3IKEA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikeA00
1GX1A 3F0EA 3JVHA 1U40A 3F0DA 3KE1A 3ELCA 1U3PA 1W55A 3ESJA 1KNJA 1W57A 3IEQA 3K14A 1JY8A 3EORA 3F0FA 1VHAA 3IKFA 1U43A 5B8FA 1VH8A 3ERNA 1H48A 3P10A 1IV3A 1T0AA 2PMPA 3K2XA 1IV4A 2UZHA 4C81A 3FBAA 3B6NA 1JN1A 3IKEA 1KNKA 1YQNA 3GHZA 3F0GA 4C8IA 1H47A 1IV1A 1U3LA 3QHDA 3RE3A 2GZLA 3IEWA 2AMTA 3MBMA 4C8EA 1IV2A 3P0ZA 4C8GA 3Q8HA 4C82A 3F6MA 3T80A 3FPIA
chains in the Genus database with same CATH superfamily
2PHNA 4B62A 1PXWA 3JARA 3E20B 3JAMM 3I55F 1KNJA 2ZVYA 1T0KB 4I4TB 3L7QA 3RYCB 3C9TA 2ALEA 1X52A 5HP8A 1SA0A 1M90H 4X1KB 5LOVA 3JALA 4TZZA 3I3FA 1JN1A 3WJRA 5AVMA 4ZHYB 3RYHA 4WBNB 1H47A 4ZK7A 1VQ8F 2AMTA 2ZF8A 1CLIA 1IV2A 5EZYA 1TVKA 3HKDA 3C9UA 4X1IA 2WALA 1W5AA 2HS4A 3JVHA 5IYZA 2HVYD 3U0OA 3NMUC 2OTJF 1VHAA 3V7EA 3IKFA 3M84A 4XCQA 4B45A 4U3JA 5HXUA 1YI2F 1XHOA 2IQQA 3WGNA 1FFXB 3GTZA 3RA5A 2QA4F 3F0GA 3PAFA 3RYCA 2EWCA 3K12A 4BVSA 3CYQA 3TD3A 2VAMA 5JQGA 5EYPB 1W42A 1CN7A 1NMUB 1XV2A 2YYEA 3Q8HA 2ZAUA 1SA0B 3K0TA 4O4JB 3JASA 1Q7YH 1VQVA 2UYPA 3ELCA 3ON1A 1W55A 4I4TA 3S03A 3CPWF 2OTMA 3D54A 4I50B 1U43A 5G4VC 3LWRC 4X1IB 1KD1H 2H8EA 5CB4B 4I55B 1R1MA 5HXZA 4G4YA 5JCOC 4ZHWA 1YQNA 3M4SA 1YIJF 5MN5A 5C8YA 2L26A 1W40A 5KX5A 3T80A 3RYIB 2N48A 5LXTA 2GVIA 3KE1A 3JALB 5J2TB 3JAKB 5LYJA 4IIJB 2RHOA 5B8FA 2GLZA 3JAWB 2RHHA 5HY1A 4YJ2B 1YJ9F 4BW0B 5HY4A 2K1SA 3VYTC 4G4WA 5GONB 3B6NA 2ZVZA 1VK3A 4O4HA 4I50A 2V9YA 4NUTA 1GO1A 3NK6A 3WPWA 3CCVF 3IEWA 4B5CA 1RQ2A 5JH7B 5LA6B 5DCVA 2YXZA 3CD6F 5ITZA 4TUYB 1QAHA 4E6EA 2KTVA 3CC2F 4O4LB 5JQGB 3IEQA 1IPAA 4PWTA 4LNUA 2DYYA 1PF5A 3G6EF 2B33A 4HNAB 3MCAB 3BYQA 4O4HB 2Z1UA 1Q81H 3WGMA 5C8YB 4ZOLB 3CCRF 5EWRA 4F6RA 4BVQA 5LYJB 4FFBA 3HAXD 1VQLF 3J81M 2Z01A 5GANK 1W59A 3FD6A 2I6RA 1GX1A 3HKDB 2CHTA 3E22B 3ESJA 3HKBA 1RA4A 3WPXA 4BT4A 3F0FA 3S06A 2UYJA 4O4IA 5J2TA 1TUBA 4EB6B 1T0AA 2PMPA 5EYPA 1IV4A 2AIZP 5EB0A 4X20A 4BY9D 2CVLA 3FD5A 3S0YA 1QD9A 4DXDA 1Z5WA 1XBIA 2UYKA 3CCMF 1W2BF 1FSZA 5A2QM 2JNBA 4EI7A 3G4SF 2VGMA 3JCMM 4O2BA 5FNVB 1JFFA 2VGNA 2HS0A 4I55A 5IJ9B 1M1KH 1U40A 5HP7A 1JFFB 4RHAA 1VQMF 2Z1FA 5IJ0B 3RA6A 3C9RA 3VTIC 3LFOA 4IHJA 2AIFA 3N2KB 1VQ5F 3K2XA 2BTOA 4EI9A 2CSLA 3RYHB 1UFYA 2LBWA 5KMGB 4G4XA 2Z1TA 1YITF 3MQWA 3VOBA 3CC7F 5HY2A 3HKEB 3V4DA 1N8RH 3S0HA 3F0DA 5G4UC 4B46A 1YJNF 3J7AR 4ZI7A 2VXYA 1ONIA 4BT2A 1QVFF 3P10A 4O2AA 3CCLF 5BMVA 4ZOLA 2FC3A 4C4WC 3CG6A 1YGYA 2QI2A 3N4ZA 1IV1A 1RLGA 3QHDA 1VQOF 3ZO8A 2ZODA 3S0WA 1VQNF 1FFXA 3WGLA 3I56F 4C82A 5GIOC 4O4LA 4BVTA 3JARB 3N4YA 2Z1EA 3DDNA 3N2GA 3HJWC 2UYNA 3WJQA 4TUYA 5MN6A 2BO1A 3LMEA 1Q86H 2BTUA 3WJPA 4G88A 3FFMA 4TV9A 3VI6A 2HRYA 3FBAA 4EI8A 2FGYA 2QEXF 4F6RB 5J2UA 2CHSA 4LNUB 3CMAF 3LDTA 1XRGA 3ZP4A 3GYQA 3F6MA 4BVRA 1TUBB 1QVGF 3FPIA 5EIBC 4R40B 4ZHVA 3CYPB 1W57A 5IT9M 1VQ9F 1VQ6F 1ZWZA 4IHJB 5J2UB 1K9MH 1VH8A 4KWEA 3G71F 3O85A 2W8BC 2UZHA 3JATA 4U39A 2IAFA 5BMVB 4O2BB 5FNVA 3TD5A 3D01A 4X1YB 1Q82H 3RE3A 5EB1B 1W41A 1KQSF 2OTLF 3CCEF 3V7QA 1FNJA 1J7HA 3LWQC 1FNKA 1VQPF 3OW2F 5LP6A 3HKEA 5GIPC 2R6R1 3JATB 4IIJA 4X3LA 3MDOA 2UYNB 1E7KA 1QU9A 1Z5VA 3UT5B 2H6LA 1UI9A 1W5EA 3ZOPA 5ITZB 4YJ3B 3HKBB 3C8LA 2HQSC 5EAZA 2HX0A 3VYSC 1COMA 4LCKA 2OZBA 4TV8A 5MN4A 4FFBB 2GZLA 4U3JB 5FJ4C 4G4ZA 4TV9B 3CCSF 3IMPA 1NJIH 4C8EA 2KTUA 3P0ZA 1W5BA 5IJ9A 3VYUC 5CA0B 1KC8H 3F0EA 2OHWA 3VCZA 3HKCA 3N2GB 3K14A 1K8AH 1TVKB 2RB9A 3I7TA 1CK2A 1SZQA 4O4JA 4BT5A 3NVIB 2HRUA 2CWJA 3MCQA 1VQ7F 2IG8A 3CC4F 4YJ3A 3ZP7A 3KJKA 5EO3A 3CCQF 3CCJF 1W5FA 1X25A 3D00A 3NVKE 4O4IB 1U3LA 3HWUA 2HP0A 4RQOA 4BT6A 4O2AB 5HY0A 1SDSA 5CA1A 1RQ7A 1DT9A 2MQEA 1GO0A 4ZHQB 2LBXA 2VAWA 3C9SA 4ZI7B 1X7PA 3HTNA 4ZHQA 4G4VA 3JASB 3J80M 1H7MA 1W581 1YJWF 4WBNA 3CMEF 2HP0B 3TD4A 4C81A 5EZYB 3WGKA 1VQKF 5LOVB 2I6DA 2RHJA 3CPQA 2CZWA 4X3MA 3VOAA 2KG4A 3CCUF 1VQ4F 1W3EX 1JD1A 2R751 3UT5A 1S72F 5KMGA 4X1KA 3HKCB 5FLXM 3OONA 4ERHA 1U3PA 2NMUA 3OBWA 3EORA 3N2KA 5IYZB 2P6YA 2VAPA 3VMFB 3WGJA 5HWEA 3IR9A 1IV3A 5IJ0A 3LWVC 3CXCF 3PLAC 4NQ3A 3SIUA 5CA1B 3KJJA 2QTPA 5EIBD 5GAPK 4X20B 3V3TA 3OBYA 2CW4A 3AGKA 4TV8B 1YHQF 1GZ0A 4HNAA 3SIVA 1DBFA 4C8GA 5LXTB 1NQ3A 3VO8A 5JH7A 2DT4A 3RYIA 4DRXB 5LP6C 2Q1YA 3KHNA 4EB6A 2F9ZC 3NK7A 2KGWA 2BTQB 3ERNA 3VIUA 1H48A 5JVDA 3LWPC 1OFUA 5CA0A 3S02A 5LP6B 3E22A 5JCOA 3QTYA 3M1XA 3IKEA 3CB2A 3GHZA 4C8IA 2LBTA 2ZOVA 3LYBA 3P4EA 3DC2A 1ODEA 3RYFA 3MBMA 1RLUA 1JJ2F 4BT7A 4DRXA 3LWOC 3JAWA 1K73H 2HS3A 3JAKA 1JY8A 1Q8RA 4BT3A 5LA6A 2LCAA 2HP3A 5KX5B 2Q1XA 3RYFB 3R0PA 3WXMB 5CB4A 1KNKA 5GONA 1OAPA 5GINC 4X1YA 2RHLA 4M8IA 4NWOB 4YJ2A 3KIZA 2H8CA 2G9IA 3QUWA 5JVDB 3E1YA 1X7OA
chains in the Genus database with same CATH topology
1GX1A 3F0EA 3JVHA 1U40A 3F0DA 3KE1A 3ELCA 1U3PA 1W55A 3ESJA 1KNJA 1W57A 3IEQA 3K14A 1JY8A 3EORA 3F0FA 1VHAA 3IKFA 1U43A 5B8FA 1VH8A 3ERNA 1H48A 3P10A 1IV3A 1T0AA 2PMPA 3K2XA 1IV4A 2UZHA 4C81A 3FBAA 3B6NA 1JN1A 3IKEA 1KNKA 1YQNA 3GHZA 3F0GA 4C8IA 1H47A 1IV1A 1U3LA 3QHDA 3RE3A 2GZLA 3IEWA 2AMTA 3MBMA 4C8EA 1IV2A 3P0ZA 4C8GA 3Q8HA 4C82A 3F6MA 3T80A 3FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX1 A;  3F0E A;  3JVH A;  1U40 A;  3F0D A;  3KE1 A;  3ELC A;  1U3P A;  1W55 A;  3ESJ A;  1KNJ A;  1W57 A;  3IEQ A;  3K14 A;  1JY8 A;  3EOR A;  3F0F A;  1VHA A;  3IKF A;  1U43 A;  5B8F A;  1VH8 A;  3ERN A;  1H48 A;  3P10 A;  1IV3 A;  1T0A A;  2PMP A;  3K2X A;  1IV4 A;  2UZH A;  4C81 A;  3FBA A;  3B6N A;  1JN1 A;  3IKE A;  1KNK A;  1YQN A;  3GHZ A;  3F0G A;  4C8I A;  1H47 A;  1IV1 A;  1U3L A;  3QHD A;  3RE3 A;  2GZL A;  3IEW A;  2AMT A;  3MBM A;  4C8E A;  1IV2 A;  3P0Z A;  4C8G A;  3Q8H A;  4C82 A;  3F6M A;  3T80 A;  3FPI A; 
#chains in the Genus database with same CATH topology
 2PHN A;  4B62 A;  1PXW A;  3JAR A;  3E20 B;  3JAM M;  3I55 F;  1KNJ A;  2ZVY A;  1T0K B;  4I4T B;  3L7Q A;  3RYC B;  3C9T A;  2ALE A;  1X52 A;  5HP8 A;  1SA0 A;  1M90 H;  4X1K B;  5LOV A;  3JAL A;  4TZZ A;  3I3F A;  1JN1 A;  3WJR A;  5AVM A;  4ZHY B;  3RYH A;  4WBN B;  1H47 A;  4ZK7 A;  1VQ8 F;  2AMT A;  2ZF8 A;  1CLI A;  1IV2 A;  5EZY A;  1TVK A;  3HKD A;  3C9U A;  4X1I A;  2WAL A;  1W5A A;  2HS4 A;  3JVH A;  5IYZ A;  2HVY D;  3U0O A;  3NMU C;  2OTJ F;  1VHA A;  3V7E A;  3IKF A;  3M84 A;  4XCQ A;  4B45 A;  4U3J A;  5HXU A;  1YI2 F;  1XHO A;  2IQQ A;  3WGN A;  1FFX B;  3GTZ A;  3RA5 A;  2QA4 F;  3F0G A;  3PAF A;  3RYC A;  2EWC A;  3K12 A;  4BVS A;  3CYQ A;  3TD3 A;  2VAM A;  5JQG A;  5EYP B;  1W42 A;  1CN7 A;  1NMU B;  1XV2 A;  2YYE A;  3Q8H A;  2ZAU A;  1SA0 B;  3K0T A;  4O4J B;  3JAS A;  1Q7Y H;  1VQV A;  2UYP A;  3ELC A;  3ON1 A;  1W55 A;  4I4T A;  3S03 A;  3CPW F;  2OTM A;  3D54 A;  4I50 B;  1U43 A;  5G4V C;  3LWR C;  4X1I B;  1KD1 H;  2H8E A;  5CB4 B;  4I55 B;  1R1M A;  5HXZ A;  4G4Y A;  5JCO C;  4ZHW A;  1YQN A;  3M4S A;  1YIJ F;  5MN5 A;  5C8Y A;  2L26 A;  1W40 A;  5KX5 A;  3T80 A;  3RYI B;  2N48 A;  5LXT A;  2GVI A;  3KE1 A;  3JAL B;  5J2T B;  3JAK B;  5LYJ A;  4IIJ B;  2RHO A;  5B8F A;  2GLZ A;  3JAW B;  2RHH A;  5HY1 A;  4YJ2 B;  1YJ9 F;  4BW0 B;  5HY4 A;  2K1S A;  3VYT C;  4G4W A;  5GON B;  3B6N A;  2ZVZ A;  1VK3 A;  4O4H A;  4I50 A;  2V9Y A;  4NUT A;  1GO1 A;  3NK6 A;  3WPW A;  3CCV F;  3IEW A;  4B5C A;  1RQ2 A;  5JH7 B;  5LA6 B;  5DCV A;  2YXZ A;  3CD6 F;  5ITZ A;  4TUY B;  1QAH A;  4E6E A;  2KTV A;  3CC2 F;  4O4L B;  5JQG B;  3IEQ A;  1IPA A;  4PWT A;  4LNU A;  2DYY A;  1PF5 A;  3G6E F;  2B33 A;  4HNA B;  3MCA B;  3BYQ A;  4O4H B;  2Z1U A;  1Q81 H;  3WGM A;  5C8Y B;  4ZOL B;  3CCR F;  5EWR A;  4F6R A;  4BVQ A;  5LYJ B;  4FFB A;  3HAX D;  1VQL F;  3J81 M;  2Z01 A;  5GAN K;  1W59 A;  3FD6 A;  2I6R A;  1GX1 A;  3HKD B;  2CHT A;  3E22 B;  3ESJ A;  3HKB A;  1RA4 A;  3WPX A;  4BT4 A;  3F0F A;  3S06 A;  2UYJ A;  4O4I A;  5J2T A;  1TUB A;  4EB6 B;  1T0A A;  2PMP A;  5EYP A;  1IV4 A;  2AIZ P;  5EB0 A;  4X20 A;  4BY9 D;  2CVL A;  3FD5 A;  3S0Y A;  1QD9 A;  4DXD A;  1Z5W A;  1XBI A;  2UYK A;  3CCM F;  1W2B F;  1FSZ A;  5A2Q M;  2JNB A;  4EI7 A;  3G4S F;  2VGM A;  3JCM M;  4O2B A;  5FNV B;  1JFF A;  2VGN A;  2HS0 A;  4I55 A;  5IJ9 B;  1M1K H;  1U40 A;  5HP7 A;  1JFF B;  4RHA A;  1VQM F;  2Z1F A;  5IJ0 B;  3RA6 A;  3C9R A;  3VTI C;  3LFO A;  4IHJ A;  2AIF A;  3N2K B;  1VQ5 F;  3K2X A;  2BTO A;  4EI9 A;  2CSL A;  3RYH B;  1UFY A;  2LBW A;  5KMG B;  4G4X A;  2Z1T A;  1YIT F;  3MQW A;  3VOB A;  3CC7 F;  5HY2 A;  3HKE B;  3V4D A;  1N8R H;  3S0H A;  3F0D A;  5G4U C;  4B46 A;  1YJN F;  3J7A R;  4ZI7 A;  2VXY A;  1ONI A;  4BT2 A;  1QVF F;  3P10 A;  4O2A A;  3CCL F;  5BMV A;  4ZOL A;  2FC3 A;  4C4W C;  3CG6 A;  1YGY A;  2QI2 A;  3N4Z A;  1IV1 A;  1RLG A;  3QHD A;  1VQO F;  3ZO8 A;  2ZOD A;  3S0W A;  1VQN F;  1FFX A;  3WGL A;  3I56 F;  4C82 A;  5GIO C;  4O4L A;  4BVT A;  3JAR B;  3N4Y A;  2Z1E A;  3DDN A;  3N2G A;  3HJW C;  2UYN A;  3WJQ A;  4TUY A;  5MN6 A;  2BO1 A;  3LME A;  1Q86 H;  2BTU A;  3WJP A;  4G88 A;  3FFM A;  4TV9 A;  3VI6 A;  2HRY A;  3FBA A;  4EI8 A;  2FGY A;  2QEX F;  4F6R B;  5J2U A;  2CHS A;  4LNU B;  3CMA F;  3LDT A;  1XRG A;  3ZP4 A;  3GYQ A;  3F6M A;  4BVR A;  1TUB B;  1QVG F;  3FPI A;  5EIB C;  4R40 B;  4ZHV A;  3CYP B;  1W57 A;  5IT9 M;  1VQ9 F;  1VQ6 F;  1ZWZ A;  4IHJ B;  5J2U B;  1K9M H;  1VH8 A;  4KWE A;  3G71 F;  3O85 A;  2W8B C;  2UZH A;  3JAT A;  4U39 A;  2IAF A;  5BMV B;  4O2B B;  5FNV A;  3TD5 A;  3D01 A;  4X1Y B;  1Q82 H;  3RE3 A;  5EB1 B;  1W41 A;  1KQS F;  2OTL F;  3CCE F;  3V7Q A;  1FNJ A;  1J7H A;  3LWQ C;  1FNK A;  1VQP F;  3OW2 F;  5LP6 A;  3HKE A;  5GIP C;  2R6R 1;  3JAT B;  4IIJ A;  4X3L A;  3MDO A;  2UYN B;  1E7K A;  1QU9 A;  1Z5V A;  3UT5 B;  2H6L A;  1UI9 A;  1W5E A;  3ZOP A;  5ITZ B;  4YJ3 B;  3HKB B;  3C8L A;  2HQS C;  5EAZ A;  2HX0 A;  3VYS C;  1COM A;  4LCK A;  2OZB A;  4TV8 A;  5MN4 A;  4FFB B;  2GZL A;  4U3J B;  5FJ4 C;  4G4Z A;  4TV9 B;  3CCS F;  3IMP A;  1NJI H;  4C8E A;  2KTU A;  3P0Z A;  1W5B A;  5IJ9 A;  3VYU C;  5CA0 B;  1KC8 H;  3F0E A;  2OHW A;  3VCZ A;  3HKC A;  3N2G B;  3K14 A;  1K8A H;  1TVK B;  2RB9 A;  3I7T A;  1CK2 A;  1SZQ A;  4O4J A;  4BT5 A;  3NVI B;  2HRU A;  2CWJ A;  3MCQ A;  1VQ7 F;  2IG8 A;  3CC4 F;  4YJ3 A;  3ZP7 A;  3KJK A;  5EO3 A;  3CCQ F;  3CCJ F;  1W5F A;  1X25 A;  3D00 A;  3NVK E;  4O4I B;  1U3L A;  3HWU A;  2HP0 A;  4RQO A;  4BT6 A;  4O2A B;  5HY0 A;  1SDS A;  5CA1 A;  1RQ7 A;  1DT9 A;  2MQE A;  1GO0 A;  4ZHQ B;  2LBX A;  2VAW A;  3C9S A;  4ZI7 B;  1X7P A;  3HTN A;  4ZHQ A;  4G4V A;  3JAS B;  3J80 M;  1H7M A;  1W58 1;  1YJW F;  4WBN A;  3CME F;  2HP0 B;  3TD4 A;  4C81 A;  5EZY B;  3WGK A;  1VQK F;  5LOV B;  2I6D A;  2RHJ A;  3CPQ A;  2CZW A;  4X3M A;  3VOA A;  2KG4 A;  3CCU F;  1VQ4 F;  1W3E X;  1JD1 A;  2R75 1;  3UT5 A;  1S72 F;  5KMG A;  4X1K A;  3HKC B;  5FLX M;  3OON A;  4ERH A;  1U3P A;  2NMU A;  3OBW A;  3EOR A;  3N2K A;  5IYZ B;  2P6Y A;  2VAP A;  3VMF B;  3WGJ A;  5HWE A;  3IR9 A;  1IV3 A;  5IJ0 A;  3LWV C;  3CXC F;  3PLA C;  4NQ3 A;  3SIU A;  5CA1 B;  3KJJ A;  2QTP A;  5EIB D;  5GAP K;  4X20 B;  3V3T A;  3OBY A;  2CW4 A;  3AGK A;  4TV8 B;  1YHQ F;  1GZ0 A;  4HNA A;  3SIV A;  1DBF A;  4C8G A;  5LXT B;  1NQ3 A;  3VO8 A;  5JH7 A;  2DT4 A;  3RYI A;  4DRX B;  5LP6 C;  2Q1Y A;  3KHN A;  4EB6 A;  2F9Z C;  3NK7 A;  2KGW A;  2BTQ B;  3ERN A;  3VIU A;  1H48 A;  5JVD A;  3LWP C;  1OFU A;  5CA0 A;  3S02 A;  5LP6 B;  3E22 A;  5JCO A;  3QTY A;  3M1X A;  3IKE A;  3CB2 A;  3GHZ A;  4C8I A;  2LBT A;  2ZOV A;  3LYB A;  3P4E A;  3DC2 A;  1ODE A;  3RYF A;  3MBM A;  1RLU A;  1JJ2 F;  4BT7 A;  4DRX A;  3LWO C;  3JAW A;  1K73 H;  2HS3 A;  3JAK A;  1JY8 A;  1Q8R A;  4BT3 A;  5LA6 A;  2LCA A;  2HP3 A;  5KX5 B;  2Q1X A;  3RYF B;  3R0P A;  3WXM B;  5CB4 A;  1KNK A;  5GON A;  1OAP A;  5GIN C;  4X1Y A;  2RHL A;  4M8I A;  4NWO B;  4YJ2 A;  3KIZ A;  2H8C A;  2G9I A;  3QUW A;  5JVD B;  3E1Y A;  1X7O A; 
#chains in the Genus database with same CATH homology
 1GX1 A;  3F0E A;  3JVH A;  1U40 A;  3F0D A;  3KE1 A;  3ELC A;  1U3P A;  1W55 A;  3ESJ A;  1KNJ A;  1W57 A;  3IEQ A;  3K14 A;  1JY8 A;  3EOR A;  3F0F A;  1VHA A;  3IKF A;  1U43 A;  5B8F A;  1VH8 A;  3ERN A;  1H48 A;  3P10 A;  1IV3 A;  1T0A A;  2PMP A;  3K2X A;  1IV4 A;  2UZH A;  4C81 A;  3FBA A;  3B6N A;  1JN1 A;  3IKE A;  1KNK A;  1YQN A;  3GHZ A;  3F0G A;  4C8I A;  1H47 A;  1IV1 A;  1U3L A;  3QHD A;  3RE3 A;  2GZL A;  3IEW A;  2AMT A;  3MBM A;  4C8E A;  1IV2 A;  3P0Z A;  4C8G A;  3Q8H A;  4C82 A;  3F6M A;  3T80 A;  3FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...