQA 4I4TB 4L87A 2QZ4A 3W7XA 4HUQA 5J2UB 2FXIA 2ORWA 4DSTA 3TRKA 5JD6A 3K1ZA 2I9KA 3KVVA 1VFPA 3GUUA 1JZSA 1I10A 2W6NA 3ESRA 1IB6A 3DEHA 4TV8A 5EE3A 4DDMA 3VR5H 1JY8A 3OLYA 2W2LD 4MAMA 1QHFA 3W9BA 1CRLA 2QD1A 3BHJA 2Z6UA 3GHZA 4CODB 4DLSA 3BPSA 3PV0A 1N0NA 1J2JA 1I14A 2DPXA 1EVYA 3AEKA 1NW3A 3D6TB 1R2QA 3GRVA 4KQJA 1NJSA 3S2YA 1TCCA 2DXIA 2K1EA 1GVNB 1CR6A 1YASA 2P9HA 2YVAA 3FYUA 3L9XA 2C8LA 3R3HA 4TMKA 3LPNA 2CUTA 3K5MA 3PN1A 1Q12A 1WE2A 2A06H 3JY6A 3WLMA 2GM4A 3J7AC 3TW8A 4A0GA 5CDTA 4RADA 4J2TA 2VP5A 3E3LA 3GUHA 3O93A 4P9PA 1MEEA 1IY0A 2QORA 3IJRA 2BGUA 4IINA 3IAS6 4LY9A 3FF4A 3I4FA 4PAQA 4XKJA 4MUIA 2I71A 3BMNB 3ENWA 5JY1A 2VK4A 2QMUA 2WBLC 5FWXB 3NJ8A 1YAJA 3EQ6A 1H05A 5F9MA 3K9AA 1DC6A 4MZDA 5EMKA 5EJ8A 2ZR0A 2DWPA 3B6MA 2YHUA 4I4CA 4UU0A 4EEKA 4HMOA 4FPPA 2RK6A 3ZH9B 1UOQA 3P9IA 4E22A 1GL3A 1W85A 4F9GA 5I4IA 4MITA 2YV3A 5JZBA 3K70C 4ZHWA 2DR2A 3T06B 2LBTA 2PT5A 4PG6A 5BMVA 4BBPA 1ZH0A 1P2FA 2RCVA 2QLNA 2AHYA 3D0QA 2O8EB 1M7BA 4D9EA 4MV7A 5GADl 3K8ZA 4JL6A 1H9BA 1K68A 1O3YA 2GT1A 3AHDA 2ZG6A 3SIWA 4ZTZB 1XNQO 5LZ8A 5FUWA 3TBKA 4R9SA 3V2GA 3FNQA 3EGXB 3OZAA 1KR2A 4RELA 2PMDA 4RMGA 2G5GX 2HS4A 3HJTA 1X70A 1VLLA 2EP7A 3TLYA 4IVQA 2GCGA 2E75B 1CEZA 2VJOA 1R37A 5GWXA 1N2EA 1UPAA 2VLBA 1OJLA 3FYEB 4DV6B 1UFRA 4LYFA 4TKUB 5EXTA 4U39A 1FFDA 4IIYA 2DPMA 1GXSB 5IZ4A 5KVAA 2HEGA 1JDZA 1SUDA 4DG9A 2ODNA 2RC6A 3EW7A 5T8KC 3CRAA 1JLLB 2NTYC 5DM1A 3I52A 5FO0A 1QIKA 2UYKA 1F20A 3IAM1 5B8FA 2PUAA 1GCIA 1QH1B 1C1DA 3VOTA 4Q7LA 4B62A 2OE2A 4ALIA 3PKJA 4JH0A 5KOHA 1H5QA 1ZJZA 4DJFC 3KJHA 2CHEA 2JJ8A 3O1LA 4B4VA 4B7AA 4ZGWA 1EN6A 4OHOA 5CB8A 1UKYA 2ZTMA 4PSVA 4B8WA 4BO5A 1TQ2A 5E7IA 1XD8A 2CFOA 2RK4A 4LQCA 2QUBA 1RYZA 3L84A 4R31A 4BB9A 1DCFA 3SQWA 3SYAA 3FETA 5C93A 3WLRA 3GJ6A 3TEMA 4FCCA 5DBGA 2JJ2G 2N74A 2UZHA 3OW2U 1C7EA 1W2HA 2ODWA 1M2GA 2R6GA 5DT2A 4ND8A 1ORTA 3VI4B 2VAPA 3P8ZA 3WRYC 3HKCB 5DHSA 2O7SA 1C2TA 3FVTA 1PQUA 3OF2A 4M9RA 2OO3A 2ZJ6A 1SZTA 3VKHA 1R1DA 4HEQA 3H9CA 1LI5A 2RG7A 4QD3A 1GD1O 4YO8A 1K5PA 3N70A 3QX8A 3L01A 2H9YA 3CC4V 1CUIA 3QG5A 3WP0A 1IZ3A 1QM5A 1Q43A 4Q1AA 5TV2A 5K3BA 1SCIA 4CEHB 1XZFA 4ARZA 2IJHA 3KAKA 4HX2A 1T0HB 1K6JA 4OHPA 3R0QA 4DIOA 3U16A 3VRHA 1FKAO 1XMJA 3V9PA 3WK6A 3VNUA 4E2WA 1DIBA 4ZU6X 2K87A 1N77A 3R5FA 4BVSA 3D8TA 3ZJZA 5A9TA 3VKVA 3AKZA 3OQOA 3I6IA 3USCS 2FKAA 1TMGE 2HLDA 2PYDA 2NVOA 1HXHA 5BN5B 3TE6A 5GINE 2GLXA 2VH1A 4KIJA 5LUBA 5F3RA 3LC1O 1JLMA 2VZLA 4X8AA 3P27A 3FKSD 1PJQA 1YE3A 4IEFB 3WLFA 1KH1A 5C1DA 4H9GA 4E51A 3KQLA 2HPZA 2AIZP 2P90A 2ZRLA 5SYMA 4D9NA 2CEAA 1YB6A 3L70H 1AUVA 1XZQA 1J23A 4LF9O 2RGBA 2RHBA 4MWTA 3OKFA 5GVRA 3QELA 2H5LA 1R0KA 3GLFA 1M66A 2IIVA 1CZUA 1WDLA 3IA2A 4LC1A 3KCNA 1KO7A 4QNRA 2J3DA 2G1UA 1HZZA 3U1TA 1F2VA 4ERXA 1IE3A 2HUNA 4FYKA 1MHPA 1ZNXA 4KIUA 1I2AA 1B2LA 4II7A 1XAIA 1EVZA 2B4YA 3PXXA 1DQNA 3K57A 1WXFA 1O77A 3R1IA 1I4TD 4YCDA 4G0MA 2X77A 3K03A 2YOFA 4F3RA 3DCNA 1AZLA 1Q0UA 3I12A 3SJUA 4J41A 3MUNA 2NU6A 1YS1X 4EPTA 1OCEA 1HSZA 3I34X 4EW3A 2GWHA 3AJ8A 3EIUA 5KJEA 2H2WA 3KWFA 2CFIA 2XOKD 4WDQA 1A8HA 4C30A 4P3PA 1MX9A 5EJ2A 4YUXA 2ZRPA 4FW8A 3RNLA 2R00A 1R6DA 3FCXA 1Z0DA 4MQ5A 5TE9A 5DNDA 1SBIA 5CT8A 1ZI8A 4QGBA 3R7BA 3TAHA 2VJNA 3F5SA 3L0PA 2WLJA 1G55A 3DNFA 3HABA 3ZCRA 3EZLA 1T1JA 4FZJA 4HBGA 2AI3A 4J6EA 4QVKA 2QM8A 4CG3A 1U2DC 3SICE 3UMYA 2WA4A 1NX6A 2FEWB 3G0DA 3OMAB 4WERA 1G3QA 1GNSA 3KETA 2HFEC 2ZUCA 1IEXA 2H54A 3DH0A 3EYWA 4S24A 1VQVA 3BREA 1TLFA 4P0QB 3VNVA 2HRYA 5GINC 3QKSA 4AUEA 2FHPA 2Z1NA 1WMFA 4AXBA 3MCVA 1PE0A 4CQMD 1DGSA 4NYJR 1OBVA 1JCHA 2FZLA 2JLCA 4YCMA 5FWDA 1YTUA 2GN1A 3SHVA 2I80A 3OCYA 4BRSA 2UYQA 3IFSA 5HRUA 1G20E 4ZGGA 3RA6A 2XE7A 5ALKA 2E6KA 5AXDA 3NAZA 3CYOA 5LLSA 1NG9A 2PZGA 3DZBA 1A95A 4C03A 1GA4A 1U97A 1M34E 3TXSA 3CUSA 3HN2A 3BGDA 3BEDA 4K1LA 3UPDA 4L3OA 3ZHVA 5G4KA 2ZSIA 1E1QA 4YJ2B 2O2GA 2Y1FA 2YVUA 3MELA 3MLEA 1QYXA 4HWTA 1XBIA 1NBME 2CFRA 1T2FA 1XJ5A 1OREA 4HWOA 4LISA 2FX2A 5AQEA 5H82A 3UYLA 3WDKA 3ABIA 3CE2A 4Q16A 2A9OA 4K5QA 1L5RA 2XKKA 1DBSA 2OTJV 3BXEA 1HO3A 1RHJA 2W2KB 2EFDB 2XCQA 4R3UC 3QVUA 1WCYA 1IATA 4OVKA 2ID8A 4JHXA 2WA3A 4MVOA 1P5ZB 2CFCA 5KYXA 2IQIA 1P77A 2O3JA 4L27A 5KNDA 3HO1A 3DC5A 3VHLB 3E9DA 3WB2A 1P7PA 2BGRA 2P5SA 2I8LA 5H0IA 4M0LA 3IKTA 2GYUA 5CW2A 2Z83A 5L3CA 1RI3A 2ZUWA 4Y0NA 3UH1A 2ZVDA 2KX7A 3PXCX 2CLSA 2YS8A 4ZQCB 1I4EB 1NDQA 4BMXA 1RXSA 3HGMA 3LXRA 3DDOA 1AR4A 2QAGB 3I83A 4WNAB 4X93A 5TPWB 1DEHA 2ZM6O 1RZ3A 1AROP 1CLEA 4INPA 4KX3A 4MOWA 5DHFA 4X8LA 3MWYW 4UCSA 2ETNA 2H63A 1XTJA 3HM2A 4I1YA 3PDCA 4RFVA 4ESEA 5B6JA 3HH8A 5ELXA 4TZTA 3HHPA 3OTIA 3PC3A 1LSUA 4G8CA 2XT9A 2I65A 4ALMA 1G59A 3QWBA 4DNXA 5HK9A 3ONVA 5C8YB 1OSNA 4HWPA 3TNJA 1YCDA 2ZETA 5IKOA 3KJQA 1I7DA 1PK7A 4JT4A 3O1HB 2G63A 1BNCA 2OO5A 2AXTZ 3QXJA 4BIZA 4Q3KA 3AG1B 3L72H 1A2BA 1FQJA 2NVWA 3COPA 4LX8A 3U0BA 3BSSA 5LWHA 2JJ1G 1TM7E 3ZE1B 3CWQA 5CJPA 3WICA 2VHWA 5IZCA 4MWEA 4C21A 1Z8NA 2HIGA 2X13A 3EXEB 3JVUA 2HQBA 4OHMA 4PR3A 1OVGA 4F3NA 3BG5A 2HWKA 4Q19A 5DO9A 4D3FA 4CT5A 4FLVA 1LSSA 2NV6A 1YZYA 1Q0HA 2VHXA 1QU2A 3GFQA 1IXZA 1XX6A 1AJNA 1XT6A 2H1RA 4R41A 5EO3A 3SNHA 4G0VA 2A7WA 2J0EA 3CLUD 3O3NB 1DT9A 1M6HA 1Z39A 2CY0A 1UBCA 3PHBE 4ZAWA 5IT9A 3PLAE 2GVZC 1P1BA 1YS4A 2QQ0A 1Q5PA 4OL9A 3RIGA 3PLRA 3QMPA 5JT1A 1WS6A 1Q6HA 4A1OA 1PQYA 2LCFA 2XGSA 2I6RA 4LECA 4M7WA 4R6WA 3JQAA 5K3FA 3ZBPA 2PSHA 4O2BF 4CV0A 3FFAA 1VBFA 3JXEA 1ZC4A 3ZVRA 3VTKA 2EJVA 4FCWA 4O2AA 3PJGA 2WW8A 2K5UA 3ICXA 1U0LA 1H48A 1BFKA 2P9GA 3HJGA 4LGMA 3IHKA 2FMIA 4ZQHA 5ULLA 1D2DA 3QO5A 1L7AA 1Z4OA 4J0HA 4U7PB 3UO3A 1YUBA 3DXYA 5CHEA 4A5UB 4TRMA 5JRZA 1OH6A 1IBSA 2FYTA 2WV9A 1WXGA 2J7KA 4C8GA 1V5GA 4I0XB 1KBOA 4XVRA 1NUQA 4BO4A 2MU1A 1QGAA 1O0CA 3EOBI 2IYUA 1SBCA 2MJLA 2G5PA 4K03A 3NTVA 4CLEA 2B78A 3AB7A 4RD3A 3DC2A 1DTWA 1D0VA 3P4UA 4NEHB 2G1KA 3ETHA 4QJBA 3EAQA 4BGVA 5B1EA 2BRUC 1ISRA 2EFEB 5P8WA 4PLFA 2FUG6 4REQB 3EZ6A 3LWDA 2HHHO 3DF9A 3KD3A 2VC2B 3UHJA 3VOSA 1GUFA 3FXAA 4AIRA 2P4EA 1EWVA 4KO8A 3E9YA 2R6DA 3G7UA 1JG2A 1VJ1A 2C54A 2VJLA 3IL2A 3ZY4A 4GF5A 4BP8A 3DC6A 5ALJA 1YZBA 2ZPAA 3AP1A 2PKQO 2YR0A 3EDOA 3WLLA 4B6PA 3EIFA 4R2JA 1WNSA 3QOXA 2DP4E 4Z4FA 4Q4HB 1AOXA 3JVVA 3R8XA 3VR5D 1MORA 3NOVA 3WQRA 1W94A 3NONA 5BN4A 4MWSA 1DRWA 1L6IA 3F5QA 3SI7A 3SEZA 3D5TA 4G23A 1CUXA 5FTMA 3V8PA 3BWYA 5JZVA 5JSYA 1F7VA 1JJBA 2ZRHA 3KVOA 4RULA 3ICCA 4OJNA 4ZC1A 5CN0A 3TVTA 2DLNA 3LYAA 4I2VA 2XADA 1L5OA 4MB2A 4YP0A 4IMJB 1JIQA 4FQ8A 2C94A 4A6XA 3A3OA 4F2PA 1X7XA 1E3TA 1QONA 4KFCA 5EP4A 1QVFF 5AESA 5T57A 4GZLA 5KTYA 4EI9A 1XJWA 2GA9A 2OOSA 3ABQB 2P6YA 4NXNO 2JKVA 4YFVA 2P35A 2AG6A 2FJPA 1YDXA 1NW4A 4FHEA 1KI6A 1RHKA 4JP3A 3DHWC 2QY6A 3PBKA 2I6TA 4JZGA 1D7AA 5TGZA 1Z6TA 4Y2HA 4MEJA 2GXAA 4RAIA 1CUAA 3WGNA 3ACCA 4C89A 5GV8A 4CGYA 2OHFA 5EZQA 3DHEA 3HBAA 2W71A 2Y8EA 3RAGA 1V7CA 1ABEA 1JKIA 2V7PA 1CZNA 4CQLA 2Q2VA 3PJFA 4KQXA 2O8FA 3ANXA 1R0SA 1XZPA 2QTVA 3DNMA 4W6ZA 3WR5A 3GTZA 2J5RA 3MGGA 3ONWA 2V55B 4G01B 4LMBA 1NONA 1LUAA 1XIVA 1CR0A 2VN8A 4OB6A 3AVXA 2R25B 4F71A 2Q9UA 4AXXA 4CH3A 3HEMA 2I54A 2VS1A 1VEWA 4V3BA 3EVAA 4XDYA 1P7WA 3K0FA 3WGIA 2WWYA 3KHNA 3MWKA 4NE2A 5ICGA 3DEFA 2NYVA 4H08A 5LP6C 1SCNE 1KK0A 2HWXA 1ADFA 1URPA 4QTTB 1CKEA 3BB4A 4WNYA 1XEFA 1Q81H 3VAZA 4CDNA 4Y2QA 4YUWA 3AUKA 1J0BA 1IOZA 2H3EA 2WVAA 4LJYA 3T5GA 1Z0UA 3C3AA 1JU4A 4AKIA 1XQ9A 1R15A 1KJWA 1OLXB 2XITA 4ZZIA 1OBHA 1G2QA 2OBMA 4G25A 4N48A 3GCWA 3I61A 2V0CA 3WNDA 4U8GA 4AQ7A 3NYWA 1N5RA 1N3IA 2CLKB 2IKQA 1Q92A 2W37A 3HG7A 5DSXA 5U4XA 2JGUA 3WK8A 1KNQA 4DQUA 2QWRB 5IFLA 4IYIA 1R6VA 3FHOA 4NRDA 3RVMA 4J80A 5JAZA 4E2YA 4WDRA 3TW6A 1BIFA 2M1XA 2Z30A 3L0ZA 4HPWA 2PNJA 1XRGA 1OX4B 2UXCB 3RRZA 4O2BB 3F49S 4L15A 4N5IX 2P9ZA 3WYGA 3KVNA 3C6MA 4ME6A 1HFEL 3JQ9C 3TTSA 2CNWA 2P5TB 3P2IA 4N18A 3AINA 3F4LA 4LRSB 1SG0A 3WFJA 5IH7A 3SIXA 4HQOA 1YSCA 2RGCA 1YIDA 4FNOA 4FLZA 1XZJA 2OV6A 2C5SA 4CUZA 2X7XA 1FDSA 1G5HA 2GZLA 2DR3A 2CCJA 4YAOA 5B4UA 3J80A 4NTWA 2I2BA 4X90A 3TR0A 3VDNB 5B2FA 3NHUA 3PS9A 2D7CA 1MXHA 3IT1A 4RVCA 3UN1A 4WK0B 2SKCA 4QNNA 3IAM6 4EARA 3E8XA 5J3JA 4ZYLA 1CERA 4JWKA 1E79G 2F17A 2FW0A 2WTBA 4WWHA 4Z4GA 3FTFA 4WINA 1XQWA 4TMWA 5CFZA 1R50A 4MA5A 1NXSA 3UWMA 1IZ9A 2QL5A 3ZDQA 1G6KA 1IU9A 1AXEA 2A1TS 3RVJA 3ABKB 1HEUA 1OTYA 2PO7A 3EQ8A 4L4RA 3FOBA 2HP0A 5D5PA 2AFIE 1HE2A 3L04A 4GPD1 3CGGA 1NG1A 4OI2A 5JAPA 1A9YA 5IJ9B 1XU7A 1G8GA 1TUBA 1GPWB 3SYNA 2BD0A 1FMLA 3G89A 1JOYA 1WKCA 4EGQA 2JA1A 3IVXA 4A26A 5JS6A 1J9ZA 1IM5A 4NYJQ 1BT8A 1JQEA 3FPEA 4DEYA 5MGBA 1G8PA 1JG7A 4X64O 2C03A 5JDIC 4C4ZA 3BCSA 3IVGA 2GAJA 1XRJA 1ZCFA 4Q21A 2CZQA 1SIWA 2ZSJA 3K12A 1QO0A 1TZCA 3OU2A 5BWNA 4HZ3A 1V96A 1ZH2A 1NGSA 4MS2A 5C8YA 3T4EA 4XDJA 2QWOB 4FFBA 1CLIA 4ZREA 1GSIA 3ZP7A 4Z0PA 3ZHTA 4N39A 3HNOA 4EHKA 3GRUA 1W40A 3FNRA 1GT6A 3I39X 2FNAA 2POCA 4P32A 2V7VA 2W7TA 3IP7A 4UULA 1UFQA 1AQJA 4JI8B 1IV2A 1KGSA 4MK4A 3DTVA 3FNHA 2C5GA 2D5IA 4KFTA 3VH3A 5IVHA 1O5TA 3QJYA 4GLLA 4PSCA 1RBQA 1D4ZA 1YR1A 2AN1A 4QWMA 3P32A 3IAEA 1S2OA 4KR9A 3U3XA 4LJ5A 3TWOA 3GLIB 1E6UA 3S40A 4IDBA 2JJ2D 3AF2A 1JJAA 1M9NA 1R6BX 1PGJA 2JJ1D 3F46A 4G36A 1U8AA 2VQSA 2I67A 1U63A 3L0YA 1JW9B 3FTDA 3LW7A 2EBFX 2XOXA 4HRXA 4BRWA 5FNVF 3ITNA 1J2RA 4CN8A 4D3ZA 1WB7A 2GV9A 5INTA 5FIUA 1HG1A 4G24A 2W8ZA 3STVA 3WYAA 4DV4B 4F4HA 3HRKA 3PFKA 4POOA 5IMSA 4Y30A 4RHUA 2O8NA 4JB8A 5IYZB 4LCUC 2CF5A 2LRHA 1ZBQA 3TXXA 2NW6A 4OEHA 2AFVA 4G8JA 3M84A 3B12A 2BIFA 3N8IA 2EP8A 2ZSBA 3EWNA 3OQVA 5CNJA 5ER6A 1YK1A 1YZTA 3CUEF 4ZYXA 5HM8A 1E5VA 3WLHA 4JUCA 5IMBA 2Q4DA 4F4CA 4A6PA 1QJ4A 4MRVA 2I7DA 3ITKA 4E3WA 2QLFA 3PC6A 5ITZB 1E1RG 3EXHA 3GLGB 4EIWA 2BCEA 2Q27A 4RTPA 1WU7A 3IR9A 1M1YA 1RI2A 1Y5NA 2JFQA 2J3LA 4RUKA 5DCUA 5DEDA 1HFWA 1HDXA 2X1HA 3HYCA 3D2CA 1M2FA 3GCZA 3QVGA 4C4WC 1ZI6A 4KQHA 4KV9A 1M0TA 1Q0ZA 3JR3A 1E2FA 2H00A 2A6PA 4L22A 5IPFA 1MUUA 4OBXA 3KCXA 3Q7EA 1KQOA 4F3CA 2CAZC 1NMEA 4D2IA 2HMUA 2XUAA 3HJCA 5CCBA 1AM4D 1TT5B 3CH5A 3ECAA 1ZISA 4GPIB 4EYQA 4GMGA 3B38A 4M38A 4F4IA 2XGGA 1JXQA 2JBWA 2OBLA 2FFRA 4G27B 1DX6A 3CPWU 1C0KA 1UJ6A 1EGQA 1OLXA 1U8TA 3ABOB 3HE3A 3KJIA 4Q3EA 4UXIA 2KKWA 1TUEA 4GI7A 4AD8A 4DLVA 5J47A 3BRCA 1DG9A 1YITV 1BCSA 1I1NA 1ISPA 1UPTA 2BCGY 3NJ4A 3H7AA 3O75A 4FSHA 1OASA 1UMDA 5AT1A 3PUHA 4TLBA 4W6QA 4HNGA 4IZOA 1PJZA 3N5CA 2K7ZA 1XRSB 3K70D 1N2HA 5AVVA 4YRSA 1C3LA 4FGWA 2GPAA 3T7EA 2X9NA 4R5HA 1MO6A 1Z26A 3UO8B 2R7AA 2NU7A 3FOEC 3BH0A 1CUBA 1LSJA 4BEJA 5FL7D 3GNSA 5F7OA 2H4YA 8MHTA 3PUJA 3ZIAG 3CYQA 3KPYA 2RCYA 3QVXA 4OKIA 3OQ1A 5HMLA 3EC7A 1HWYA 5I7AA 3SX0A 3G9XA 3SZLA 3RK0A 1W5SA 3WGYA 4QKQA 3RIEA 3J81M 4D9CA 1VBMA 1JJ2F 3BAZA 3K6KA 1H8EG 1SOAA 1IK4A 4ZI2A 1VSUA 4FB4A 4G5RA 3EXIA 1AI5A 3TAUA 2UVDA 3NU1A 5A6SA 1FYWA 3WA7A 3LL7A 4DTIA 5A4JA 2AJDA 4AY2A 1VH8A 1J8MF 3BCUA 5ALTA 1CUEA 4E2ZA 3WTBA 3HJUA 3T3IA 2I33A 3ZHOA 3ERNA 2Z1TA 1TO2E 3T34A 1OD6A 3TEJA 4RC9A 1RU3A 1D2GA 3L1IA 4NK5A 3WNVA 3ZHCA 4GBJA 3L7QA 1H2FA 2FTKE 2I4MA 2XD9A 3HMQA 3TG2A 4M98A 3OUFA 2HIAA 5EVCA 3UC9A 2AKYA 4H3VA 4DBZA 4EHNA 4PLYA 5G3ZA 4CIVA 1HNZO 3CLKA 4AY4A 1PD3A 1PTJA 1J0AA 2C9BA 2MYTA 2PY6A 3H05A 2H48A 3SQOA 4JAAA 3IMEA 1ZNWA 2G17A 1S5JA 1SXJA 4IO1A 4HDSA 4RJKA 5FWYB 3NC1C 1GO0A 3B2NA 3KHKA 3LL4A 1FYJA 4W63A 1YR6A 1X9HA 1FRZA 4BNGA 4I9NA 5H4GA 2R6FA 2O8CB 1YIJF 4NCHA 3LPCA 2GEBA 2IYWA 4A6DA 2XXAA 2NMVA 2B5WA 4UATA 1TK2A 1PLLA 3BILA 1WCWA 1XMQB 1DXHA 3LVFO 4ND1A 3KFLA 1J00A 4HGZA 4QNMA 3RROA 3RRFA 9LDTA 3W2TA 3HVUA 2FSIA 1Z63A 3K9NA 2BMVA 3P9SA 5AK3A 1AQNA 2LV8A 3UAXA 3U1BA 3EIEA 4HQ0A 4B46A 2WJGA 5D8DA 4RUEA 1ZIPA 2CK3A 5AHOA 4B09A 4W8GA 1HUQA 3GAAA 3H4TA 2GJ4A 2B7LA 4JJFA 5ALDA 2QA5A 3V4RA 3EEOA 3J81N 3H1FA 4L8YA 3NHFA 3PX3A 3Q41A 4H7FA 2C5AA 3CNLA 2I4RA 1ORWA 1PJ3A 1Q3KA 4Q6WA 5DKFA 4ZQGA 2P7IA 4D0NA 3K6SA 3W2EA 3HPQA 3FDJA 4GBMA 4HYTA 4PBRA 1D5NA 3ZR4B 5DGDA 3AHHA 4CRWB 2Q6KA 2Z6VA 2W70A 1M67A 1RHQA 5CVVA 3QY0A 3FSGA 5KHLB 1RSOA 2VRWA 1HY3A 4KWCA 4GUAA 4LIPD 3GYQA 4BDTA 1UKBA 3NPAA 3IFXA 1E79A 1Y1SA 3L8YA 2JA2A 2PG3A 4MAFA 4QHSA 4B3IA 4E0BA 1EUDB 3WQQA 4DLTA 1W30A 3V55A 4X60A 4BO7A 1YGYA 1BXZA 2O6HA 4HDRA 4O4IB 3I42A 3OC0A 3SYKA 3ZDDA 3AFIA 3G49A 4ND8B 5KSOA 1C0PA 5TQ2B 3C87A 1NTRA 4BCBA 3E8SA 4ND6A 3TL6A 1L8QA 2J9GA 2WK1A 4ZOAA 2W2NA 1I3MA 1YB2A 2YIDA 2XWQA 3A28A 1MOFA 3QQ5A 3Q6IA 5JHHB 2GASA 5FB3A 3J7TA 5TR9A 3A9VA 4CR7A 3GGDA 4IR7A 1Q57A 5AVZA 4H3SA 5BSUA 4RGBA 4EENA 5J4HA 3PFWO 5B3JC 3CHYA 4BE7B 2GM3A 1W0CA 1RRPA 3O38A 3UQZA 4KU4A 4TT3A 3DZDA 3BYQA 5TJ9A 3UK2A 4BFXA 3CBGA 3TO5A 3MGAA 4IOJA 2ZWOA 4J7CA 2NSYA 2QVGA 3EN0A 3EUAA 1FXSA 1B42A 1AUXA 2QYSA 1RE0A 4O1HA 4R2IA 1KIFA 1GFZA 1H2RS 3ZDEA 3ANYB 4CR6A 3ER8A 1JHMA 1SEPA 3IHTA 4UMVA 5ELMA 1M7GA 2FWNA 2ZJ3A 1MDFA 1QH9A 4KXUA 3ZY2A 2BCCH 3WMXA 3E18A 4KUEA 2VI5A 4TKVB 1YZLA 5HF8A 1LLCA 3WFIA 5FPYA 1SFRA 5SICE 1AN0A 2Z01A 1GQFA 2ZUBA 3EGXA 2ZQZA 3GFFA 1SUSA 2VYVD 3QV1A 3QVOA 4QQNA 1GZ5A 3OEED 1FLAA 2WTXA 4C6HA 3M6IA 3EG9B 4BUJA 5EIBC 1IQ0A 1R0ZA 2Q9AA 3MJVA 3GRKA 2PX3A 4DDUA 3RVOA 3GLGA 4RIEA 1ZMOA 1FVOA 2KPOA 3EIOA 2QP4A 5J5VA 5FL7G 4B6JA 1HNXO 1EXWA 3EVEA 4LF7O 2ZYIA 4C0QC 2ZWVA 2VDUE 2A5GA 1X7OA 4KWIA 2IV3A 2M6KA 2BHSA 4YRQA 3V33A 4M8NE 1R8JA 5DDIP 3GFVA 4HLQB 4ZC8A 5JTUA 2GPSA 3GFOA 2BSKA 1S89A 1VKOA 3NH6A 3QKWA 1K73H 2GD0A 3IKMB 4RD2A 3IP9A 1SKAA 3AEKB 4J0CA 4AROA 5BR4A 2WMOB 2WWWA 2CXUA 3KJGA 1ODTC 3IP8A 2IBTA 1SC3A 2FXVA 5D51S 4X94A 5DTRA 2DB3A 2BFDA 2F90A 2IIPA 1GUZA 1RYBA 3SZUA 1LW7A 3A7EA 2Q62A 3E23A 4C5BA 3PI6A 5KTTA 4GIBA 1SCAA 1JS1X 4QE9A 4I46A 4LCEA 4N21A 4GT1A 1U8YA 4OPAA 4LVOA 3R7WA 1FZTA 2UU9B 3NEPX 3PIRA 2ZI7A 3RHTA 3GWOA 3T5BA 4C0SA 2WKRA 5JHGB 1Q15A 1C0IA 1J2YA 3TBFA 4BLWA 1BXKA 4GOLD 4XWYA 1R12A 3OSUA 1F2UB 5IVIA 1G64A 4YALA 4DPMA 2BFFB 2PV0A 2Q07A 4LOAA 1CZRA 4JI3B 3W7UA 5ARDA 1V9PA 3ETGA 2QEQA 3FDZB 4KK3A 3ZW9A 5IN4A 3REGA 1JQJC 1TUBB 5ITZA 2VSNA 4TYYA 1KNXA 2LW1A 1K2VN 1ILWA 1Z3CA 3DR3A 4C6TB 4YCCA 2WUEA 4YJDA 1OIWA 1M6VB 1XZDA 5KYKA 3IEIA 3NHWA 1NMUB 1C7FA 1EFPB 1JVNA 1TM2A 2ECQA 2LUOA 1U99A 3E58A 4IVNA 4TXMA 4WNIA 4DOMA 4I1SA 5GZ3A 2JFOA 1VJTA 2CCGA 2CXTA 3BZWA 4ABYA 4HV4A 4RTNA 3S0YA 1SXHA 3AGPA 2HR1A 4GCZA 3K08A 2AFIA 2AMFA 4AN4A 5E38A 3CYPB 2ID4A 1FJHA 2X4LA 2XCLA 3EFBA 1MEOA 2HIMA 2XUFA 3DYBA 3H5TA 2FC3A 3BMQB 3AJAA 4RQBA 1AGRA 5F12A 2ZPTX 4CM9D 5B3SC 3H2BA 4XUEA 4LNHA 2BSAA 3HKEA 2A59A 4MMZB 1WZNA 5C31A 4A0SA 2I2WA 1G18A 5LOVB 2IJKA 4QZVA 2EL7A 2OV4A 2V98A 2XHEA 4Q39A 1B3BA 1QQ5A 1CUCA 3O91A 5EWJA 1ULSA 5HKKD 2COUA 4ZPXA 3T95A 3FUUA 4KI7A 2JAXA 5JZOA 5ESRA 1XPOA 1FXUA 2Q4EA 2I3GA 1XHZA 2OB1A 3E3MA 3HDHA 3EQ7A 4OLFA 4XJSA 4QPJA 2O4UX 2A9HA 3EDQA 4BNFA 5IT9M 2UZAA 2QKYA 2SNIE 1I7NA 2DYKA 1GN4A 3HR0A 1AQ6A 3ELBA 5KQGA 3TGUH 4UEWA 3LUGA 3TLBA 3ML1A 3ORYA 3AMVA 3QFSA 1FL9A 4OGKA 4XDHA 1GH6A 2FYUH 1OIXA 3R6TA 4KWTA 3AONB 2GD1O 3LFUA 2X0LA 4X1YA 2QLLA 4JMPA 1WDMA 1WPQA 5F1OA 4FX5A 1LLDA 2VBCA 4LZJA 3TZQA 3OZ7A 3QFRA 3B9QA 3C5VA 5F4ZA 2WKSA 3UJHA 3K70B 2GNPA 2VYND 3DXRA 5LGNA 4XWKA 4M49A 1TQHA 3MUOA 4H17A 1VJCA 3G67A 3V7FA 1P8AA 4CV1A 1O6FA 2G8LA 1Y82A 3HACA 4RJLA 5IC5A 5IDVA 3S55A 1Q90D 1S7GA 3A11A 3N59A 3ADOA 2HRDA 4EKWA 3BF8A 1J5XA 2ZI3A 1P84F 3KQTA 5EP2A 1Z13A 3K35A 3HVKA 2WG0A 4DMLA 1QIGA 2D3WA 3FIUA 2R11A 1EP1B 2BMAA 1MH1A 2H18A 3VISA 4QYXA 2KQUA 2K7FA 2C3MA 1X7HA 2QJ1A 1HX7A 3KWJA 1GN3A 3X44A 5DHTA 4ND4A 2Y3IA 4WZAA 5C9ZA 3AHIA 1DC4A 1R0BA 5DYGA 3VPAA 1U3UA 4FLUA 2C7BA 2Y0BA 4LF5B 1NRIA 2CFTA 5KOYA 2W0FC 3K14A 3ZV6A 5KOJB 5L7TA 2I4NA 5SYNA 3C3SA 5FUVA 2JRIA 3BWEA 3WHKA 4QJFB 4ARCA 1O7JA 4IY1A 2CXRA 3VXKA 1DO2A 1XYVA 1F8YA 4GMKA 4Z99A 5DYWA 4JEMA 2Q9BA 1A32A 2JFGA 4CMEC 1U3PA 2G9NA 5FRDA 5K3EA 1ZC3A 4MVJA 4ZOLA 2ZBDA 1Y6RA 1M1KW 1LXCA 3EH2A 3KVRA 4G81A 1DKOA 1USWA 3UJAA 1XVLA 3CVUA 1TDJA 1WMBA 1QXSA 4JJKA 1PL4A 2O8DB 5ALOA 1JEYB 2G7ZA 3TUZC 3DMTA 2HQSC 1A4IA 1I5EA 1Q0SA 3JYPA 1J25A 1MB4A 1SA0A 2XZPA 1IXYA 3RGGA 3WLSA 5CBPB 1RW4A 1ND6A 1YXMA 3SHQA 3RVLA 5EHXA 2ANBA 4X6UA 2A7QA 4BTVA 1I0IA 5F64A 2XVXA 3IEPA 1J90A 2HL6A 3HU3A 4HVAA 4I8XA 2JCBA 2EKQA 4RTQA 5K2OA 4J7KA 2XBMA 2OHVA 5AW9A 1V41E 1WSAA 4EG3A 4ZODA 3DBIA 1H69A 3F0DA 4JJ6A 4MTGA 1RM3A 1SZXA 1N2IA 1IUKA 2AE2A 3FKJA 1JDPA 1M1UA 4GM4A 1C29B 1ND5A 3NEJA 1SOMA 3TTVA 4AN1A 2ZUEA 4YBRA 3H6GA 1MCZA 3IR7A 1FRVA 2PVSA 4YNBA 1NXXA 3TQRA 3F74A 3MTIA 1VKHA 4I9UA 1DZ3A 3LP6A 4KAJA 3SDZA 4AJLA 2I8CA 1PD1A 2FWRA 1BHQ1 1ZJYA 2V59A 4D4GA 4DV0B 2G38A 3SBOA 4LJRA 1QCYA 3CCRV 5BW6B 3TTTA 2EERA 2AA3A 2VZEA 2Y66A 5EY5B 3FIJA 4JHLA 1OV4A 3WNCA 1Z28A 2VATA 3HB4X 4N7BA 1SD1A 1XZMA 1PQ4A 1NI4A 2CH7B 3Q2KA 1ZNZA 4HZUA 2NZ8A 2IP4A 1GRVA 2FPGA 1OGJA 3WO1A 3N75A 1QS0A 3WL7A 5HGXA 5K05A 1IXBA 3OBIA 3QWHA 2GBLC 5EVJA 1AK1A 2ZFUA 1UBUS 2BELA 3BFRA 1SUFA 2XKBA 1JYEA 3D8HA 3H9QA 2UUPA 3HDTA 3IV7A 4LX0A 3RI3A 3ZPXA 1TMKA 1XHEA 4QOJA 3FHJA 4DR3O 1QF7A 1W55A 4NNOA 3RWBA 2H7YA 3VO9A 1UPCA 4EFLA 3ZWPA 3B6KA 2V7WA 3L6OO 2ENUA 2QW0X 4M9SA 2PRZA 2Q2WA 2Y6VA 2J9ZB 2P79A 2BGLA 2P9TA 3K3WA 4B45A 3MYRA 2YXNA 2Z8YM 4JU9A 4UCXA 5T5QA 5TF0A 4BXOA 1LBQA 2BR4A 5GJBA 1UM9B 5ESDA 5ERGB 8GPBA 5JFGA 4CHGA 3L7KA 4ARIA 1NR5A 1K0FA 1RHUA 3B1WA 1P4AA 1WG8A 3EE6A 4XJTA 3UXYA 4AS3A 3ZV7A 4CM6A 3ORFA 3B89A 5L3DA 1IMOA 2ZYTX 3COYA 4QGGA 3UK0A 2CXPA 1FXHA 1V6AA 3KJXA 4KO3S 5CJ2A 1D2HA 1ZSNA 2BFMA 2C2BA 5C7OO 5JQGF 3AU8A 4N3BA 2YHSA 3N8HA 4KJXA 5HY4A 1RJGA 2GJKA 3HL0A 2HJSA 4NCNA 4ZYUA 4LHXA 1F8UA 3L73H 3RSQA 4XWOA 3FROA 3IESA 2WDZA 1GV1A 1YD7A 2D5BA 3BE6A 3NLLA 3V8VA 1X7WB 3ASZA 4CLRB 3SDSA 5LKRA 4O63O 1YZKA 2B3DA 1KZ4A 4R8KA 5EIHA 1M0WA 4IILA 5JVDA 4QTZA 3RSFA 5IBCA 2J85A 2BHLA 3KJNA 1ZGGA 5IJ0A 1DLJA 3AESB 2VJAA 2HRBA 3CF6R 1BN6A 1IHXA 1B0PA 3A1VA 1QZXA 1YCFA 2DFVA 3EWIA 3FUVA 3NWEA 2V03A 4GRIA 4DLUA 2I6QA 2ZINA 3U9LA 3HC7A 4C0LA 1JECA 1POWA 2XHZA 4NZOA 1Z16A 3CRQA 1KXZA 3FPCA 3Q9SA 1V5WA 3ED1A 4OXQA 2ZBFA 1G4HA 4AZ3B 3M1XA 1ENVA 2KW5A 3H6HA 1WMEA 2VT3A 3NORA 3TZLA 2VHCA 3UYKA 2Z04A 4I4TA 1IY8A 3OPNA 4RZ3A 2XOEA 3BOSA 1RCTE 3G5UA 4IAOA 2Y4NA 4J3FA 3PPIA 2ZOSA 2F95B 1DE0A 1KO1A 2IZZA 3MT9A 4J0KA 3WYNA 4URVR 5EWMA 4R7TA 2G72A 4KPGA 2IYRA 3CYFA 2KB0A 1K5SA 4UE3S 2CZGA 3LG2A 4OHUA 2AK2A 5TS2A 1G38A 5AO9A 4W5QA 2E6UX 1M3SA 1AZSC 2FK7A 3QX3A 3WL5A 1E7WA 2V8BA 3G4SV 2K2QB 2W2OA 3WIVA 3ZU5A 1U3LA 3RBXA 5B57C 5IT4A 2IUYA 5TSDA 2F1KA 4CGZA 3KTAB 3B85A 2AX4A 2IEAA 1ZKDA 2VFAA 3T4DA 4J9UE 1DXQA 2Q6VA 4WX2B 4MVZA 3WGMA 1ZGJA 2L0XA 5DNAA 4WOCA 5HIJA 4XQCA 2ODPA 3H1IH 1UFIA 3VBBA 1R9JA 4U9IS 5JS7A 2B4QA 1YS9A 4WCFC 5CA1F 3I9V1 3AEYA 2UZ0A 3MFQA 2YWFA 3NDBB 4MYCA 3HWUA 5GW7A 3CSUA 2GFIA 1Z4MA 3QE2A 1U1GA 3ZHXA 2JGIA 3FVRA 4C4AA 2CYCA 4JI4B 1R88A 4GUDA 2HMVA 4MWDA 3R8CA 2QXUA 4Q3DA 2WJWA 3EGWA 4H37A 4LXYA 2PTHA 3OMIB 3CZAA 1BSVA 3ND9A 3PE3A 3AWDA 4BQFA 2XQJA 3C3TA 2PIDA 5KAFZ 3WMWA 2J0QA 3RGBA 3P9YA 4Y2XA 3BDIA 4B8YA 4Q4AA 4GDFA 4QE3A 1QP8A 2ZRAA 3C9UA 3KKMA 1EUDA 3NHJA 4XVCA 5JOQA 2CN1A 3IQGX 4PC2A 1UDCA 3STLC 4D9FA 5DCVA 2YQZA 3IGAC 4BNHA 3P4EA 2CK3G 4KP4A 5KHAA 3A06A 1I2MA 2FX5A 3C9RA 4G1CA 2W8BC 1XNRB 3BD7A 4R81A 4XDGA 4DNOA 3AFMA 3E6AA 3HU5A 3RJMA 4X3MA 2P7HA 3W6NA 4UFZA 3PUZA 2OYRA 3IT3A 2Q3MA 3H2KA 3U62A 4BZXA 4LH6A 1NVGA 2OO5C 2R6CA 4XYBA 4K46A 5ESWA 2PQMA 4EF5A 2GN6A 2H59A 2I29A 4C3VA 2F66C 4KHPO 1J07A 3QBTA 5T64A 5EG5A 4MINA 5KTNA 1H2YA 4A1FA 3MBKA 4OHZA 2NU9B 3HB0A 5A5FA 2F43B 5AP9A 1N0JA 1XJCA 2AQ8A 3AG2C 2DCUA 2VO1A 2JLUA 3T3NA 1CYDA 1NFFA 1R74A 1PWHA 3ED5A 4JUAA 4X6YA 4TKLA 4CV2A 4EUKA 3SQXA 1GCOA 5SZKB 4IZ6A 1OTHA 1T4CB 1U0NA 4PSKA 4FLFA 4LY3A 3LDUA 2HU8A 1A9QA 3PRYA 3QPCA 1A5ZA 5HE8A 1CEYA 1R10A 1FYXA 2IPNA 4F60A 5I7WA 3FDIA 2J0UB 1DELA 5I47A 4Q48A 2EKPA 3E1KA 1Z8DA 4M7OA 3LRPA 4EBBA 2IBZH 2B21A 3IEMA 4IQFA 3M2PA 3RTEA 3OH8A 2WKWA 2HMSA 5AM1A 3LUHA 3P2MA 3B40A 1OT5A 2DZDA 4Y2YA 5K4AA 4FHDA 2B2NA 2ZM5A 3MPUA 1VZ2A 3STUA 4ZJUA 1WCV1 2QE7D 3Q7RA 4MHSA 2PH3A 2O2DA 3DTNA 3LUJA 4HDMB 1IDN1 3ZV5A 2OQRA 1S6YA 2XYHA 1O5OA 3QOWA 1F38A 3FWHA 2WYVA 4DT1B 4DW1A 4BPBA 4MHTA 1GTMA 5K8JB 1SVIA 1VKZA 1ZK0A 4FM0A 4CMJA 2X5KO 3OCVA 2CNLA 1B2RA 1Y5LA 2PKCA 3IIIA 4FDAA 4KIFA 3WZLA 4OLHA 2ILMA 7REQB 1WA8B 5JSQA 4IIJF 4Q02A 1CJSA 1SERA 1SR8A 3OE7G 1OU4A 2DR0A 4JK3A 4NDNE 1ADYA 1PYDA 1UK6A 3VAYA 1RI4A 1X8LA 2PXXA 4JF3A 4QJ5A 4BFTA 2WALA 2P69A 3OQNA 5GJWC 1XDZA 1VLQA 1ECJA 2Y2UA 3CX6A 4MR8B 4I1OA 4K6CA 4KODA 5DX8A 2NP6A 4JBWA 2HSDA 1DC3A 2WHEA 1LR1A 1TT7A 4A8JB 2ONZA 2XB6A 4FFRA 5G0VA 3LA8A 1DOZA 3SCZA 2XH8A 4OQMA 3ZTTA 4NVPA 1V8OA 1JN0A 4OU5A 5GTHZ 4QBFA 3V6MA 1T5BA 2AZDA 4HTFA 2MSKA 1FSSA 4Y6GB 4C05A 3FB7C 1RABA 2DWUA 1IQRA 3PVZA 3E9EA 4NU5A 5A5GA 1J7JA 2IZ5A 4JEHA 5GV7A 1YUMA 3WLAA 2R66A 4TMFA 1A8QA 1O4WA 2REOA 2DUMA 3JQ6A 1MKYA 2VGMA 1NMQA 3L82B 5AWFC 2RHDA 1II8B 1ISSA 1X7YA 4BIIA 1MGOA 2EWMA 2WF9A 3FBWA 4JI6O 1XALA 2EFCB 1PFWA 2QG9A 3DDWA 3KT8A 1V8BA 3KYCA 3ZUGA 2ASVA 2BTEA 1NF3A 2LDXA 2YIMA 3E2MA 4QUDA 3SR2C 4YJKA 2CTPA 1PRYA 2IH3C 2JLQA 2QSZA 1JT9A 2HVKC 1HFKA 2IZ6A 2WICA 1P5HA 4U2EA 5EA2A 4INOA 3AERB 5CXUA 4BW0B 1LU9A 2R86A 2WTEA 4FUQA 3ZOZA 4FYWA 5MN4A 3F6SA 1GWNA 2L69A 3JWEA 3UH0A 2WB2A 1F17A 4E4RA 3IBCA 5U4QA 3NDIA 4UNRA 3LTNC 4J4BA 1DC8A 4BU1A 1FJXA 4M9CA 4PLWA 3TEFA 3QNWA 2QRVA 4G41A 2JBAB 2QD3A 3CXRA 3QY9A 3B52X 4M46A 5JRDS 4I1PA 4KBGA 3WHPA 1IK6A 1R3DA 4FZ0A 1WA5A 3C41J 2O9JA 1DFGA 3C6XA 1XCMA 4MYUA 5DOVA 1EVQA 4I55B 5LMZA 4C7OB 3CINA 2I87A 2F3QA 3O21A 2RSLA 3QVLA 4GPTA 1N5DA 4TS1A 4XVUA 2AXNA 3TZEA 4FUTA 3U3RA 4NICA 1B16A 2Y71A 4WKGA 1TCUA 4UFOA 5FLKA 3HPRA 4QL3A 3EPKA 3VBCA 2Q9LA 4URFA 1EVEA 3CX5F 5BRJA 1X77A 1E0KA 4YR7A 1C9EA 3E8FA 3MWLA 4YHHO 3AR9A 3QLVC 2XMDA 4QOSA 1O8BA 2FPIB 3C8MA 4F72A 1NYQA 4F84A 4DJTA 2LO1A 4N4AA 3X2FA 2V9PA 3GVPA 2QRMA 3ZE8A 1QBGA 2AQKA 4OG2A 5KDLA 3VX4A 2MMGA 4M1EA 1NI3A 2M6YA 1UJWB 1FNNA 4WI1A 2QDXA 4CTMA 1NUSA 2YVKA 1VM6A 3G0HA 2EBWA 3R6DA 1XPJA 3LFTA 1TTPB 1OI7A 3PGLA 5JBIA 2Q49A 1G5TA 3OQ6A 3OWHA 2EBHX 2J8ZA 4TRNA 2ZB8A 2WHRA 4PZ0A 5AKEA 1Z5PA 2Q6TA 3QPBA 4I19A 4BFZA 5ICMA 2CDNA 1U0BB 1G6UA 1W4BA 4JVOA 1M34A 5DGTA 3U31A 1LDYA 2GF2A 2BKUA 4WLFA 3RODA 3IMCA 3BGIA 1GAJA 5BQPA 2G25A 3UFBA 1T3GA 3WDSA 2QMQA 3BB1A 2JB9A 3H9GA 3IO5A 3BVOA 3M2TA 5AD1A 2GETA 2G71A 3OMLA 1SRRA 4H60A 2PD4A 1R9MA 3TI7A 3FYUB 4L0QA 2AGVA 3UAOA 4MRPA 4UE2A 2PZ8A 2HDNB 3ZP4A 1O6GA 3P0RA 3JAKA 3PNLA 4TTJA 1DFHA 4C0JA 1Y4MA 2JGEA 3OCWA 4CEJA 3I3FA 1YJWF 2B4AA 1R4MB 3WXBA 3VO8A 2CNWD 1NURA 1H8HD 4N5MA 4P84A 1L4BA 3RE1A 4AG3A 1X7GA 2ZXWC 4DBVO 3AIIA 1KNJA 4KJZA 1TO6A 3I2YX 2Y77A 1KDYA 4BVJA 3KSUA 2B1GA 3N0WA 4KFUA 3PQ3A 3B20A 3CZ4A 4XARA 3ZMZA 4MQEB 3ZD8A 4DXHA 1VA5A 4DF3A 3OICA 4WECA 5A0VA 3TRDA 3OD1A 5J1SB 3M0EA 3SC3A 4V1CA 2JATA 4NNJA 1KYQA 5MDHA 2XUMA 5IYZA 1ECCA 5HSGA 3MG9A 3MUEA 1GJRA 2HK7A 3WGVA 2EKLA 2EULA 4L0MA 1EXVA 4V1CI 1BU5A 5CT9A 2YH2A 2C98A 2NNWB 1P7BA 2CGNA 3FLBA 3F6EX 4QYMA 3ZDCA 1H2KA 3ZIDA 4E14A 1SQ6A 5JECA 1Z47A 1IXRC 1GK9A 5FD8A 4UDNA 3OEHD 1M34B 3OHMA 1U3GA 5C1OA 1KK1A 2ZU6A 2RONA 5AJUA 8OHMA 1BXRB 3EX7C 4KR7A 2YBEA 2PLWA 4KH1A 4O4JF 4EP1A 4JVMA 4K26A 4TN1A 3G71F 4YXWD 2DHDA 1TGOA 4YJ3B 4DV3O 4HGQA 2UU9O 1RD4A 5I9NA 4UV8A 3B53X 4XLTA 1QIEA 4WIAA 3T61A 3N6RA 1U11A 3BMNA 1RXIA 2C0CA 3AW9A 3ESBA 4QPPA 1KS2A 4RKYA 3VFDA 5IJWA 5EHZA 1K8AW 3TD3A 1DC5A 1OXTA 1EB8A 3QUWA 2QROA 4S3MA 5B2EA 3KEMA 3PQ7A 1YTFD 1OBCA 3JAMM 1PBNA 4MV1A 4DAOA 4YMHA 2V6JA 1VQ6F 1X1AA 1I3LA 1WF3A 3KJEA 3MWGA 4D81A 1L9XA 3C3PA 3ZJ4A 3DJYA 2EX0A 2GHTA 4ZDWA 2W5UA 3F90A 2JFUA 5U1PA 5YASA 4Q3OA 3NK6A 3BRWA 4MIOA 1DXOA 5EC2C 5I7HA 2D8AA 3DT9A 3DZIA 1IHPA 4LDZA 1JWAB 3SGIA 1SKVA 1NP3A 3ZW7A 4ZT7A 4RH0A 2LP7A 3DMFA 3LUFA 5K3CA 1KQPA 3FPIA 2NXJA 4P3KA 4UUQA 4CLDA 2FU5C 4RSMA 1G3RA 2CMHA 1XCOA 2PUGA 2WP8J 4JNCA 4I6EA 2FW6A 3O8OB 2E74B 1CS0A 4G8BA 4NCJA 4QT4A 2BPOA 5LP6F 2X7HA 2EJCA 2OESA 3F97A 3L5KA 4QDKA 4PA9A 4OJTA 4TWRA 5B1DA 4B32A 4I7ZB 2YXHA 3ZJVA 4F4DA 5J2TA 1LSOA 3E89A 1V0JA 1FEZA 1L7VC 1UIRA 2HSEA 2OFWA 3SYQA 2TMGA 3CRW1 4LJAA 3CSSA 3ZK9A 4PCAA 5EJ6A 2Z58A 3AT1A 5DNYB 3B4SA 2BP7B 2FRDA 2WF7A 1SVNA 3G5MA 4I5EA 1N33B 1LFDB 2QWQB 1SB8A 4LDRA 4RS4A 1PV4A 2Q41A 2XUHA 3OKPA 4LEIA 4AJIA 3AB3A 2P11A 4OV6B 2QW1A 1JEQA 1L5WA 5K3AA 2AXPA 5AHXA 1FFBA 2P5YA 1YDMA 2YNMA 5I45A 1KAGA 5LB4A 4JV5O 4JI3O 3WBKA 3BKWA 3W7AA 4CCWA 4PNHA 1ZEMA 4A0RA 1J1ZA 5AKHA 3O83A 1P2TA 2GX6A 4O2AF 3AY0A 2PUVA 2AOTA 3I53A 4O5AA 3TLCA 3B1KA 3ABTA 4UCRA 2GS9A 5BSHA 1BS1A 2XCSB 1TJ3A 3D0OA 1MJGA 1EFAA 1K06A 4GWKA 5HGJA 3DHVA 3UBMA 2YQ4A 3I28A 1U0RA 3ZIUA 4A8JA 4EMTA 4ZYVA 1OXBB 1ZM2A 2KGWA 1FFXB 3VC2A 3CHXA 4U63A 1XVIA 3TK1A 1GPBA 1EDBA 2CWDA 3DPUA 5BOVA 2ZBRA 1AB3A 4OLJA 3MIIA 4YXWA 3TSWA 3W90A 4B71A 1C8BA 2C5HA 4D99A 3ADBA 4QGFA 4TKZA 3RFXA 4E15A 2GM5A 3HVJA 1A2OA 2QTWB 4XCVA 3LE8A 3UICA 1NI5A 5MGNA 7MHTA 2Z4SA 4S0XA 5CYOA 4UVAA 3MDOA 1BKDR 2FR1A 2WA2A 2D13A 5LDDC 2R87A 3H5OA 4JJIA 1ZSVA 3OUTA 1QK5A 1XMSA 2G9IA 2ATVA 3G2HA 1W88A 5CVJA 2QKSA 3PNVA 5K01A 2R1TB 2PMWB 1JDNA 2TMYA 4H1TA 1T2VA 5B1OA 5TPZA 3QX7A 3VYUC 3KQMA 5E0KB 1W1UA 4M1MA 1XNQB 1Z0ZA 2W22A 2XAJA 4G1FA 4I99A 1KEPA 1VPDA 2HQRA 4L16A 3T4XA 2J4DA 5L3EA 1JALA 1KVSA 1MRZA 2ZXUA 1U5BA 2BGKA 1W0KG 1QO7A 5BYAA 4RUFA 2HA2A 3FTPA 1IQPA 1LKZA 3SIVA 1HM5A 3GNQA 4Q00A 3QVSA 1U8XX 2HMTA 3GUZA 3OZIA 1S8OA 1PP4A 3BMQA 4CQLB 1WVGA 4DANA 1J2TA 1Y6GA 2B33A 3HKBA 3HZZA 1SC5B 4OA8A 1PD0A 2PEYA 3GYGA 3IPYA 1RCUA 5FP0A 4WOPA 2WYWA 2VSFA 4FFDA 4CMHA 4F4JA 4BKMA 3G7SA 2BCJQ 2V7BA 3F6PA 3P26A 3UMMA 1QQAA 1ZQ1A 4WGFA 3T3GA 1UUFA 2DJ5A 2ZULA 3R9WA 1WW3A 4MS1A 1IPAA 2R5FA 4YCBA 4NBKA 4RX1A 3ETCA 3ZOKA 2X0DA 4LQDA 4GKBA 1CY6A 2PA3A 1QV7A 2FFBA 1TYBE 3RA5A 2WWTA 3CKMA 4YROA 3UENA 3W9YA 3W3AD 3BK2A 1AI6A 1JBQA 5KCZA 3SFZA 1CNFA 4PG4A 1RC0A 3E7DA 2PCLA 2Q7EA 1D4FA 1L5ZA 3OLQA 3OQPA 3I8OA 1GRRA 3K5HA 3DQPA 3AKCA 4YJGB 2JFFA 4XM0A 1A50B 4DR2O 2C3OA 1KKDA 3G85A 1ISJA 3N2KA 1H8EA 1KECA 1X0VA 1XQ1A 5FV4A 3UXEA 4EKDA 3QO8A 4J1TC 4PFKA 1NVWQ 1NHWA 1DL5A 1RI5A 1N6HA 3WK9A 5KNDD 1U2PA 2J9FB 3DE0X 2BMEA 4C2UA 3CVJA 2HFKA 1N9KA 3AEUA 5DE3A 4RETA 3O9ZA 2QMYA 3CD6F 5FNVA 5AI4A 5C5IA 3SX2A 2RHMA 4R2MA 2FEMA 3MWDB 1F0YA 3ES9A 1ORIA 2V1DA 4FFMA 5HK8A 5HWEA 1T8TA 4PD4F 2GHRA 4QLAA 4MQUA 3UB3A 2BFAA 4RWUA 2NXEA 2R1UA 2WJ4A 1GPMA 1VP9A 2E1PA 3NCHA 3ZMTA 3U4IA 5EERA 3W6ZA 3OX4A 1AK9A 1M1YE 1UBRS 5FPHA 3RW0A 2E4XA 3KB6A 1ZX1A 3KE9A 2LCQA 4V1CB 5IJZA 1QJCA 2FQYA 3CUKA 4JKOA 1TW3A 4B6RA 3TD6A 2MR6A 4DNPA 1Y1RA 1M1NA 4LF9B 4JLAA 3E5HA 3ZWDA 3OTGA 2F3TA 5JPCA 3IEQA 3RUPA 1I08A 1Z4NA 4IIJA 4BKOA 3UPUA 3NEYA 4HSEA 2PMEA 4GXNA 4FHFA 3R65A 1PP9H 2VDOB 3CZRA 4NULA 3A4TA 3E8MA 3EEYA 3ZLJA 3CMAV 1VQ8F 4BQOA 5CDSA 1XTZA 4FOPA 4P2BA 4ZYTA 1ID8A 1T10A 2XMRA 3TTYA 2WAAA 5HJ7A 3CC2F 3ELUA 4WLNA 4EABA 1A5AB 3OIUA 3VYUB 1BQ0A 1B23P 2XNDG 1F0PA 1YZHA 1M2KA 1U1IA 3GMTA 1AQIA 3GXBA 1OBFO 1A76A 1DHRA 1DI0A 1S01A 1P4GA 3C7DB 3I64A 1C30A 4MTFA 2B1QA 3C3JA 1DJLA 2JLAA 5EMHA 5A5EA 4PFQA 2ZF8A 4P33A 3E83A 1BW9A 5GM2A 2KQXA 4YRJA 1CNEA 3CUTA 3W5HA 2DY1A 2BTUA 4XRRA 4N76A 1EGHA 1XV2A 4LYHA 5AJWA 2X0NA 3D4LA 4CETA 4PU0A 1ZRNA 1WTCA 3NBFA 4N6GA 2JIMA 1WKBA 2H07A 1FRNA 2Q2OA 1ESEA 4F91B 2PH5A 4JLMA 2COEA 3N27A 1H2BA 1HLDA 2CBZA 5AVQA 3O47A 2OZKA 2LGJA 4LZAA 1WIWA 1NF2A 2BR5A 2A88A 3EZ9A 1ZL8A 2V9CA 4JLUA 5JVDB 4C6SA 3C6YA 4KGXA 3JWPA 4BTLA 3ESAA 1DKPA 3UBTA 5KYUB 4HRAA 1MQ9A 5KNCH 1JU3A 5DI3A 2X7JA 3ZEDA 1CS4C 1VE9A 4A8JC 1NN3A 1J20A 4M8IA 4RJTA 3I05A 4C1BA 1GR0A 4W8HA 4EX7A 4F8JA 4DV2B 1CUYA 2ZI6A 4TSKA 3AG6A 2IPMA 2ZJ8A 1AUPA 4IEEA 4LUCA 3VMFB 2IYOA 5K8TA 2C96A 4PYOA 3H0CA 3SYPA 1HDYA 5KAIZ 3GLUA 1UBEA 3V46A 821PA 1B41A 3GLTA 1OWLA 1EUYA 1YQGA 3A1SA 4R1OA 5C4MA 3G2KA 3WQSB 4B3SB 5G4UC 1JAIA 2V3CC 1VQ4V 1Y76B 1D6MA 2H1CA 3I1FA 4UCFA 3CCLF 5IARA 3V7WA 2CVOA 3TECE 4IUDS 1UJMA 2LQTA 2NUBA 4EY8A 1IJKA 4CH5A 1KU0A 2H1WA 3AEIA 1WULS 2Q99A 5K6AA 3CCCA 2G4VA 4B40A 1I4OA 3ZWNA 2IF2A 3W5CA 4K0RA 1X19A 3N2YA 1F7UA 3A6ZA 3RUIA 4B7ZA 8ATCA 1JD1A 1DKUA 3AGQA 3P97A 4NG5A 5LCXA 4RY0A 4IV5A 1GOTA 1X13A 4JELA 3DUFA 1JX9A 4OY3A 2IITA 4R9NA 1ONOA 4G0WA 4RPCA 4WJKB 3L1JA 2C4UA 1KDVA 4G28B 1U7TA 3CLTC 1RPTA 4AYWA 4TUYA 5DASA 1CV2A 4TTVA 4RF5A 1GNPA 3KOMA 1BJTA 1XA0A 3DWEX 3JQQA 3N28A 5ER9A 4AS2A 2Q6OA 1L5SA 2ORYA 1ESDA 2VDWA 4L5YA 3LUDA 1W88B 1B1CA 3ZU3A 1IZ8A 2LBPA 2X9GA 3L7NA 2WMDA 4MYDA 5HP7A 1FS4A 5BQ5A 4XWAA 2QW8A 2AVDA 1QHIA 1KJZA 1Z18A 3AF5A 3K73O 3PGJA 4HDQB 1PSZA 4X20B 1Y9ZA 4MVJP 3VR3D 3WAKA 2GEUA 3ABMC 4FBGA 1GQQA 1P81A 3M1AA 5G0TA 2H2FA 1ZIYA 5GP1A 5HZHA 2HVYD 4ZIBA 4HJRA 2EATA 2BEJA 2OTLF 2B35A 3NCTA 4PO8A 4AP6A 4Q7EA 2OSVA 2IPXA 2NV2B 4FHGA 4PZEA 1XB2A 3A25A 4Q9JA 1P91A 5LZ4A 5LIRA 5FOVA 4I3HA 1WBBA 5GANK 1I2DA 4K3UA 1PJ4A 2FQXA 3MQWA 1IMJA 4PR0A 2QX7A 3E2PA 3PQ5A 3RD5A 1LK5A 1S3SA 3AR6A 2X2FA 3OUZA 3QO7A 2J87A 3EF0A 4G5XA 3EVDA 1QF9A 4IP0A 3VDQA 3EGCA 4PZLA 1SQGA 3VQWA 1RMQA 4F1KA 5IBQA 2NM0A 3UKJA 1DSSG 2QV0A 3AFHA 1KK2A 1U96A 3R3UA 3COJA 3VH4A 1XE3A 4GFDA 2D0IA 1ZXLA 2YIBD 4TV9F 4AL4A 4JPRA 3OTQA 1VRWA 2RGYA 1PJ8A 1RM5A 4NWOB 1JGTA 4KL1A 3KSMA 1VB3A 2C7GA 2PGAA 3A6LA 4R51A 3V2UA 5K6RA 9GPBA 3S2EA 4D9KA 5BSFA 5K0GA 2GKGA 1W52X 4W8OA 5EIFA 1RYFA 5FUYA 2Y05A 2AUMA 4NV3A 2X6BA 2YC4C 3OECA 1O94D 1VQ8V 3CMAF 2CVQA 4IT5A 2UZ1B 5U9CA 1PKEA 2JI9A 1S7CA 2PGDA 2VNJA 3HN6A 4OU4A 1ZOIA 2OAEA 5BSWA 4I5SA 2PGNA 3OTHA 5F9HA 2O48X 3IKFA 2FB9A 2JVJA 5EIXA 3ZE0B 2IYPA 3PE6A 3FAVB 1T26A 2PS0A 3T7JA 2I3AA 2PU5A 1YFLA 1SK9A 1WPRA 1P1CA 4KX5A 1QAQA 2AW3A 3OFNA 2G6BA 1RWMA 3GD5A 1MB3A 3MDSA 3P3NA 1E2UA 1P2DA 2YYZA 3G9UA 3VR4D 2VZ8A 1U40A 3PRHA 1D1SA 4ZCPA 1KYVA 2CE4A 2ZWIA 3DLTA 1VIVA 3R3YA 2F3UA 3UJ6A 4XIFA 3UAZA 2QRZA 2XYGA 3PQEA 2EJRA 1OBOA 4UEQA 5JANA 2BGGA 2CLDX 4FT2A 4DMKA 2PLRA 4BIMA 3SWWA 4A0HA 2W2PA 3NPMA 1G98A 1Z34A 1S8FA 2WLIB 3VTIC 1GCUA 5F1KA 2HCBA 5AK4A 4B5CA 4M21A 4W5WA 4DV1O 1J95A 1N9ZA 1NBIA 1AHPA 2ZJ1A 2IVZA 3QSYA 2O8BB 2LKDA 4A2WA 2JFZA 2PLFA 1EWQA 4RQAA 3HXPA 4NQRA 3QFFA 3JATB 3BGWA 2XPCA 4JI6B 2YW2A 2ZSKA 3MTJA 4C87A 4ARZB 4F2HA 1USUA 2BKEA 3ZMVA 2G9ZA 2RB9A 5CX1B 1H8ED 2KWIA 3BK7A 2EW8A 3PZRA 4MJ3A 2XUJA 4RM3A 2WKQA 3NTOA 4MTXA 4REMA 2FUG1 3LFOA 1ONIA 4NQZA 2NUAB 3LCVB 2ERYA 5JADA 2E48A 3DGEC 1OLOA 1PGNA 3M83A 1AKVA 2O2ZA 2WWFA 3EA0A 3U7EB 3MD9A 3HKCA 1Y4UA 4HADA 2F23A 3V8QA 3S8EA 4CU5A 4RTJA 1SQBH 4U7TB 3S02A 3G1UA 1ZPDA 3B70A 4GE0A 4RD4A 3VHXA 3ZDXB 1N8SA 4NF2A 4PO9A 4DUZO 4H4EA 4UNNA 4AKSA 3BD6A 4Z7JA 4E31A 2J7PD 3TSCA 5CEEA 4E46A 1NS1A 2BUAA 4MS4B 1KMCA 4OX9B 3KUKA 3A1WA 5FQOA 4P4LA 4BVFA 3IAYA 5KDDA 5CNMA 4AILC 1KE2A 2GLZA 2R1VA 3I72A 3M33A 1ONNA 3EPHA 4NOMA 4MQEA 3U3JA 2QA4V 4JOBA 4FZ1A 5EXPA 1L7RA 1QGZA 3SJCA 3A05A 3L7BA 4KN5A 4G5FA 4PZZA 2Y1EA 3G23A 3MTDA 1CQZA 3MJFA 2R8RA 4ZQFA 1CE8A 4KUGA 2NNUA 3RREA 1YDGA 1FFWA 4ZEOA 5ALMA 2C4VA 2WP0A 5HCNA 3RAEC 3QH4A 2ODEA 3RF6A 4ED9A 3HA5A 1R4NA 4X8HA 2MSLA 4IHJA 1IY9A 2NP7A 1R6NA 3JAKB 3G1WA 4L4UA 4OK3A 3UV3A 5F2NA 3P5BA 3OFKA 3PB3A 3SQMA 2Q8PA 3HFRA 1CDZA 3O26A 3NNSA 5HJ5A 3QHAA 2DYRC 3TZHA 2OGTA 3R5XA 4RTMA 3GH1A 1NIJA 2VRCD 4PRZA 4YB8A 2C2AA 1Z75A 2Y9PB 5F2EA 5KX5A 4EBFA 1MRNA 1GL9B 4IHAA 1HTWA 4MUNA 1V43A 2J32A 1OYWA 4ZP1A 2RAVA 3UT0A 3JASA 2NR5A 1WEKA 3A9UA 1NH2D 1IIBA 4N8SA 2OLKA 2YW9A 3A3YA 5D3ZA 2N75A 3Q88A 5A4DA 2OAP1 4OFXA 4WXPA 1E6EA 1T1GA 5EPUA 3VHXB 3LXUX 1LTQA 5HIKA 1ULHA 1ZH4A 3D6FA 3PNBA 4N5NA 5DYIA 1VYUA 3S0JA 4EUHA 4F4FA 4D0SA 3CIFA 3DGFC 5B55A 5C81A 4JQZA 1DAFA 2Z3WA 4I55F 1U3DA 1E32A 3N4ZA 1KE1A 3SIPA 1VGQA 4OFZA 6ABPA 3FAKA 4JN6B 2PHNA 2BGMA 3OLXA 3FR7A 3Q3JB 5BSKA 4TZ0A 1B15A 1CUGA 3TXQA 4M1SA 3RN4A 3HI4A 4L5IA 5EN4A 1B6SA 4W1SA 1EK0A 3PQFA 4I4IA 3VU8A 3W1EA 1CUSA 3CZPA 2XJ4A 4CIXA 3WYEA 2AXQA 3EARA 1YRYE 3HZRA 4XB6B 1WJZA 4BWGA 1VQ4F 1IVNA 2ID9A 3IKJA 4Y2RA 3QKUA 3C7CB 2IVFA 1GQRA 1B74A 1FPOA 4WHMA 3RYCA 1FTSA 4QPDA 3WKEA 2XYPA 1T0PA 2NZWA 5K0JA 2LE0A 2DEUA 1L5VA 4W5JA 5JAUA 2ZTLA 1UXHA 4FZ5A 5AJZA 4R68A 4NB5A 4YIPA 4MEBA 4Q1FA 5CLIA 4QGAA 1A9OA 2JIPA 5K8LA 1K3UB 2CEKA 3ZGZA 3FB4A 1SKQA 1KF0A 1G8MA 2QVZX 3ELWA 3NWOA 1WZEA 4L76A 3TJMA 4DN6A 2WD8A 3PE4A 2SKEA 4PGAA 3LQRA 4B3TO 3SDLA 1GPNA 5I7EA 3TQCA 2FOXA 3ZX6A 3MC1A 4FYMA 1Z82A 1R8XA 4U3JB 1YJ9F 1SWWA 3O9VA 4GI5A 4RD6A 1A8IA 4V0OA 2VOEA 3FGPA 1Y3FE 2AE1A 2AUNA 3AVOA 4U1RA 3VDRA 3FOCA 1SQQH 4X88A 1UM9A 2QT0A 1LGYA 2LIPA 2BZ0A 4LGCA 2QRPA 3A26A 4PLVA 4IDNA 1UC5B 1NJ1A 2OBFA 3DOUA 1FLNA 4RS3A 1V48A 1U3WA 3ZGLA 3K5IA 3JD2A 1EU1A 4YIKA 4ZT4A 3BM5A 1JLKA 1XLTC 1X2EA 3I6BA 4BBAA 1M73E 1RVV1 4WL0A 3CCFA 4KAFA 3VV3A 4C6RA 3T2MA 3RV3A 3WGLA 2PK3A 4BFYA 4OMUA 2XWSA 1ISFA 2R1ZA 2MYUA 1Z2GA 2JEXA 1JHYA 3D4NA 3ZGXA 4Y2TA 2CNDA 1IZ0A 4KIWA 3STHA 3IP3A 3VR4H 4BWAA 1IY1A 1WSDA 1PNQA 5CDYA 1E1MA 5IUKC 1YC2A 3GZNA 3N74A 2IYEA 4K9MA 5TVKA 3H1PA 2P4KA 5L6MB 1HEIA 4B17A 2W90A 2H8CA 2AN5A 4UOZA 2GCOA 3IBYA 1NVDA 3CN7A 3OE5A 3ZS8C 1BCSB 4NC9A 4EUFA 1IVYA 1GDDA 1R8YA 4JENA 4UVBA 3W7SA 4FLYA 1MIOA 1OHHD 3MQFA 1U2DA 2FZGA 2X9VA 3RC1A 3U1VA 5IAGA 4WZAE 2N48A 5SYAA 5LP6A 4MWZA 1S4MA 3KM0A 3W2GA 2BEUB 1W4RA 1TM1E 3QGMA 1RP1A 4B73A 2W6MA 1BX0A 3QYFA 3P9NA 4Z1MA 4XR4A 3HJHA 4CQJA 3R9XA 1Y1TA 1U0FA 2X1MA 1EJBA 1N6OA 3PXEA 4JASA 1PG0A 3R0PA 2ZWMA 4BLUA 4UM9B 2C5LA 3G6WA 1SXPA 3Q1KA 3WPWA 5AHRA 3PQ8A 1JA9A 4HAYA 1H6AA 1ZUHA 3NK7A 3UJBA 1RR6A 5KMGB 1KMNA 3NOXA 1JMVA 3QA9A 1MJGM 1K34A 1IEVA 1R5BA 1MX1A 1VMAA 2QMEA 3HCNA 3OQJA 4FR0A 1JYFA 4LSMA 4J42A 4UOQA 4YAEA 3UFXA 5CLFA 5CMUA 3RYIA 2UYPA 4GVLA 3ORHA 1RYDA 1D03A 4BEBA 3ASNC 1VIAA 3DV2A 4KR2A 4WT7A 4MGYR 3WJPA 3ZRVA 1RPNA 1P7ZA 2N3ZA 3Q0TA 5CTAA 4R6ZA 4FEYA 3LKBA 4WFAV 5C0OE 3OQMA 1Q82W 2PSEA 1B04A 1Q6YA 3MCWA 3TLGA 4NPHA 4NBNA 2QZ9A 4F21A 2WSSA 3IEXA 3R3WA 1EX7A 4LRUA 4Q7KA 2QLTA 4QPCA 1CB0A 2QR2A 4ILEA 2C8KA 3CCJF 2VNIA 3A9SA 2KS6A 3NIFB 5M7EA 1XQVA 1T43A 2ZXEA 5FXMA 3U4QB 3QV2A 4NG4A 3UEOA 1A9XB 3C98A 3HB1A 4JBGA 1UBMS 2FUEA 3WLOA 4BZWA 5K0TA 2IHNA 3RVDA 4YQEA 3JW8A 3EAGA 3OIDA 5AOCA 2OORA 2PBRA 1F4NA 4PYMA 1D6NA 3SHTA 4EHBA 2TMDA 4JJGA 4OHCA 1C14A 4HQFA 1E6CA 1R18A 5CFNA 1N33O 4XQEA 3IOMA 3EVBA 5LMUB 1N9GA 4XM2A 1ZWIC 4HXGA 3RKRA 3F9IA 3KHTA 5DVZA 4E5DA 5LJIA 3D6HA 3TPCA 1NLYA 4FYIA 1VQ9V 3OEHG 1WUKS 2BDUA 4KE8A 4ZMBA 1JB9A 1UBOS 1OWOA 1YDWA 2PKWA 4WZZA 2EP5A 1MJFA 1MD9A 2BSXA 3QYAA 4B3BA 3FGOA 1W8DA 1MBZA 2E85A 1TJPB 3K0AA 3MXOA 1EAMA 5GMOA 3H7IA 4OBWA 2YWXA 1TECE 5JMOA 1H93A 7ADHA 4U7FA 2GEJA 1YZFA 3PD7A 2RMKB 1REQA 1E1RA 3DVLA 5LR6A 1PR0A 1UK7A 4GYCB 4G4SO 3U7RA 3HDGA 1V1JA 4MW5A 3SC2B 4N3GA 3T3DA 4DVGA 4DZRA 3T9BA 1VF7A 1ZGAA 4AIIA 4B6SA 5CVUA 1Q7YH 2JEZA 3RVNA 1JL3A 4EKNB 2Y76A 3BRWD 3HBFA 4QC2A 4BTEA 1A2QA 2IIQA 2DWDC 4EX6A 3KEQA 2TECE 3FZYA 2XW6A 4ZCLA 3CXHF 3PWSA 3UAWA 4DMCA 1XA4A 4J9VA 4W7IA 1HNWO 2GHYA 1SUAA 2ZXWB 2MYNA 1P9WA 4MIEA 3PUXA 2F43G 1P9RA 4KYIB 1N7HA 5D3MA 2YZ2A 1DKQA 3DMRA 2CNNA 4LZPA 1UBGA 3LBHA 4IDHA 3ER9A 5DFAA 1VIDA 2GWRA 1TPYA 5DHRA 3LHDA 4P4NA 4UBMA 2GK7A 5J1TB 4HR7A 3GT3A 2DF8A 3GWZA 2BT4A 4MZXA 4F6EA 1D2CA 3AW8A 2GN9A 1DTEA 1W42A 3EQ2A 4XFDA 4QBIA 2JDIG 1Q20A 5IDJA 1KD1W 3U6BA 2RJOA 2PMPA 1JDUA 1UC8A 2YRWA 2ZJ0A 1YZVA 2O2JA 1L1RA 4YH1A 3VIUA 1JEAA 1S2IA 4JTAB 5EKXA 1C3OB 1TW2A 3DWGA 3VMMA 4BJ5A 4RTRA 2FH5B 3A6DA 2AQIA 5JWPA 2I6SA 3ROZA 3WWYA 1LX6A 3X0DA 2GSWA 4I1IA 3SE0A 1FP6A 7AT1A 1ULZA 1Y1KE 2JIZD 1RPZA 1JPXA 4QASA 4TOIA 4YJ2F 5ALYA 4CJXA 3H1LH 1WMAA 3H42B 4HDKA 1AVMA 1XTRA 4JYAB 3N2NA 4CEJB 2SKDA 2ZPUA 1Z7GA 3A1DA 3X1MA 4FFLA 1TKCA 4YP7A 3Q7IA 4MAAA 4CLXA 1H4VB 1LCIA 3QPAA 4RZHA 4G6ZA 1H7MA 3ESDA 4LOHA 5FULA 5H59A 2DJVA 2PM8A 2WHPB 1AKWA 4FDUA 3TW8B 4JI1B 1PV2A 1E2MA 1W3EX 3VYTC 2G5CA 3EWSA 3LT4A 4CF5A 2DPYA 5L4LA 4PIMA 5E9WA 2Q3EA 1YTFB 2JS5A 3EPRA 2NN4A 1RMYA 2MSDB 4MYTA 2CJFA 1V7QA 2QRQA 1GAQA 1NTKH 3TM5A 4MVJI 1RWOA 2P67A 3VQXA 1EM8A 3WP1B 4MRNA 1O2DA 3GHHA 2C20A 4EHFA 3K31A 1E3JA 3UCSC 4PWZA 3HCWA 2BSKB 4OTZA 5DGHA 2DE0X 3SHWA 3FNEA 2ZIWB 1YZUA 2GRUA 3TDKA 2HHHB 3HSYA 4RQUA 5HF6A 4KKXB 2A4KA 2H1HA 2EFYA 4PO1A 3AXTA 4Y3UA 1JTFA 4DNFA 1ZU5A 1QB7A 2CD7A 4GLXA 1NA5A 2OQIA 1GL6A 1YDHA 1P31A 3A4NA 3FCEA 3I04A 3IQXA 3MS4A 5H81A 5ARBA 1IM2A 4P4UA 2HR3A 2DMRA 2IA5A 4YRLA 3LIIA 3ZXUB 2LCAA 3AERA 1NV8A 4JVSB 3H87A 4L9RA 4EUEA 3PPXA 4F56A 5IDQA 1JKJA 1E5DA 2EVWX 1E1DA 1ZI9A 2XLBA 3L7LA 4PA4A 4Q03A 1O4VA 3ESZA 4QUHA 2X8WA 2X6TA 1T2EA 1Y5IA 2ORIA 1T0AA 2PQ0A 2ZUUA 3G6BA 3IJPA 5KOJA 3Q3EA 1YA4A 1S5PA 4Q6GA 1VP3A 1PT6A 2EG9A 2OP1A 2W6CX 1QGUB 4FQ5A 4FX2A 4JXJA 4OXYA 4X44A 4YCJA 4DREA 2QX9A 2O5EA 3GT4A 1T0IA 2DWQA 1A8SA 1GQYA 4NQ3A 3ONDA 3IP1A 4BV2A 5JLJA 4HUJA 5REQA 5BYBA 3DEKA 2R97A 3TGLA 4OBEA 4GNRA 4EA9A 3MJEA 2IYYA 1PZFA 3D7LA 2YCLA 3U3OA 2VAMA 4KKVA 5KJ1A 5AHKA 1H4TA 1YQEA 3T5TA 2AF4C 3DBLA 4KR6A 2NTEA 3OETA 4GUNA 5DGXA 3CWBH 4P4GA 1PSDA 1QR2A 2AMYA 5J2UF 1NT2B 4PTYA 4EECA 3CJTA 2D2CB 3COZA 4AVYA 4L7VA 4G5QA 5BOSB 1Y7IA 2GF9A 3BJRA 2FWBA 3HFGA 2GTIA 3LMKA 4H16A 2W6ZA 4P93A 3JPYA 3ITEA 5HY2A 3D3JA 2V0NA 2Z5UA 5L3QB 1E9EA 3ZYZA 2P75A 3FMOB 3ON5A 2JHGA 4E94A 1ML3A 1T1IA 3HEAA 5HQ3A 1XJQA 3ISTA 1BGVA 1JR2A 4R8SA 3RANA 4JLDA 6LDHA 2R8ZA 2HK9A 5A5VA 1PHPA 4B44A 2L17A 2XEXA 2D1RA 3WBBA 3KO8A 3HM9A 1Y3AA 1EA7A 1TA8A 5K51A 2IWHA 3K5OA 4RDIA 3AUFA 4UQLA 1M4UA 3ZWCA 4JAUA 2H8EA 2BI8A 3AO0B 3B6JA 2ARHA 3FSGD 3GFSA 3NBQA 4WFEA 1EFVB