3IKEA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikeA00
3P10A 3ERNA 1U3LA 2AMTA 3K14A 3ELCA 3IEQA 1IV1A 3GHZA 3KE1A 5B8FA 3QHDA 3IKFA 2GZLA 3EORA 1JN1A 4C8IA 1JY8A 1U40A 4C81A 3FBAA 1IV3A 1W57A 3B6NA 1W55A 1VH8A 3JVHA 1H48A 1GX1A 3ESJA 3F0EA 1U3PA 1U43A 3F6MA 4C8GA 3Q8HA 1YQNA 2UZHA 3RE3A 1IV4A 3MBMA 3K2XA 1VHAA 3F0FA 3P0ZA 3T80A 1H47A 3IKEA 4C8EA 1KNKA 2PMPA 3F0DA 4C82A 1KNJA 1IV2A 3FPIA 3IEWA 1T0AA 3F0GA
chains in the Genus database with same CATH superfamily
2ZF8A 4BW0B 2VGNA 3HJWC 2CW4A 4IIJB 1N8RH 1W41A 3CYQA 4B45A 3CCQF 1Q82H 3CCRF 1TVKA 3MCQA 3CCVF 2DYYA 1VQMF 4O4HA 1KNKA 2BTUA 4X20A 3IEWA 4NUTA 3VYUC 3DDNA 3MCAB 2HX0A 3LWPC 2JNBA 1KQSF 3CMEF 4LCKA 5IJ9A 5B8FA 2DT4A 5LXTA 4DRXA 2HRUA 2KG4A 2UYKA 3CCLF 4EI9A 1U40A 4G88A 4LNUB 3N2KA 5EO3A 1VQPF 5FNVA 1JFFA 4ZI7B 3WGNA 2MQEA 1DT9A 1W5FA 1YJWF 1K73H 4O4LA 5HXUA 5GANK 3LDTA 3TD3A 3OONA 3IMPA 5GINC 5GAPK 1GO0A 3CC4F 1IV2A 4BT6A 4DXDA 4X1KB 3RYIB 3HKDA 5LYJA 1NMUB 4R40B 3G71F 3OBYA 1OAPA 2HRYA 1FFXA 1XBIA 3B6NA 3S06A 1W55A 3O85A 4F6RB 3IR9A 1U43A 3VOBA 2UZHA 1RLGA 3HWUA 1FNKA 2OHWA 3S0WA 2Q1XA 3CPQA 4TV9B 4ZK7A 4O2BA 3HKCA 4ERHA 1KNJA 4O2AA 1T0AA 1M1KH 3PAFA 1CN7A 2HP0B 2AMTA 1FSZA 2LBWA 4U3JB 1VQ9F 1W42A 5CA1A 4KWEA 3AGKA 1FNJA 1JY8A 1Z5WA 5HP8A 5ITZB 1KC8H 1VQNF 1YJ9F 5C8YA 2ZAUA 1VQLF 1QAHA 3HAXD 1SDSA 2CHTA 1ODEA 2AIFA 3VTIC 3RE3A 2UYPA 3WPWA 4IHJB 1K8AH 3SIUA 3IKEA 3CXCF 3J80M 2FGYA 3MDOA 1VQKF 4TUYA 1GZ0A 2HQSC 3D54A 2VGMA 4YJ3A 1KD1H 4X1YA 3LMEA 3KE1A 1ONIA 4FFBA 4C4WC 3IKFA 1CLIA 2N48A 2GZLA 4RHAA 1JN1A 4O4HB 3LWRC 2L26A 3NVKE 2UYJA 3WJQA 3WPXA 3JAKB 4O4JB 3JAMM 4G4WA 4U39A 5IJ9B 3HTNA 5GIOC 5LOVA 5LXTB 3N4ZA 4DRXB 3J81M 1H47A 4I55B 3M4SA 3FD6A 4B46A 4ZHWA 2UYNA 2WALA 3K0TA 3JAWA 5MN6A 1RLUA 5FNVB 1VQOF 3G6EF 1JFFB 3VO8A 2VXYA 3P10A 2OTMA 3CC2F 3CC7F 4TV8B 3D00A 5CB4B 3VCZA 3J7AR 1XRGA 3HKBB 4ZOLA 2GVIA 4O4LB 3S03A 5J2UB 3JASA 5LP6B 3CCEF 3CMAF 1VQ8F 2CWJA 2H8CA 4EI8A 3P4EA 5HY2A 4NWOB 5JH7A 1TUBA 4XCQA 2LCAA 2F9ZC 2LBXA 1YGYA 4YJ2A 1FFXB 3M1XA 4BT3A 5IT9M 5LA6A 2KGWA 3JCMM 2FC3A 5AVMA 1W40A 5BMVB 5MN5A 2KTUA 2K1SA 3E20B 3ON1A 3C9TA 1JJ2F 1VQ7F 4O4IA 3GTZA 3JVHA 4O2AB 2P6YA 3F0EA 2OTLF 5J2TA 2ZVYA 5KMGB 3CCJF 3MBMA 5CA1B 3QTYA 1H7MA 2QTPA 2PMPA 3WJPA 1YIJF 5GONB 3FPIA 5JVDB 3VIUA 3JARB 3CCSF 4BVQA 3LYBA 1VQ5F 3GHZA 3CCUF 3SIVA 5A2QM 3N2GA 5FLXM 1S72F 2Z01A 2OTJF 1SA0A 2QEXF 1W2BF 1OFUA 1SZQA 3UT5A 1UI9A 3ZP7A 5IJ0A 2RHHA 2OZBA 3Q8HA 5CA0A 1VQ4F 3CD6F 4FFBB 3K2XA 4G4VA 4I50B 5EIBC 2V9YA 3K12A 2Z1UA 5HY4A 3S02A 1ZWZA 3WXMB 3VI6A 5EYPB 2CSLA 3ZOPA 2R751 2LBTA 3GYQA 1VQ6F 3JAWB 3TD4A 5EIBD 4WBNB 2HS3A 3ESJA 1Q7YH 1R1MA 3OBWA 4ZOLB 3F0FA 2R6R1 1X7OA 4LNUA 5KX5A 3NK7A 1W5AA 2VAMA 1QD9A 2ZOVA 1TVKB 3CB2A 3S0HA 2GLZA 3QUWA 1IV1A 1UFYA 5JH7B 3RYCA 1TUBB 4EI7A 3JALA 3CPWF 3E1YA 4YJ2B 3FBAA 3V7QA 2BO1A 4X20B 5LA6B 4EB6A 3VYSC 3NVIB 1U3PA 3LWVC 4C8GA 1T0KB 1YI2F 3P0ZA 5HY0A 5EB1B 1COMA 1NQ3A 3N2KB 1NJIH 2HVYD 1QU9A 4F6RA 3JATA 3HKEA 3N4YA 3VYTC 3C9RA 4BT2A 1CK2A 5J2TB 5JQGA 3TD5A 5EWRA 3NK6A 1XHOA 5IYZA 1PXWA 2IAFA 1GX1A 5EZYA 4HNAA 3F6MA 3MQWA 4BVSA 3WJRA 3CG6A 4ZHVA 3HKDB 5LYJB 3M84A 2RHLA 2RHOA 4E6EA 1YHQF 2RB9A 5HP7A 5ITZA 5DCVA 1W5BA 2Z1EA 2VAPA 4C8EA 3L7QA 2CZWA 1Z5VA 4G4ZA 3FFMA 1VQVA 1JD1A 3F0GA 4PWTA 3RYFA 2G9IA 3UT5B 3E22A 3ERNA 4ZHQA 5IJ0B 4X3MA 4TZZA 3C8LA 1Q8RA 3RYHA 4IHJA 2EWCA 5CA0B 3LWQC 4G4XA 4X3LA 3C9SA 3EORA 1YITF 1QVFF 4BT4A 2H8EA 4O2BB 3HKCB 3NMUC 3RA6A 3C9UA 2IQQA 4M8IA 2IG8A 3FD5A 2ZODA 3T80A 1X7PA 1K9MH 4B62A 2CVLA 2Q1YA 4I4TA 1IPAA 3RA5A 3JAKA 4O4JA 5C8YB 3KJKA 3ELCA 3I56F 4X1IA 2HS4A 4I55A 5MN4A 2W8BC 4ZHYB 5KX5B 5GIPC 3G4SF 5HXZA 3R0PA 3LFOA 5EAZA 3DC2A 4TUYB 1VH8A 1Q86H 2KTVA 1RQ7A 4TV8A 1H48A 3V3TA 1XV2A 5CB4A 1W3EX 3HKBA 4YJ3B 3CYPB 2RHJA 4X1YB 1YQNA 2VAWA 4BT7A 4BVTA 3RYCB 3I7TA 3JALB 5LP6A 5J2UA 1RQ2A 1VK3A 4IIJA 1GO1A 3I3FA 2HS0A 4EB6B 3KJJA 3K14A 3WGKA 3IEQA 3WGMA 3BYQA 2BTQB 5LOVB 3CCMF 5G4UC 1IV3A 2UYNB 2YYEA 3JATB 5BMVA 3HKEB 3KHNA 2QA4F 5JQGB 5G4VC 1J7HA 4C82A 3JASB 3KIZA 4NQ3A 3D01A 5IYZB 3PLAC 4ZI7A 3S0YA 5EZYB 3U0OA 4HNAB 5LP6C 3V7EA 1U3LA 5JCOA 4BVRA 5KMGA 3VMFB 1E7KA 3ZO8A 3I55F 2PHNA 1M90H 4C8IA 5GONA 3WGJA 1YJNF 1W57A 3ZP4A 4BY9D 5JVDA 1PF5A 3JARA 2I6DA 3RYFB 4ZHQB 4X1KA 2ZVZA 3E22B 3RYIA 4G4YA 3RYHB 4BT5A 1X52A 2AIZP 3V4DA 1Q81H 5HWEA 3F0DA 4O4IB 2QI2A 2YXZA 3LWOC 4I50A 2NMUA 3QHDA 3WGLA 4B5CA 1QVGF 1W59A 4TV9A 2B33A 4I4TB 5EB0A 3VOAA 4C81A 2HP3A 5EYPA 1DBFA 2CHSA 5JCOC 5FJ4C 1X25A 5HY1A 2HP0A 2BTOA 2Z1TA 2H6LA 1IV4A 4U3JA 4X1IB 1VHAA 2ALEA 1W5EA 4RQOA 2Z1FA 2I6RA 1W581 3N2GB 4WBNA 3OW2F 1RA4A 1SA0B
chains in the Genus database with same CATH topology
3P10A 3ERNA 1U3LA 2AMTA 3K14A 3ELCA 3IEQA 1IV1A 3GHZA 3KE1A 5B8FA 3QHDA 3IKFA 2GZLA 3EORA 1JN1A 4C8IA 1JY8A 1U40A 4C81A 3FBAA 1IV3A 1W57A 3B6NA 1W55A 1VH8A 3JVHA 1H48A 1GX1A 3ESJA 3F0EA 1U3PA 1U43A 3F6MA 4C8GA 3Q8HA 1YQNA 2UZHA 3RE3A 1IV4A 3MBMA 3K2XA 1VHAA 3F0FA 3P0ZA 3T80A 1H47A 3IKEA 4C8EA 1KNKA 2PMPA 3F0DA 4C82A 1KNJA 1IV2A 3FPIA 3IEWA 1T0AA 3F0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P10 A;  3ERN A;  1U3L A;  2AMT A;  3K14 A;  3ELC A;  3IEQ A;  1IV1 A;  3GHZ A;  3KE1 A;  5B8F A;  3QHD A;  3IKF A;  2GZL A;  3EOR A;  1JN1 A;  4C8I A;  1JY8 A;  1U40 A;  4C81 A;  3FBA A;  1IV3 A;  1W57 A;  3B6N A;  1W55 A;  1VH8 A;  3JVH A;  1H48 A;  1GX1 A;  3ESJ A;  3F0E A;  1U3P A;  1U43 A;  3F6M A;  4C8G A;  3Q8H A;  1YQN A;  2UZH A;  3RE3 A;  1IV4 A;  3MBM A;  3K2X A;  1VHA A;  3F0F A;  3P0Z A;  3T80 A;  1H47 A;  3IKE A;  4C8E A;  1KNK A;  2PMP A;  3F0D A;  4C82 A;  1KNJ A;  1IV2 A;  3FPI A;  3IEW A;  1T0A A;  3F0G A; 
#chains in the Genus database with same CATH topology
 2ZF8 A;  4BW0 B;  2VGN A;  3HJW C;  2CW4 A;  4IIJ B;  1N8R H;  1W41 A;  3CYQ A;  4B45 A;  3CCQ F;  1Q82 H;  3CCR F;  1TVK A;  3MCQ A;  3CCV F;  2DYY A;  1VQM F;  4O4H A;  1KNK A;  2BTU A;  4X20 A;  3IEW A;  4NUT A;  3VYU C;  3DDN A;  3MCA B;  2HX0 A;  3LWP C;  2JNB A;  1KQS F;  3CME F;  4LCK A;  5IJ9 A;  5B8F A;  2DT4 A;  5LXT A;  4DRX A;  2HRU A;  2KG4 A;  2UYK A;  3CCL F;  4EI9 A;  1U40 A;  4G88 A;  4LNU B;  3N2K A;  5EO3 A;  1VQP F;  5FNV A;  1JFF A;  4ZI7 B;  3WGN A;  2MQE A;  1DT9 A;  1W5F A;  1YJW F;  1K73 H;  4O4L A;  5HXU A;  5GAN K;  3LDT A;  3TD3 A;  3OON A;  3IMP A;  5GIN C;  5GAP K;  1GO0 A;  3CC4 F;  1IV2 A;  4BT6 A;  4DXD A;  4X1K B;  3RYI B;  3HKD A;  5LYJ A;  1NMU B;  4R40 B;  3G71 F;  3OBY A;  1OAP A;  2HRY A;  1FFX A;  1XBI A;  3B6N A;  3S06 A;  1W55 A;  3O85 A;  4F6R B;  3IR9 A;  1U43 A;  3VOB A;  2UZH A;  1RLG A;  3HWU A;  1FNK A;  2OHW A;  3S0W A;  2Q1X A;  3CPQ A;  4TV9 B;  4ZK7 A;  4O2B A;  3HKC A;  4ERH A;  1KNJ A;  4O2A A;  1T0A A;  1M1K H;  3PAF A;  1CN7 A;  2HP0 B;  2AMT A;  1FSZ A;  2LBW A;  4U3J B;  1VQ9 F;  1W42 A;  5CA1 A;  4KWE A;  3AGK A;  1FNJ A;  1JY8 A;  1Z5W A;  5HP8 A;  5ITZ B;  1KC8 H;  1VQN F;  1YJ9 F;  5C8Y A;  2ZAU A;  1VQL F;  1QAH A;  3HAX D;  1SDS A;  2CHT A;  1ODE A;  2AIF A;  3VTI C;  3RE3 A;  2UYP A;  3WPW A;  4IHJ B;  1K8A H;  3SIU A;  3IKE A;  3CXC F;  3J80 M;  2FGY A;  3MDO A;  1VQK F;  4TUY A;  1GZ0 A;  2HQS C;  3D54 A;  2VGM A;  4YJ3 A;  1KD1 H;  4X1Y A;  3LME A;  3KE1 A;  1ONI A;  4FFB A;  4C4W C;  3IKF A;  1CLI A;  2N48 A;  2GZL A;  4RHA A;  1JN1 A;  4O4H B;  3LWR C;  2L26 A;  3NVK E;  2UYJ A;  3WJQ A;  3WPX A;  3JAK B;  4O4J B;  3JAM M;  4G4W A;  4U39 A;  5IJ9 B;  3HTN A;  5GIO C;  5LOV A;  5LXT B;  3N4Z A;  4DRX B;  3J81 M;  1H47 A;  4I55 B;  3M4S A;  3FD6 A;  4B46 A;  4ZHW A;  2UYN A;  2WAL A;  3K0T A;  3JAW A;  5MN6 A;  1RLU A;  5FNV B;  1VQO F;  3G6E F;  1JFF B;  3VO8 A;  2VXY A;  3P10 A;  2OTM A;  3CC2 F;  3CC7 F;  4TV8 B;  3D00 A;  5CB4 B;  3VCZ A;  3J7A R;  1XRG A;  3HKB B;  4ZOL A;  2GVI A;  4O4L B;  3S03 A;  5J2U B;  3JAS A;  5LP6 B;  3CCE F;  3CMA F;  1VQ8 F;  2CWJ A;  2H8C A;  4EI8 A;  3P4E A;  5HY2 A;  4NWO B;  5JH7 A;  1TUB A;  4XCQ A;  2LCA A;  2F9Z C;  2LBX A;  1YGY A;  4YJ2 A;  1FFX B;  3M1X A;  4BT3 A;  5IT9 M;  5LA6 A;  2KGW A;  3JCM M;  2FC3 A;  5AVM A;  1W40 A;  5BMV B;  5MN5 A;  2KTU A;  2K1S A;  3E20 B;  3ON1 A;  3C9T A;  1JJ2 F;  1VQ7 F;  4O4I A;  3GTZ A;  3JVH A;  4O2A B;  2P6Y A;  3F0E A;  2OTL F;  5J2T A;  2ZVY A;  5KMG B;  3CCJ F;  3MBM A;  5CA1 B;  3QTY A;  1H7M A;  2QTP A;  2PMP A;  3WJP A;  1YIJ F;  5GON B;  3FPI A;  5JVD B;  3VIU A;  3JAR B;  3CCS F;  4BVQ A;  3LYB A;  1VQ5 F;  3GHZ A;  3CCU F;  3SIV A;  5A2Q M;  3N2G A;  5FLX M;  1S72 F;  2Z01 A;  2OTJ F;  1SA0 A;  2QEX F;  1W2B F;  1OFU A;  1SZQ A;  3UT5 A;  1UI9 A;  3ZP7 A;  5IJ0 A;  2RHH A;  2OZB A;  3Q8H A;  5CA0 A;  1VQ4 F;  3CD6 F;  4FFB B;  3K2X A;  4G4V A;  4I50 B;  5EIB C;  2V9Y A;  3K12 A;  2Z1U A;  5HY4 A;  3S02 A;  1ZWZ A;  3WXM B;  3VI6 A;  5EYP B;  2CSL A;  3ZOP A;  2R75 1;  2LBT A;  3GYQ A;  1VQ6 F;  3JAW B;  3TD4 A;  5EIB D;  4WBN B;  2HS3 A;  3ESJ A;  1Q7Y H;  1R1M A;  3OBW A;  4ZOL B;  3F0F A;  2R6R 1;  1X7O A;  4LNU A;  5KX5 A;  3NK7 A;  1W5A A;  2VAM A;  1QD9 A;  2ZOV A;  1TVK B;  3CB2 A;  3S0H A;  2GLZ A;  3QUW A;  1IV1 A;  1UFY A;  5JH7 B;  3RYC A;  1TUB B;  4EI7 A;  3JAL A;  3CPW F;  3E1Y A;  4YJ2 B;  3FBA A;  3V7Q A;  2BO1 A;  4X20 B;  5LA6 B;  4EB6 A;  3VYS C;  3NVI B;  1U3P A;  3LWV C;  4C8G A;  1T0K B;  1YI2 F;  3P0Z A;  5HY0 A;  5EB1 B;  1COM A;  1NQ3 A;  3N2K B;  1NJI H;  2HVY D;  1QU9 A;  4F6R A;  3JAT A;  3HKE A;  3N4Y A;  3VYT C;  3C9R A;  4BT2 A;  1CK2 A;  5J2T B;  5JQG A;  3TD5 A;  5EWR A;  3NK6 A;  1XHO A;  5IYZ A;  1PXW A;  2IAF A;  1GX1 A;  5EZY A;  4HNA A;  3F6M A;  3MQW A;  4BVS A;  3WJR A;  3CG6 A;  4ZHV A;  3HKD B;  5LYJ B;  3M84 A;  2RHL A;  2RHO A;  4E6E A;  1YHQ F;  2RB9 A;  5HP7 A;  5ITZ A;  5DCV A;  1W5B A;  2Z1E A;  2VAP A;  4C8E A;  3L7Q A;  2CZW A;  1Z5V A;  4G4Z A;  3FFM A;  1VQV A;  1JD1 A;  3F0G A;  4PWT A;  3RYF A;  2G9I A;  3UT5 B;  3E22 A;  3ERN A;  4ZHQ A;  5IJ0 B;  4X3M A;  4TZZ A;  3C8L A;  1Q8R A;  3RYH A;  4IHJ A;  2EWC A;  5CA0 B;  3LWQ C;  4G4X A;  4X3L A;  3C9S A;  3EOR A;  1YIT F;  1QVF F;  4BT4 A;  2H8E A;  4O2B B;  3HKC B;  3NMU C;  3RA6 A;  3C9U A;  2IQQ A;  4M8I A;  2IG8 A;  3FD5 A;  2ZOD A;  3T80 A;  1X7P A;  1K9M H;  4B62 A;  2CVL A;  2Q1Y A;  4I4T A;  1IPA A;  3RA5 A;  3JAK A;  4O4J A;  5C8Y B;  3KJK A;  3ELC A;  3I56 F;  4X1I A;  2HS4 A;  4I55 A;  5MN4 A;  2W8B C;  4ZHY B;  5KX5 B;  5GIP C;  3G4S F;  5HXZ A;  3R0P A;  3LFO A;  5EAZ A;  3DC2 A;  4TUY B;  1VH8 A;  1Q86 H;  2KTV A;  1RQ7 A;  4TV8 A;  1H48 A;  3V3T A;  1XV2 A;  5CB4 A;  1W3E X;  3HKB A;  4YJ3 B;  3CYP B;  2RHJ A;  4X1Y B;  1YQN A;  2VAW A;  4BT7 A;  4BVT A;  3RYC B;  3I7T A;  3JAL B;  5LP6 A;  5J2U A;  1RQ2 A;  1VK3 A;  4IIJ A;  1GO1 A;  3I3F A;  2HS0 A;  4EB6 B;  3KJJ A;  3K14 A;  3WGK A;  3IEQ A;  3WGM A;  3BYQ A;  2BTQ B;  5LOV B;  3CCM F;  5G4U C;  1IV3 A;  2UYN B;  2YYE A;  3JAT B;  5BMV A;  3HKE B;  3KHN A;  2QA4 F;  5JQG B;  5G4V C;  1J7H A;  4C82 A;  3JAS B;  3KIZ A;  4NQ3 A;  3D01 A;  5IYZ B;  3PLA C;  4ZI7 A;  3S0Y A;  5EZY B;  3U0O A;  4HNA B;  5LP6 C;  3V7E A;  1U3L A;  5JCO A;  4BVR A;  5KMG A;  3VMF B;  1E7K A;  3ZO8 A;  3I55 F;  2PHN A;  1M90 H;  4C8I A;  5GON A;  3WGJ A;  1YJN F;  1W57 A;  3ZP4 A;  4BY9 D;  5JVD A;  1PF5 A;  3JAR A;  2I6D A;  3RYF B;  4ZHQ B;  4X1K A;  2ZVZ A;  3E22 B;  3RYI A;  4G4Y A;  3RYH B;  4BT5 A;  1X52 A;  2AIZ P;  3V4D A;  1Q81 H;  5HWE A;  3F0D A;  4O4I B;  2QI2 A;  2YXZ A;  3LWO C;  4I50 A;  2NMU A;  3QHD A;  3WGL A;  4B5C A;  1QVG F;  1W59 A;  4TV9 A;  2B33 A;  4I4T B;  5EB0 A;  3VOA A;  4C81 A;  2HP3 A;  5EYP A;  1DBF A;  2CHS A;  5JCO C;  5FJ4 C;  1X25 A;  5HY1 A;  2HP0 A;  2BTO A;  2Z1T A;  2H6L A;  1IV4 A;  4U3J A;  4X1I B;  1VHA A;  2ALE A;  1W5E A;  4RQO A;  2Z1F A;  2I6R A;  1W58 1;  3N2G B;  4WBN A;  3OW2 F;  1RA4 A;  1SA0 B; 
#chains in the Genus database with same CATH homology
 3P10 A;  3ERN A;  1U3L A;  2AMT A;  3K14 A;  3ELC A;  3IEQ A;  1IV1 A;  3GHZ A;  3KE1 A;  5B8F A;  3QHD A;  3IKF A;  2GZL A;  3EOR A;  1JN1 A;  4C8I A;  1JY8 A;  1U40 A;  4C81 A;  3FBA A;  1IV3 A;  1W57 A;  3B6N A;  1W55 A;  1VH8 A;  3JVH A;  1H48 A;  1GX1 A;  3ESJ A;  3F0E A;  1U3P A;  1U43 A;  3F6M A;  4C8G A;  3Q8H A;  1YQN A;  2UZH A;  3RE3 A;  1IV4 A;  3MBM A;  3K2X A;  1VHA A;  3F0F A;  3P0Z A;  3T80 A;  1H47 A;  3IKE A;  4C8E A;  1KNK A;  2PMP A;  3F0D A;  4C82 A;  1KNJ A;  1IV2 A;  3FPI A;  3IEW A;  1T0A A;  3F0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...