3IKEA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikeA00
3F0DA 1VH8A 2UZHA 3GHZA 1IV2A 3K14A 1W57A 3F0FA 3MBMA 3ELCA 1KNJA 3KE1A 1YQNA 1U3LA 3IEWA 3Q8HA 1JY8A 3RE3A 1IV3A 3ESJA 4C82A 3JVHA 4C8EA 1H47A 5B8FA 3FPIA 1IV1A 1VHAA 3IKEA 3F0EA 1H48A 4C81A 3FBAA 1U40A 3T80A 1U3PA 1GX1A 3F6MA 3B6NA 4C8IA 3QHDA 3EORA 3K2XA 3ERNA 1KNKA 2PMPA 3IEQA 1W55A 1IV4A 3F0GA 3P10A 3IKFA 1U43A 2AMTA 1JN1A 2GZLA 1T0AA 3P0ZA 4C8GA
chains in the Genus database with same CATH superfamily
2UYKA 2BTOA 3WPWA 3VYSC 2HP3A 5MN4A 4G4ZA 3WPXA 1W5AA 5CA0B 3N4ZA 5IYZB 1U3LA 4X1IB 4ZHQA 2DT4A 1W5BA 1H7MA 1QD9A 3C9UA 3HTNA 3IKEA 3CD6F 2L26A 3CXCF 1W3EX 3S06A 3M1XA 1X52A 3C9RA 5CA0A 4B45A 5LP6B 3ZP7A 5LXTB 5J2TB 2VAMA 3RYFB 1Q86H 3M84A 3VMFB 1KC8H 4TV8B 1E7KA 4RHAA 5BMVB 5LP6A 1ODEA 2RB9A 1H47A 1QU9A 1RA4A 3HWUA 1GZ0A 5IJ9A 2Z1TA 4HNAB 3QHDA 2Z1FA 4G88A 5GIOC 4TV8A 3CCQF 4NQ3A 1DT9A 3HKDB 3TD3A 3VOBA 4O2BA 4IHJA 4LNUB 3E1YA 1IPAA 3WJRA 3G4SF 3JARA 2CSLA 2Z01A 1QVFF 4LNUA 3CMEF 3HKDA 3FBAA 1Q7YH 2KTUA 3LDTA 5LOVB 1VQ5F 3JCMM 4EB6B 4X1IA 4ZHQB 1W55A 1NQ3A 4YJ3A 3MDOA 4O4HA 2DYYA 4G4WA 3OBYA 3NMUC 4ZHWA 3GHZA 3RA6A 2GLZA 2HVYD 3K14A 2QI2A 1VQ9F 4ZOLA 3S0YA 1YJ9F 1YQNA 3E22A 3UT5B 1JY8A 5EIBC 3M4SA 3D54A 1VQOF 4G4XA 4IIJA 3T80A 1SZQA 4BT7A 2B33A 3D01A 3LYBA 1PXWA 3CCLF 1QAHA 2CW4A 2VAPA 1VQ8F 1U43A 4I4TB 3S03A 1GO0A 2VGNA 3E20B 2JNBA 3VYUC 2UYNB 4O4IB 3WJQA 2N48A 3IEWA 3NK7A 1YJNF 5B8FA 3FPIA 3CC4F 4TUYB 2LBXA 2BO1A 3S02A 4U39A 3J80M 3CCUF 1X7OA 3CCEF 1FFXB 4YJ2A 2R751 3JAWB 5A2QM 3F0GA 3WGJA 5CB4A 2KG4A 4B62A 3E22B 1VQ7F 5KX5B 2ZODA 3CPQA 2CHTA 4C8GA 2NMUA 3NVIB 2F9ZC 2R6R1 3F0FA 4BT5A 1RQ2A 1JFFA 1QVGF 1IV3A 1SA0A 4O2AA 5AVMA 4I4TA 3JAKB 4U3JA 3NVKE 1R1MA 2HS4A 2H8EA 3HJWC 3B6NA 2BTQB 2HRYA 1VQ6F 3G71F 5CA1A 3FD6A 4M8IA 4X1YB 1ZWZA 1Z5WA 5HY1A 4ZHYB 2QTPA 3KHNA 3C8LA 3S0WA 5HP7A 2IAFA 3HKBA 4NUTA 2YYEA 3I3FA 4DRXA 2CVLA 3DC2A 4EI9A 2YXZA 3C9SA 4F6RA 5ITZB 5IT9M 2FGYA 1U40A 2ZVZA 1YIJF 2G9IA 2UYJA 5HY4A 5IJ0A 4PWTA 3MQWA 4G4VA 4G4YA 3RA5A 3KJKA 4F6RB 2EWCA 2WALA 4X20B 3V7QA 5ITZA 1GO1A 1CLIA 4IIJB 3VI6A 4O4LA 1VQNF 3LWVC 4EI8A 5JVDB 3VTIC 1FFXA 1VQMF 3BYQA 1W5FA 2IQQA 3JASA 5LXTA 4WBNA 2ZF8A 5CA1B 1Q81H 1SDSA 1VHAA 4BT3A 5J2TA 2UYNA 2MQEA 3F6MA 3V3TA 5FLXM 3WGLA 3CCRF 1NMUB 4O4JA 4XCQA 1FSZA 3PAFA 4O2AB 4O4IA 5IYZA 5JH7B 2OHWA 2HQSC 1YHQF 1YITF 1VQKF 3P4EA 4BT6A 2UZHA 3VIUA 1NJIH 3MBMA 2Q1XA 4I50A 3LWOC 3PLAC 2CZWA 3JVHA 5CB4B 3LWRC 3CPWF 1W41A 2Q1YA 3GYQA 1VQVA 1VK3A 4B46A 4EI7A 1W5EA 3WGMA 1TUBA 2K1SA 4C8IA 1RQ7A 4I50B 4TV9B 3UT5A 2HX0A 1SA0B 3I55F 3P10A 2OZBA 3IKFA 1JFFB 5GONB 2AIFA 2GZLA 1W2BF 1K73H 5GAPK 1UI9A 5LOVA 4BVTA 5EB0A 3N2KA 3CCJF 3CC7F 4ZK7A 4DXDA 2ZOVA 5HY0A 4YJ3B 5EYPA 1Z5VA 3MCAB 4BW0B 3RYCA 3CMAF 3RYIA 2QEXF 5MN6A 4X3LA 2KTVA 4BVQA 3HKBB 5HXUA 5KX5A 2RHHA 1U3PA 4O4LB 3AGKA 5C8YB 3HKCB 3JASB 3L7QA 3OW2F 1K9MH 3IEQA 2PHNA 3I56F 4ZOLB 5JQGB 1RLUA 3CYQA 5KMGB 3JAKA 5J2UA 4TUYA 1OAPA 2IG8A 3I7TA 3IR9A 4I55A 3ZO8A 1XBIA 2HP0B 3K12A 1IV2A 3CG6A 5GIPC 3SIUA 3WXMB 1S72F 1M1KH 2VXYA 2H6LA 4EB6A 2BTUA 4O4HB 3Q8HA 4C82A 3CCVF 5EIBD 1FNKA 3MCQA 5FNVB 2RHJA 3VCZA 2HP0A 3JALA 4X1KB 1Q82H 1RLGA 1Q8RA 2HRUA 5J2UB 4I55B 4BT4A 2CWJA 3K2XA 3SIVA 3JATA 1CN7A 5LYJA 1FNJA 3O85A 5EZYB 2I6DA 3JARB 1TVKB 1N8RH 2OTJF 4BVSA 3CB2A 5HY2A 3U0OA 4BVRA 3KE1A 4ZI7B 3QUWA 5JCOA 1M90H 2LCAA 5JH7A 4X3MA 1IV1A 3IMPA 1W42A 4C81A 1ONIA 2AIZP 3OONA 3VO8A 5EB1B 3N2KB 3ON1A 2W8BC 2CHSA 4BY9D 1JN1A 2P6YA 3R0PA 1TUBB 4WBNB 3P0ZA 4LCKA 4ZHVA 3HKCA 3CCMF 1YGYA 4YJ2B 3TD5A 1W40A 1KD1H 3JAWA 5G4UC 3S0HA 2H8CA 4X20A 2VGMA 4X1YA 3ELCA 5HXZA 1X7PA 1VQ4F 3ESJA 3RYFA 3G6EF 1J7HA 4TZZA 5LYJB 4B5CA 2RHLA 3FD5A 1YI2F 3DDNA 3J7AR 2FC3A 3LFOA 5EWRA 1GX1A 1JD1A 3N2GB 1VQLF 3EORA 3V4DA 1IV4A 1XRGA 5FNVA 1KQSF 3KIZA 1COMA 2Z1UA 4KWEA 2OTLF 3F0DA 3KJJA 1XHOA 1YJWF 3CC2F 4RQOA 3NK6A 5C8YA 4TV9A 2V9YA 5EZYA 3CCSF 3VYTC 5HWEA 3LWPC 3JATB 1TVKA 2OTMA 3F0EA 3V7EA 3OBWA 4IHJB 3RYCB 2LBTA 2PMPA 3GTZA 5LP6C 2QA4F 3WGNA 3RYIB 3VOAA 4ZI7A 2ZAUA 2GVIA 1VH8A 4O4JB 5DCVA 3TD4A 5IJ9B 1W581 1XV2A 1W57A 1VQPF 3N4YA 1W59A 3J81M 1KNJA 5GANK 3RE3A 1X25A 3HAXD 2HS3A 3WJPA 4C8EA 3CYPB 3RYHA 5LA6B 2ALEA 3QTYA 1H48A 1OFUA 4O2BB 3WGKA 3ZP4A 5JVDA 3ERNA 5GINC 4FFBB 2Z1EA 3RYHB 5EYPB 5JCOC 5LA6A 2RHOA 4U3JB 3K0TA 1K8AH 1T0AA 3FFMA 4BT2A 3HKEA 3N2GA 2LBWA 3JALB 4X1KA 5EAZA 4HNAA 2UYPA 3ZOPA 5IJ0B 1CK2A 5GONA 4E6EA 3JAMM 2KGWA 4FFBA 1PF5A 3D00A 3HKEB 5JQGA 3LMEA 5KMGA 1UFYA 1T0KB 5EO3A 5G4VC 3C9TA 2ZVYA 5BMVA 1JJ2F 1KNKA 5FJ4C 1DBFA 2HS0A 4R40B 4ERHA 5HP8A 4DRXB 2VAWA 4C4WC 2AMTA 3LWQC 2I6RA 4NWOB 5MN5A
chains in the Genus database with same CATH topology
3F0DA 1VH8A 2UZHA 3GHZA 1IV2A 3K14A 1W57A 3F0FA 3MBMA 3ELCA 1KNJA 3KE1A 1YQNA 1U3LA 3IEWA 3Q8HA 1JY8A 3RE3A 1IV3A 3ESJA 4C82A 3JVHA 4C8EA 1H47A 5B8FA 3FPIA 1IV1A 1VHAA 3IKEA 3F0EA 1H48A 4C81A 3FBAA 1U40A 3T80A 1U3PA 1GX1A 3F6MA 3B6NA 4C8IA 3QHDA 3EORA 3K2XA 3ERNA 1KNKA 2PMPA 3IEQA 1W55A 1IV4A 3F0GA 3P10A 3IKFA 1U43A 2AMTA 1JN1A 2GZLA 1T0AA 3P0ZA 4C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0D A;  1VH8 A;  2UZH A;  3GHZ A;  1IV2 A;  3K14 A;  1W57 A;  3F0F A;  3MBM A;  3ELC A;  1KNJ A;  3KE1 A;  1YQN A;  1U3L A;  3IEW A;  3Q8H A;  1JY8 A;  3RE3 A;  1IV3 A;  3ESJ A;  4C82 A;  3JVH A;  4C8E A;  1H47 A;  5B8F A;  3FPI A;  1IV1 A;  1VHA A;  3IKE A;  3F0E A;  1H48 A;  4C81 A;  3FBA A;  1U40 A;  3T80 A;  1U3P A;  1GX1 A;  3F6M A;  3B6N A;  4C8I A;  3QHD A;  3EOR A;  3K2X A;  3ERN A;  1KNK A;  2PMP A;  3IEQ A;  1W55 A;  1IV4 A;  3F0G A;  3P10 A;  3IKF A;  1U43 A;  2AMT A;  1JN1 A;  2GZL A;  1T0A A;  3P0Z A;  4C8G A; 
#chains in the Genus database with same CATH topology
 2UYK A;  2BTO A;  3WPW A;  3VYS C;  2HP3 A;  5MN4 A;  4G4Z A;  3WPX A;  1W5A A;  5CA0 B;  3N4Z A;  5IYZ B;  1U3L A;  4X1I B;  4ZHQ A;  2DT4 A;  1W5B A;  1H7M A;  1QD9 A;  3C9U A;  3HTN A;  3IKE A;  3CD6 F;  2L26 A;  3CXC F;  1W3E X;  3S06 A;  3M1X A;  1X52 A;  3C9R A;  5CA0 A;  4B45 A;  5LP6 B;  3ZP7 A;  5LXT B;  5J2T B;  2VAM A;  3RYF B;  1Q86 H;  3M84 A;  3VMF B;  1KC8 H;  4TV8 B;  1E7K A;  4RHA A;  5BMV B;  5LP6 A;  1ODE A;  2RB9 A;  1H47 A;  1QU9 A;  1RA4 A;  3HWU A;  1GZ0 A;  5IJ9 A;  2Z1T A;  4HNA B;  3QHD A;  2Z1F A;  4G88 A;  5GIO C;  4TV8 A;  3CCQ F;  4NQ3 A;  1DT9 A;  3HKD B;  3TD3 A;  3VOB A;  4O2B A;  4IHJ A;  4LNU B;  3E1Y A;  1IPA A;  3WJR A;  3G4S F;  3JAR A;  2CSL A;  2Z01 A;  1QVF F;  4LNU A;  3CME F;  3HKD A;  3FBA A;  1Q7Y H;  2KTU A;  3LDT A;  5LOV B;  1VQ5 F;  3JCM M;  4EB6 B;  4X1I A;  4ZHQ B;  1W55 A;  1NQ3 A;  4YJ3 A;  3MDO A;  4O4H A;  2DYY A;  4G4W A;  3OBY A;  3NMU C;  4ZHW A;  3GHZ A;  3RA6 A;  2GLZ A;  2HVY D;  3K14 A;  2QI2 A;  1VQ9 F;  4ZOL A;  3S0Y A;  1YJ9 F;  1YQN A;  3E22 A;  3UT5 B;  1JY8 A;  5EIB C;  3M4S A;  3D54 A;  1VQO F;  4G4X A;  4IIJ A;  3T80 A;  1SZQ A;  4BT7 A;  2B33 A;  3D01 A;  3LYB A;  1PXW A;  3CCL F;  1QAH A;  2CW4 A;  2VAP A;  1VQ8 F;  1U43 A;  4I4T B;  3S03 A;  1GO0 A;  2VGN A;  3E20 B;  2JNB A;  3VYU C;  2UYN B;  4O4I B;  3WJQ A;  2N48 A;  3IEW A;  3NK7 A;  1YJN F;  5B8F A;  3FPI A;  3CC4 F;  4TUY B;  2LBX A;  2BO1 A;  3S02 A;  4U39 A;  3J80 M;  3CCU F;  1X7O A;  3CCE F;  1FFX B;  4YJ2 A;  2R75 1;  3JAW B;  5A2Q M;  3F0G A;  3WGJ A;  5CB4 A;  2KG4 A;  4B62 A;  3E22 B;  1VQ7 F;  5KX5 B;  2ZOD A;  3CPQ A;  2CHT A;  4C8G A;  2NMU A;  3NVI B;  2F9Z C;  2R6R 1;  3F0F A;  4BT5 A;  1RQ2 A;  1JFF A;  1QVG F;  1IV3 A;  1SA0 A;  4O2A A;  5AVM A;  4I4T A;  3JAK B;  4U3J A;  3NVK E;  1R1M A;  2HS4 A;  2H8E A;  3HJW C;  3B6N A;  2BTQ B;  2HRY A;  1VQ6 F;  3G71 F;  5CA1 A;  3FD6 A;  4M8I A;  4X1Y B;  1ZWZ A;  1Z5W A;  5HY1 A;  4ZHY B;  2QTP A;  3KHN A;  3C8L A;  3S0W A;  5HP7 A;  2IAF A;  3HKB A;  4NUT A;  2YYE A;  3I3F A;  4DRX A;  2CVL A;  3DC2 A;  4EI9 A;  2YXZ A;  3C9S A;  4F6R A;  5ITZ B;  5IT9 M;  2FGY A;  1U40 A;  2ZVZ A;  1YIJ F;  2G9I A;  2UYJ A;  5HY4 A;  5IJ0 A;  4PWT A;  3MQW A;  4G4V A;  4G4Y A;  3RA5 A;  3KJK A;  4F6R B;  2EWC A;  2WAL A;  4X20 B;  3V7Q A;  5ITZ A;  1GO1 A;  1CLI A;  4IIJ B;  3VI6 A;  4O4L A;  1VQN F;  3LWV C;  4EI8 A;  5JVD B;  3VTI C;  1FFX A;  1VQM F;  3BYQ A;  1W5F A;  2IQQ A;  3JAS A;  5LXT A;  4WBN A;  2ZF8 A;  5CA1 B;  1Q81 H;  1SDS A;  1VHA A;  4BT3 A;  5J2T A;  2UYN A;  2MQE A;  3F6M A;  3V3T A;  5FLX M;  3WGL A;  3CCR F;  1NMU B;  4O4J A;  4XCQ A;  1FSZ A;  3PAF A;  4O2A B;  4O4I A;  5IYZ A;  5JH7 B;  2OHW A;  2HQS C;  1YHQ F;  1YIT F;  1VQK F;  3P4E A;  4BT6 A;  2UZH A;  3VIU A;  1NJI H;  3MBM A;  2Q1X A;  4I50 A;  3LWO C;  3PLA C;  2CZW A;  3JVH A;  5CB4 B;  3LWR C;  3CPW F;  1W41 A;  2Q1Y A;  3GYQ A;  1VQV A;  1VK3 A;  4B46 A;  4EI7 A;  1W5E A;  3WGM A;  1TUB A;  2K1S A;  4C8I A;  1RQ7 A;  4I50 B;  4TV9 B;  3UT5 A;  2HX0 A;  1SA0 B;  3I55 F;  3P10 A;  2OZB A;  3IKF A;  1JFF B;  5GON B;  2AIF A;  2GZL A;  1W2B F;  1K73 H;  5GAP K;  1UI9 A;  5LOV A;  4BVT A;  5EB0 A;  3N2K A;  3CCJ F;  3CC7 F;  4ZK7 A;  4DXD A;  2ZOV A;  5HY0 A;  4YJ3 B;  5EYP A;  1Z5V A;  3MCA B;  4BW0 B;  3RYC A;  3CMA F;  3RYI A;  2QEX F;  5MN6 A;  4X3L A;  2KTV A;  4BVQ A;  3HKB B;  5HXU A;  5KX5 A;  2RHH A;  1U3P A;  4O4L B;  3AGK A;  5C8Y B;  3HKC B;  3JAS B;  3L7Q A;  3OW2 F;  1K9M H;  3IEQ A;  2PHN A;  3I56 F;  4ZOL B;  5JQG B;  1RLU A;  3CYQ A;  5KMG B;  3JAK A;  5J2U A;  4TUY A;  1OAP A;  2IG8 A;  3I7T A;  3IR9 A;  4I55 A;  3ZO8 A;  1XBI A;  2HP0 B;  3K12 A;  1IV2 A;  3CG6 A;  5GIP C;  3SIU A;  3WXM B;  1S72 F;  1M1K H;  2VXY A;  2H6L A;  4EB6 A;  2BTU A;  4O4H B;  3Q8H A;  4C82 A;  3CCV F;  5EIB D;  1FNK A;  3MCQ A;  5FNV B;  2RHJ A;  3VCZ A;  2HP0 A;  3JAL A;  4X1K B;  1Q82 H;  1RLG A;  1Q8R A;  2HRU A;  5J2U B;  4I55 B;  4BT4 A;  2CWJ A;  3K2X A;  3SIV A;  3JAT A;  1CN7 A;  5LYJ A;  1FNJ A;  3O85 A;  5EZY B;  2I6D A;  3JAR B;  1TVK B;  1N8R H;  2OTJ F;  4BVS A;  3CB2 A;  5HY2 A;  3U0O A;  4BVR A;  3KE1 A;  4ZI7 B;  3QUW A;  5JCO A;  1M90 H;  2LCA A;  5JH7 A;  4X3M A;  1IV1 A;  3IMP A;  1W42 A;  4C81 A;  1ONI A;  2AIZ P;  3OON A;  3VO8 A;  5EB1 B;  3N2K B;  3ON1 A;  2W8B C;  2CHS A;  4BY9 D;  1JN1 A;  2P6Y A;  3R0P A;  1TUB B;  4WBN B;  3P0Z A;  4LCK A;  4ZHV A;  3HKC A;  3CCM F;  1YGY A;  4YJ2 B;  3TD5 A;  1W40 A;  1KD1 H;  3JAW A;  5G4U C;  3S0H A;  2H8C A;  4X20 A;  2VGM A;  4X1Y A;  3ELC A;  5HXZ A;  1X7P A;  1VQ4 F;  3ESJ A;  3RYF A;  3G6E F;  1J7H A;  4TZZ A;  5LYJ B;  4B5C A;  2RHL A;  3FD5 A;  1YI2 F;  3DDN A;  3J7A R;  2FC3 A;  3LFO A;  5EWR A;  1GX1 A;  1JD1 A;  3N2G B;  1VQL F;  3EOR A;  3V4D A;  1IV4 A;  1XRG A;  5FNV A;  1KQS F;  3KIZ A;  1COM A;  2Z1U A;  4KWE A;  2OTL F;  3F0D A;  3KJJ A;  1XHO A;  1YJW F;  3CC2 F;  4RQO A;  3NK6 A;  5C8Y A;  4TV9 A;  2V9Y A;  5EZY A;  3CCS F;  3VYT C;  5HWE A;  3LWP C;  3JAT B;  1TVK A;  2OTM A;  3F0E A;  3V7E A;  3OBW A;  4IHJ B;  3RYC B;  2LBT A;  2PMP A;  3GTZ A;  5LP6 C;  2QA4 F;  3WGN A;  3RYI B;  3VOA A;  4ZI7 A;  2ZAU A;  2GVI A;  1VH8 A;  4O4J B;  5DCV A;  3TD4 A;  5IJ9 B;  1W58 1;  1XV2 A;  1W57 A;  1VQP F;  3N4Y A;  1W59 A;  3J81 M;  1KNJ A;  5GAN K;  3RE3 A;  1X25 A;  3HAX D;  2HS3 A;  3WJP A;  4C8E A;  3CYP B;  3RYH A;  5LA6 B;  2ALE A;  3QTY A;  1H48 A;  1OFU A;  4O2B B;  3WGK A;  3ZP4 A;  5JVD A;  3ERN A;  5GIN C;  4FFB B;  2Z1E A;  3RYH B;  5EYP B;  5JCO C;  5LA6 A;  2RHO A;  4U3J B;  3K0T A;  1K8A H;  1T0A A;  3FFM A;  4BT2 A;  3HKE A;  3N2G A;  2LBW A;  3JAL B;  4X1K A;  5EAZ A;  4HNA A;  2UYP A;  3ZOP A;  5IJ0 B;  1CK2 A;  5GON A;  4E6E A;  3JAM M;  2KGW A;  4FFB A;  1PF5 A;  3D00 A;  3HKE B;  5JQG A;  3LME A;  5KMG A;  1UFY A;  1T0K B;  5EO3 A;  5G4V C;  3C9T A;  2ZVY A;  5BMV A;  1JJ2 F;  1KNK A;  5FJ4 C;  1DBF A;  2HS0 A;  4R40 B;  4ERH A;  5HP8 A;  4DRX B;  2VAW A;  4C4W C;  2AMT A;  3LWQ C;  2I6R A;  4NWO B;  5MN5 A; 
#chains in the Genus database with same CATH homology
 3F0D A;  1VH8 A;  2UZH A;  3GHZ A;  1IV2 A;  3K14 A;  1W57 A;  3F0F A;  3MBM A;  3ELC A;  1KNJ A;  3KE1 A;  1YQN A;  1U3L A;  3IEW A;  3Q8H A;  1JY8 A;  3RE3 A;  1IV3 A;  3ESJ A;  4C82 A;  3JVH A;  4C8E A;  1H47 A;  5B8F A;  3FPI A;  1IV1 A;  1VHA A;  3IKE A;  3F0E A;  1H48 A;  4C81 A;  3FBA A;  1U40 A;  3T80 A;  1U3P A;  1GX1 A;  3F6M A;  3B6N A;  4C8I A;  3QHD A;  3EOR A;  3K2X A;  3ERN A;  1KNK A;  2PMP A;  3IEQ A;  1W55 A;  1IV4 A;  3F0G A;  3P10 A;  3IKF A;  1U43 A;  2AMT A;  1JN1 A;  2GZL A;  1T0A A;  3P0Z A;  4C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...