3IKEA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikeA00
3FBAA 3P0ZA 4C8GA 3F0DA 2AMTA 4C8IA 1T0AA 4C8EA 1W55A 3IKEA 1W57A 1H47A 3F0GA 3JVHA 3K14A 1YQNA 1IV4A 1VHAA 1U40A 2PMPA 1JN1A 1IV1A 1JY8A 3ELCA 3GHZA 3IEWA 3FPIA 1U3PA 2UZHA 3MBMA 3Q8HA 3ERNA 2GZLA 5B8FA 1KNKA 3F0FA 3QHDA 3B6NA 3RE3A 3T80A 1IV3A 3F6MA 3KE1A 3K2XA 1IV2A 3EORA 3F0EA 4C81A 3ESJA 3IEQA 1H48A 3IKFA 3P10A 4C82A 1KNJA 1VH8A 1GX1A 1U43A 1U3LA
chains in the Genus database with same CATH superfamily
3RYHB 2AMTA 2IAFA 1VQPF 3KJKA 1YGYA 1H7MA 1CN7A 3JALB 2OZBA 3JVHA 1W41A 2MQEA 4X1YA 3MQWA 5EYPB 4EI8A 1W42A 2Q1XA 4X3MA 2HRYA 4B5CA 1GZ0A 3GHZA 1K9MH 2UYJA 3MBMA 3K12A 3ERNA 5B8FA 3N2GA 1VQ6F 2IG8A 2RHHA 4DXDA 1XV2A 3CCMF 1VQ5F 2BTQB 4IHJA 2QI2A 4ZI7A 4LCKA 3JATA 3RYIB 3KHNA 3CG6A 5J2TB 2KTVA 1DBFA 1OAPA 1RQ7A 3RYCB 3JASB 4I55B 3VYSC 5GINC 5GANK 3PAFA 3NK7A 1YHQF 1YITF 4G4ZA 2HQSC 2Z01A 3K14A 3WPWA 2KTUA 3HKDB 5KMGA 4I4TA 1VHAA 3V7QA 4ZHYB 2PMPA 1QU9A 4BVQA 4EB6B 3I55F 4DRXB 5JVDA 5IJ9A 1VQ4F 1X52A 3FPIA 1ODEA 3C9SA 4O4HA 4F6RA 3IMPA 3CB2A 3QHDA 5GAPK 1VK3A 4B62A 4G88A 1Z5WA 3HKBA 3C8LA 4TUYA 5GIPC 4U3JA 1KQSF 3LWQC 2CVLA 5EWRA 3KIZA 3MDOA 3CMAF 1W5FA 4YJ2B 5FLXM 2CZWA 1TVKB 3CXCF 3HKEB 4HNAB 1FFXB 1QD9A 3N4ZA 2EWCA 3RYIA 1X25A 2K1SA 5KX5B 2BO1A 2PHNA 2HRUA 5J2TA 4LNUA 5CB4B 1VQ7F 5IYZB 3CCVF 3F6MA 3CCQF 1VQOF 4XCQA 3LDTA 4ZOLB 3LWPC 1JJ2F 2HX0A 2OTLF 5HXUA 1KNJA 4BVSA 5ITZA 2GVIA 4EB6A 4DRXA 2ALEA 4C8IA 3RA5A 4C8EA 3JAWB 2ZOVA 5LXTB 3DC2A 5JH7B 1X7OA 3CYPB 4X1IB 4X3LA 1IV1A 3VIUA 5JQGB 1ONIA 4X1KB 2N48A 3WJPA 5HY4A 1KNKA 3B6NA 4PWTA 3J80M 3VI6A 2Z1EA 4YJ2A 5HY2A 2IQQA 1QVGF 2LBXA 2CHSA 1FFXA 2DT4A 3CC7F 5EB0A 3VMFB 1NJIH 3NVKE 5IJ0A 4BW0B 1TUBA 5FNVB 5IT9M 3WGKA 5LOVB 2OTJF 5LYJB 3VO8A 2VAWA 4TV8B 5IYZA 2RHOA 1IV4A 1W5AA 1QAHA 1VQLF 4X20A 3CYQA 4ZOLA 4NUTA 5MN5A 3WGLA 3HWUA 3VYTC 3V3TA 3WJRA 3S03A 4B46A 3CCUF 1VQVA 5GONB 3JAWA 5LXTA 1VQNF 5AVMA 3HAXD 5JH7A 4X1IA 3WPXA 1Q86H 3HKCB 3VCZA 1W55A 3WJQA 4ZHWA 2AIZP 3P0ZA 5JQGA 4X1KA 1YJNF 3I3FA 2VXYA 1FNKA 4I50A 3C9RA 1T0KB 3ZOPA 2W8BC 1U40A 5LP6B 5JCOC 3LWVC 4BT3A 1W2BF 3IR9A 3LFOA 4ZHVA 2OHWA 3Q8HA 1M1KH 3CPWF 3LYBA 1W59A 2VGNA 1Q7YH 3K2XA 5LOVA 5LA6B 5LYJA 1COMA 3LWOC 4WBNB 5HXZA 2VGMA 1YI2F 1GO1A 1RLUA 4G4XA 4O4JB 1JFFB 3WGMA 3BYQA 4IIJB 4O4IB 2G9IA 3R0PA 2QTPA 5GONA 5DCVA 1JN1A 5EIBC 3CD6F 3IEWA 2UZHA 5J2UB 2HP0A 2P6YA 2HS0A 3TD4A 3HKCA 2GZLA 3RYHA 1J7HA 2YYEA 3JALA 3JARB 1IPAA 2BTOA 3E20B 3JAKB 2LBTA 2HVYD 4C82A 1SDSA 5EYPA 3U0OA 4M8IA 3WXMB 3PLAC 3O85A 3G71F 2L26A 1W5EA 3C9UA 3HJWC 3J81M 3FBAA 3LMEA 2Z1FA 3ZO8A 2Z1UA 2H8EA 4YJ3B 1W57A 1W40A 2RHJA 3F0GA 4TV9B 3I56F 1YQNA 2CW4A 3VTIC 1SA0B 1FNJA 5LA6A 2UYPA 5EZYB 3UT5B 5JCOA 2OTMA 4WBNA 3G6EF 4O4JA 3RYCA 5HY1A 3JASA 2CSLA 4I55A 1IV3A 3CCRF 1DT9A 4C81A 1JD1A 3IKFA 3HKDA 4ZHQB 3V4DA 3RA6A 4G4YA 1W5BA 2RHLA 4KWEA 4R40B 4C8GA 5J2UA 3CPQA 3L7QA 3QUWA 3E22B 5MN6A 1M90H 3QTYA 1VQ9F 3S06A 3FD6A 1JY8A 3N4YA 1VQKF 4ZK7A 3I7TA 2YXZA 3EORA 2QA4F 3AGKA 4TV9A 4BVRA 1RLGA 3MCAB 3DDNA 2I6DA 2BTUA 3E1YA 1SA0A 1TVKA 3V7EA 3HKEA 4HNAA 3VOAA 1OFUA 3UT5A 5BMVB 3SIVA 3F0DA 1W3EX 2UYNB 5KX5A 3IKEA 2WALA 5CB4A 1PF5A 1R1MA 3VYUC 5CA1B 4E6EA 3CC2F 1YJWF 1KD1H 4ZHQA 3J7AR 2KG4A 3N2KB 2R6R1 1XHOA 1XRGA 3CCSF 3E22A 3NVIB 1X7PA 2H6LA 2H8CA 5LP6C 2JNBA 1CK2A 1W581 5HP8A 5HY0A 2ZVZA 5CA0B 3JATB 1Q82H 3JAMM 1SZQA 2VAMA 3HTNA 1VQ8F 1NMUB 5G4VC 1CLIA 4U39A 3RYFB 3D00A 2HP3A 3ZP7A 5KMGB 3ZP4A 4I4TB 1N8RH 2UYNA 2I6RA 5FNVA 3OW2F 3ESJA 5JVDB 4EI9A 4TV8A 1YJ9F 2ZVYA 2V9YA 4RHAA 3OBWA 5CA1A 4O2BB 1KC8H 3G4SF 3HKBB 1FSZA 4TUYB 3S0HA 3N2KA 4G4WA 1VQMF 4U3JB 1RQ2A 4BT2A 3CMEF 2ZF8A 5A2QM 1ZWZA 4TZZA 3KE1A 3TD5A 3ON1A 3S02A 4BVTA 4O2AB 3M84A 5CA0A 2CHTA 4BT7A 4LNUB 4NWOB 1Q81H 5LP6A 3WGNA 1E7KA 1T0AA 4EI7A 4FFBB 3RYFA 1H47A 4B45A 2R751 2F9ZC 5C8YB 1UFYA 5ITZB 1UI9A 3CC4F 1U3PA 3D54A 3P4EA 4O2BA 2LBWA 4G4VA 2Q1YA 1JFFA 1IV2A 2GLZA 1RA4A 2FC3A 4BT5A 4IIJA 4O4IA 2VAPA 5EIBD 5G4UC 2CWJA 4ERHA 3CCJF 3C9TA 3GYQA 3TD3A 5FJ4C 4O2AA 5IJ0B 1Q8RA 3OONA 4BT4A 1TUBB 3ELCA 5MN4A 1K73H 3JARA 3JAKA 3NK6A 4RQOA 3MCQA 5HP7A 3WGJA 4X20B 2HS3A 3F0EA 4FFBA 2UYKA 3IEQA 4YJ3A 2LCAA 1NQ3A 1H48A 5C8YA 2ZODA 1GX1A 1PXWA 5HWEA 5EZYA 3OBYA 4O4LB 3S0YA 5EAZA 5EO3A 2HS4A 1GO0A 1YIJF 2QEXF 3M1XA 4I50B 2ZAUA 3S0WA 1Z5VA 3M4SA 3F0FA 3T80A 3LWRC 4X1YB 2NMUA 2Z1TA 3D01A 3P10A 5GIOC 2KGWA 1QVFF 3K0TA 2DYYA 1U3LA 3FFMA 3N2GB 3GTZA 4IHJB 3SIUA 3FD5A 4ZI7B 5EB1B 1S72F 2RB9A 3KJJA 4BY9D 3CCEF 3RE3A 3NMUC 2AIFA 5BMVA 4O4LA 3VOBA 1K8AH 4C4WC 3JCMM 2B33A 1XBIA 4NQ3A 5IJ9B 3CCLF 2FGYA 2HP0B 1VH8A 4O4HB 4BT6A 4F6RB 1U43A
chains in the Genus database with same CATH topology
3FBAA 3P0ZA 4C8GA 3F0DA 2AMTA 4C8IA 1T0AA 4C8EA 1W55A 3IKEA 1W57A 1H47A 3F0GA 3JVHA 3K14A 1YQNA 1IV4A 1VHAA 1U40A 2PMPA 1JN1A 1IV1A 1JY8A 3ELCA 3GHZA 3IEWA 3FPIA 1U3PA 2UZHA 3MBMA 3Q8HA 3ERNA 2GZLA 5B8FA 1KNKA 3F0FA 3QHDA 3B6NA 3RE3A 3T80A 1IV3A 3F6MA 3KE1A 3K2XA 1IV2A 3EORA 3F0EA 4C81A 3ESJA 3IEQA 1H48A 3IKFA 3P10A 4C82A 1KNJA 1VH8A 1GX1A 1U43A 1U3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBA A;  3P0Z A;  4C8G A;  3F0D A;  2AMT A;  4C8I A;  1T0A A;  4C8E A;  1W55 A;  3IKE A;  1W57 A;  1H47 A;  3F0G A;  3JVH A;  3K14 A;  1YQN A;  1IV4 A;  1VHA A;  1U40 A;  2PMP A;  1JN1 A;  1IV1 A;  1JY8 A;  3ELC A;  3GHZ A;  3IEW A;  3FPI A;  1U3P A;  2UZH A;  3MBM A;  3Q8H A;  3ERN A;  2GZL A;  5B8F A;  1KNK A;  3F0F A;  3QHD A;  3B6N A;  3RE3 A;  3T80 A;  1IV3 A;  3F6M A;  3KE1 A;  3K2X A;  1IV2 A;  3EOR A;  3F0E A;  4C81 A;  3ESJ A;  3IEQ A;  1H48 A;  3IKF A;  3P10 A;  4C82 A;  1KNJ A;  1VH8 A;  1GX1 A;  1U43 A;  1U3L A; 
#chains in the Genus database with same CATH topology
 3RYH B;  2AMT A;  2IAF A;  1VQP F;  3KJK A;  1YGY A;  1H7M A;  1CN7 A;  3JAL B;  2OZB A;  3JVH A;  1W41 A;  2MQE A;  4X1Y A;  3MQW A;  5EYP B;  4EI8 A;  1W42 A;  2Q1X A;  4X3M A;  2HRY A;  4B5C A;  1GZ0 A;  3GHZ A;  1K9M H;  2UYJ A;  3MBM A;  3K12 A;  3ERN A;  5B8F A;  3N2G A;  1VQ6 F;  2IG8 A;  2RHH A;  4DXD A;  1XV2 A;  3CCM F;  1VQ5 F;  2BTQ B;  4IHJ A;  2QI2 A;  4ZI7 A;  4LCK A;  3JAT A;  3RYI B;  3KHN A;  3CG6 A;  5J2T B;  2KTV A;  1DBF A;  1OAP A;  1RQ7 A;  3RYC B;  3JAS B;  4I55 B;  3VYS C;  5GIN C;  5GAN K;  3PAF A;  3NK7 A;  1YHQ F;  1YIT F;  4G4Z A;  2HQS C;  2Z01 A;  3K14 A;  3WPW A;  2KTU A;  3HKD B;  5KMG A;  4I4T A;  1VHA A;  3V7Q A;  4ZHY B;  2PMP A;  1QU9 A;  4BVQ A;  4EB6 B;  3I55 F;  4DRX B;  5JVD A;  5IJ9 A;  1VQ4 F;  1X52 A;  3FPI A;  1ODE A;  3C9S A;  4O4H A;  4F6R A;  3IMP A;  3CB2 A;  3QHD A;  5GAP K;  1VK3 A;  4B62 A;  4G88 A;  1Z5W A;  3HKB A;  3C8L A;  4TUY A;  5GIP C;  4U3J A;  1KQS F;  3LWQ C;  2CVL A;  5EWR A;  3KIZ A;  3MDO A;  3CMA F;  1W5F A;  4YJ2 B;  5FLX M;  2CZW A;  1TVK B;  3CXC F;  3HKE B;  4HNA B;  1FFX B;  1QD9 A;  3N4Z A;  2EWC A;  3RYI A;  1X25 A;  2K1S A;  5KX5 B;  2BO1 A;  2PHN A;  2HRU A;  5J2T A;  4LNU A;  5CB4 B;  1VQ7 F;  5IYZ B;  3CCV F;  3F6M A;  3CCQ F;  1VQO F;  4XCQ A;  3LDT A;  4ZOL B;  3LWP C;  1JJ2 F;  2HX0 A;  2OTL F;  5HXU A;  1KNJ A;  4BVS A;  5ITZ A;  2GVI A;  4EB6 A;  4DRX A;  2ALE A;  4C8I A;  3RA5 A;  4C8E A;  3JAW B;  2ZOV A;  5LXT B;  3DC2 A;  5JH7 B;  1X7O A;  3CYP B;  4X1I B;  4X3L A;  1IV1 A;  3VIU A;  5JQG B;  1ONI A;  4X1K B;  2N48 A;  3WJP A;  5HY4 A;  1KNK A;  3B6N A;  4PWT A;  3J80 M;  3VI6 A;  2Z1E A;  4YJ2 A;  5HY2 A;  2IQQ A;  1QVG F;  2LBX A;  2CHS A;  1FFX A;  2DT4 A;  3CC7 F;  5EB0 A;  3VMF B;  1NJI H;  3NVK E;  5IJ0 A;  4BW0 B;  1TUB A;  5FNV B;  5IT9 M;  3WGK A;  5LOV B;  2OTJ F;  5LYJ B;  3VO8 A;  2VAW A;  4TV8 B;  5IYZ A;  2RHO A;  1IV4 A;  1W5A A;  1QAH A;  1VQL F;  4X20 A;  3CYQ A;  4ZOL A;  4NUT A;  5MN5 A;  3WGL A;  3HWU A;  3VYT C;  3V3T A;  3WJR A;  3S03 A;  4B46 A;  3CCU F;  1VQV A;  5GON B;  3JAW A;  5LXT A;  1VQN F;  5AVM A;  3HAX D;  5JH7 A;  4X1I A;  3WPX A;  1Q86 H;  3HKC B;  3VCZ A;  1W55 A;  3WJQ A;  4ZHW A;  2AIZ P;  3P0Z A;  5JQG A;  4X1K A;  1YJN F;  3I3F A;  2VXY A;  1FNK A;  4I50 A;  3C9R A;  1T0K B;  3ZOP A;  2W8B C;  1U40 A;  5LP6 B;  5JCO C;  3LWV C;  4BT3 A;  1W2B F;  3IR9 A;  3LFO A;  4ZHV A;  2OHW A;  3Q8H A;  1M1K H;  3CPW F;  3LYB A;  1W59 A;  2VGN A;  1Q7Y H;  3K2X A;  5LOV A;  5LA6 B;  5LYJ A;  1COM A;  3LWO C;  4WBN B;  5HXZ A;  2VGM A;  1YI2 F;  1GO1 A;  1RLU A;  4G4X A;  4O4J B;  1JFF B;  3WGM A;  3BYQ A;  4IIJ B;  4O4I B;  2G9I A;  3R0P A;  2QTP A;  5GON A;  5DCV A;  1JN1 A;  5EIB C;  3CD6 F;  3IEW A;  2UZH A;  5J2U B;  2HP0 A;  2P6Y A;  2HS0 A;  3TD4 A;  3HKC A;  2GZL A;  3RYH A;  1J7H A;  2YYE A;  3JAL A;  3JAR B;  1IPA A;  2BTO A;  3E20 B;  3JAK B;  2LBT A;  2HVY D;  4C82 A;  1SDS A;  5EYP A;  3U0O A;  4M8I A;  3WXM B;  3PLA C;  3O85 A;  3G71 F;  2L26 A;  1W5E A;  3C9U A;  3HJW C;  3J81 M;  3FBA A;  3LME A;  2Z1F A;  3ZO8 A;  2Z1U A;  2H8E A;  4YJ3 B;  1W57 A;  1W40 A;  2RHJ A;  3F0G A;  4TV9 B;  3I56 F;  1YQN A;  2CW4 A;  3VTI C;  1SA0 B;  1FNJ A;  5LA6 A;  2UYP A;  5EZY B;  3UT5 B;  5JCO A;  2OTM A;  4WBN A;  3G6E F;  4O4J A;  3RYC A;  5HY1 A;  3JAS A;  2CSL A;  4I55 A;  1IV3 A;  3CCR F;  1DT9 A;  4C81 A;  1JD1 A;  3IKF A;  3HKD A;  4ZHQ B;  3V4D A;  3RA6 A;  4G4Y A;  1W5B A;  2RHL A;  4KWE A;  4R40 B;  4C8G A;  5J2U A;  3CPQ A;  3L7Q A;  3QUW A;  3E22 B;  5MN6 A;  1M90 H;  3QTY A;  1VQ9 F;  3S06 A;  3FD6 A;  1JY8 A;  3N4Y A;  1VQK F;  4ZK7 A;  3I7T A;  2YXZ A;  3EOR A;  2QA4 F;  3AGK A;  4TV9 A;  4BVR A;  1RLG A;  3MCA B;  3DDN A;  2I6D A;  2BTU A;  3E1Y A;  1SA0 A;  1TVK A;  3V7E A;  3HKE A;  4HNA A;  3VOA A;  1OFU A;  3UT5 A;  5BMV B;  3SIV A;  3F0D A;  1W3E X;  2UYN B;  5KX5 A;  3IKE A;  2WAL A;  5CB4 A;  1PF5 A;  1R1M A;  3VYU C;  5CA1 B;  4E6E A;  3CC2 F;  1YJW F;  1KD1 H;  4ZHQ A;  3J7A R;  2KG4 A;  3N2K B;  2R6R 1;  1XHO A;  1XRG A;  3CCS F;  3E22 A;  3NVI B;  1X7P A;  2H6L A;  2H8C A;  5LP6 C;  2JNB A;  1CK2 A;  1W58 1;  5HP8 A;  5HY0 A;  2ZVZ A;  5CA0 B;  3JAT B;  1Q82 H;  3JAM M;  1SZQ A;  2VAM A;  3HTN A;  1VQ8 F;  1NMU B;  5G4V C;  1CLI A;  4U39 A;  3RYF B;  3D00 A;  2HP3 A;  3ZP7 A;  5KMG B;  3ZP4 A;  4I4T B;  1N8R H;  2UYN A;  2I6R A;  5FNV A;  3OW2 F;  3ESJ A;  5JVD B;  4EI9 A;  4TV8 A;  1YJ9 F;  2ZVY A;  2V9Y A;  4RHA A;  3OBW A;  5CA1 A;  4O2B B;  1KC8 H;  3G4S F;  3HKB B;  1FSZ A;  4TUY B;  3S0H A;  3N2K A;  4G4W A;  1VQM F;  4U3J B;  1RQ2 A;  4BT2 A;  3CME F;  2ZF8 A;  5A2Q M;  1ZWZ A;  4TZZ A;  3KE1 A;  3TD5 A;  3ON1 A;  3S02 A;  4BVT A;  4O2A B;  3M84 A;  5CA0 A;  2CHT A;  4BT7 A;  4LNU B;  4NWO B;  1Q81 H;  5LP6 A;  3WGN A;  1E7K A;  1T0A A;  4EI7 A;  4FFB B;  3RYF A;  1H47 A;  4B45 A;  2R75 1;  2F9Z C;  5C8Y B;  1UFY A;  5ITZ B;  1UI9 A;  3CC4 F;  1U3P A;  3D54 A;  3P4E A;  4O2B A;  2LBW A;  4G4V A;  2Q1Y A;  1JFF A;  1IV2 A;  2GLZ A;  1RA4 A;  2FC3 A;  4BT5 A;  4IIJ A;  4O4I A;  2VAP A;  5EIB D;  5G4U C;  2CWJ A;  4ERH A;  3CCJ F;  3C9T A;  3GYQ A;  3TD3 A;  5FJ4 C;  4O2A A;  5IJ0 B;  1Q8R A;  3OON A;  4BT4 A;  1TUB B;  3ELC A;  5MN4 A;  1K73 H;  3JAR A;  3JAK A;  3NK6 A;  4RQO A;  3MCQ A;  5HP7 A;  3WGJ A;  4X20 B;  2HS3 A;  3F0E A;  4FFB A;  2UYK A;  3IEQ A;  4YJ3 A;  2LCA A;  1NQ3 A;  1H48 A;  5C8Y A;  2ZOD A;  1GX1 A;  1PXW A;  5HWE A;  5EZY A;  3OBY A;  4O4L B;  3S0Y A;  5EAZ A;  5EO3 A;  2HS4 A;  1GO0 A;  1YIJ F;  2QEX F;  3M1X A;  4I50 B;  2ZAU A;  3S0W A;  1Z5V A;  3M4S A;  3F0F A;  3T80 A;  3LWR C;  4X1Y B;  2NMU A;  2Z1T A;  3D01 A;  3P10 A;  5GIO C;  2KGW A;  1QVF F;  3K0T A;  2DYY A;  1U3L A;  3FFM A;  3N2G B;  3GTZ A;  4IHJ B;  3SIU A;  3FD5 A;  4ZI7 B;  5EB1 B;  1S72 F;  2RB9 A;  3KJJ A;  4BY9 D;  3CCE F;  3RE3 A;  3NMU C;  2AIF A;  5BMV A;  4O4L A;  3VOB A;  1K8A H;  4C4W C;  3JCM M;  2B33 A;  1XBI A;  4NQ3 A;  5IJ9 B;  3CCL F;  2FGY A;  2HP0 B;  1VH8 A;  4O4H B;  4BT6 A;  4F6R B;  1U43 A; 
#chains in the Genus database with same CATH homology
 3FBA A;  3P0Z A;  4C8G A;  3F0D A;  2AMT A;  4C8I A;  1T0A A;  4C8E A;  1W55 A;  3IKE A;  1W57 A;  1H47 A;  3F0G A;  3JVH A;  3K14 A;  1YQN A;  1IV4 A;  1VHA A;  1U40 A;  2PMP A;  1JN1 A;  1IV1 A;  1JY8 A;  3ELC A;  3GHZ A;  3IEW A;  3FPI A;  1U3P A;  2UZH A;  3MBM A;  3Q8H A;  3ERN A;  2GZL A;  5B8F A;  1KNK A;  3F0F A;  3QHD A;  3B6N A;  3RE3 A;  3T80 A;  1IV3 A;  3F6M A;  3KE1 A;  3K2X A;  1IV2 A;  3EOR A;  3F0E A;  4C81 A;  3ESJ A;  3IEQ A;  1H48 A;  3IKF A;  3P10 A;  4C82 A;  1KNJ A;  1VH8 A;  1GX1 A;  1U43 A;  1U3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...