3CC2F

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc2F00
2I6DA 3HAXD 3V7EA 3J7AR 1YJNF 3I56F 3CPQA 3LWOC 5FJ4C 1YJ9F 1GZ0A 3VMFB 1NJIH 1KD1H 1Q7YH 3FFMA 3NVKE 4LCKA 3ON1A 2WALA 1T0KB 1K9MH 3CCRF 2ALEA 1Q82H 3N4YA 2LBXA 1VQLF 3RA6A 1RLGA 4BY9D 4TZZA 2JNBA 3JAMM 2KTVA 3CG6A 2OZBA 1N8RH 3CMEF 1VQNF 1VQ5F 1KQSF 3G4SF 1IPAA 1VQ8F 3CCJF 2OHWA 1VQMF 2AIFA 3G71F 3LFOA 1YHQF 3CCVF 3O85A 3JCMM 1W2BF 2QI2A 2CZWA 3I55F 3PLAC 3NK7A 3J80M 5DCVA 3N4ZA 5GINC 3PAFA 5GIOC 3CPWF 3IR9A 1VQ9F 3OBWA 3LWQC 3LWVC 3CCEF 3VI6A 5GANK 3CC2F 5GAPK 3OW2F 1YITF 1X7PA 4X3LA 2QEXF 3CMAF 5FLXM 3LWRC 2QA4F 1KC8H 1XBIA 3E1YA 3GYQA 3RA5A 1W3EX 1QVGF 1VQ7F 1GO1A 1VQKF 2VGNA 3CCMF 1K8AH 1M90H 3NVIB 2KTUA 1YIJF 3CCSF 1M1KH 3CCUF 1W40A 1PXWA 1X7OA 3NK6A 2OTLF 2LBWA 3J81M 5G4VC 1DT9A 2HVYD 1ZWZA 5A2QM 2KG4A 2VGMA 1H7MA 1W42A 2FC3A 1K73H 2OTJF 1GO0A 3HJWC 3CD6F 1CN7A 1SDSA 1VQOF 3OBYA 3E20B 1YJWF 5G4UC 3CXCF 1S72F 1Q86H 3CC7F 3V7QA 2BO1A 5EWRA 5GIPC 1Q81H 1RA4A 3SIVA 1W41A 3WXMB 5IT9M 1VQ6F 4C4WC 5EO3A 4BW0B 3SIUA 3LWPC 3G6EF 1VQ4F 1YI2F 1NMUB 1X52A 4X3MA 1JJ2F 3CC4F 3NMUC 1QVFF 3CCLF 3MCAB 3CCQF 1CK2A 1VQPF 1E7KA 3AGKA 4NUTA
chains in the Genus database with same CATH superfamily
2Z01A 2IG8A 3EORA 5EYPA 4BT2A 3LWOC 5HY4A 4B45A 5FJ4C 2QTPA 3FBAA 3JARB 5J2UA 5KX5A 5HY2A 3R0PA 3VYUC 5LP6B 1KD1H 3MQWA 2UYJA 4O4JA 3P0ZA 2Z1FA 5KMGB 4C82A 4DXDA 1JN1A 3RYFB 5CA1A 2LBXA 4HNAA 2UYNB 1RLGA 3MBMA 1JD1A 4TZZA 4BY9D 2JNBA 2VAPA 4O4LB 3T80A 2OZBA 3FD6A 3CMEF 1VQNF 4BVTA 1KNJA 4DRXB 1VQMF 3MCQA 3LFOA 4NQ3A 5LYJA 1YHQF 3JAWA 3V4DA 4I4TB 3JCMM 3RYCB 1XRGA 2EWCA 3F0EA 2BTUA 5GIOC 3P4EA 3CPWF 3HKCA 3LWQC 5J2UB 2PHNA 5IJ0B 3CYPB 1IV1A 4C8IA 4E6EA 3S0YA 1T0AA 3OW2F 1YITF 3N2KA 4X3LA 5CA0B 5FLXM 2LCAA 4O2AB 1XBIA 3UT5A 4ZHYB 1X25A 1FNJA 3E1YA 4O4JB 4G4ZA 3RA5A 3VYSC 1QVGF 1GO1A 1IV2A 2VGNA 3CCMF 5CA1B 3NVIB 1DBFA 1TVKB 3S0WA 2RHOA 4X20B 3HKEA 2H8CA 3FPIA 3C9UA 5HWEA 3TD3A 3D01A 1X7OA 4BT3A 4EI8A 3JVHA 4C8GA 3J81M 5GONA 1UFYA 5G4VC 1ZWZA 5EZYA 4EI9A 2OTMA 5JVDA 1QD9A 5LYJB 4C8EA 3JAWB 3VCZA 5JH7B 1K73H 3HJWC 4I50B 4WBNB 3CD6F 1VQOF 5G4UC 2Z1EA 1Q86H 2BO1A 3ZP7A 3C8LA 3VOAA 5GIPC 1Q81H 4G4YA 2PMPA 2HP0B 2Q1XA 3WGNA 5LP6A 4BW0B 1RQ2A 2ZVYA 4EI7A 1NMUB 2H6LA 3TD5A 5KMGA 3S03A 1UI9A 5ITZA 3E22B 2CHTA 3N2KB 2N48A 2UYNA 3K2XA 3HAXD 3V7EA 3J7AR 1YJNF 3I56F 3CPQA 5EB0A 4O4LA 2GVIA 3TD4A 1PF5A 1SA0A 1YJ9F 1GZ0A 5EIBC 5JCOC 1W5BA 4DRXA 1U3PA 3WGKA 4I55B 4X1YA 2ALEA 3N4YA 4I4TA 4ZI7B 5BMVA 4B46A 3RYCA 3CB2A 5EZYB 1QU9A 5HXZA 3CG6A 2CW4A 2GLZA 5JVDB 3JASB 1N8RH 3VIUA 3ZOPA 4G4WA 1IPAA 3CCJF 5EB1B 4NWOB 1J7HA 2V9YA 1JY8A 3VO8A 5IJ0A 2OHWA 3D54A 3G71F 3K0TA 1W5FA 5CA0A 5LA6B 1W581 2QI2A 2CZWA 4O2AA 1GX1A 4X1KA 4O2BB 3JATB 5ITZB 3NK7A 1TVKA 3F0FA 3ERNA 4IIJB 3ESJA 2ZF8A 4TV9A 4X20A 4ZHQA 5HP8A 3CCEF 1SA0B 2UYKA 1FFXB 3QUWA 3WJRA 4ERHA 1W3EX 1VQ7F 5FNVA 4TV8B 1VQKF 2FGYA 4X1YB 1K8AH 1YIJF 5JH7A 4IHJA 4O4HB 1M1KH 4YJ3B 4I50A 5BMVB 3CCUF 3P10A 2W8BC 3VTIC 4WBNA 1PXWA 2HX0A 4M8IA 1VK3A 3RYIB 2HP0A 2OTLF 4X1IA 1KNKA 2HVYD 5EIBD 3QHDA 3IKFA 5CB4A 3E22A 2I6RA 4ZK7A 3OBYA 3E20B 4X1KB 3CXCF 1S72F 1TUBB 2HRYA 5EWRA 1SZQA 4LNUB 2K1SA 2VAMA 3L7QA 3N2GB 2VAWA 4TV9B 2Q1YA 3Q8HA 1R1MA 4G4VA 4ZHQB 1VQ6F 1RQ7A 1VQ4F 3HKBB 3NMUC 1QVFF 4PWTA 3CCLF 1U3LA 2ZODA 5IYZB 3MCAB 4BT7A 1CK2A 4I55A 3CCQF 1VQPF 3AGKA 2I6DA 3WGLA 4ZI7A 5LXTB 3I7TA 5FNVB 4F6RA 1JFFA 3HTNA 3JASA 4IHJB 5J2TB 3GHZA 3JAKB 1Z5WA 3VMFB 5HXUA 1NJIH 1Q7YH 3FFMA 3NVKE 3ON1A 2RHJA 3WPWA 3WJQA 1NQ3A 3C9TA 1K9MH 3HWUA 4YJ2B 1W59A 1Q82H 2L26A 4X1IB 5LA6A 1VQLF 5MN4A 1OFUA 3JAMM 3OONA 4O2BA 3JATA 5C8YB 3C9SA 5CB4B 1W55A 3QTYA 2IQQA 3FD5A 3KE1A 3WPXA 4IIJA 1KQSF 3G4SF 2DT4A 3S02A 3LMEA 3CYQA 2ZVZA 2H8EA 1FSZA 1FFXA 1Z5VA 1RLUA 3VYTC 4TV8A 3ZP4A 4G4XA 3J80M 3KJJA 5DCVA 4O4HA 3JALB 4YJ3A 4B62A 5GINC 3IR9A 1VQ9F 4F6RB 2HQSC 3IEWA 1JFFB 2Z1UA 5LOVB 2HS0A 1IV4A 3VI6A 3V3TA 5GANK 1YQNA 1W57A 3CC2F 3S0HA 3RYIA 4R40B 5MN5A 3GYQA 2AIZP 2KTUA 2Z1TA 3RE3A 2P6YA 1VHAA 2HS4A 1U43A 1W40A 3LYBA 5MN6A 1TUBA 4O4IA 1W5AA 3F6MA 4LNUA 2GZLA 3K14A 3N2GA 5JCOA 3NK6A 1COMA 3HKBA 4U3JB 1DT9A 4TUYA 1H7MA 1W5EA 3M84A 5IYZA 1W42A 4G88A 2FC3A 4ZOLB 1IV3A 2HP3A 1CN7A 2F9ZC 5LXTA 3DC2A 2IAFA 3CC7F 3V7QA 4KWEA 1RA4A 2UZHA 5J2TA 5HY1A 3JAKA 4ZHVA 5IT9M 4C4WC 3SIUA 3G6EF 1QAHA 1YI2F 4X3MA 3CC4F 2G9IA 1U40A 1E7KA 4YJ2A 3BYQA 1OAPA 3S06A 2YXZA 2RHHA 5C8YA 3RYHB 3M1XA 2VXYA 5EAZA 5JQGB 4BVQA 2ZOVA 3D00A 4LCKA 4O4IB 2WALA 4FFBB 1T0KB 2BTOA 3U0OA 3CCRF 2ZAUA 3RA6A 4TUYB 2KTVA 5EYPB 4EB6A 5KX5B 1ODEA 2LBTA 3DDNA 1VQ5F 3WJPA 3JALA 4C81A 2CHSA 1VQ8F 2NMUA 3I3FA 5LP6C 5HY0A 2HRUA 3K12A 3C9RA 4BVSA 5LOVA 3ZO8A 1VH8A 3WGJA 3IEQA 5HP7A 2AIFA 4BT4A 5B8FA 3CCVF 4HNAB 3O85A 3LDTA 1VQVA 3WGMA 1CLIA 1XV2A 1W2BF 2HS3A 2RB9A 2DYYA 3F0DA 4ZHWA 2BTQB 3I55F 3PLAC 2B33A 2R6R1 5IJ9A 3N4ZA 3PAFA 3OBWA 4U39A 3LWVC 3HKDA 1FNKA 4BVRA 5GAPK 1X7PA 2QEXF 3CMAF 3LWRC 1KC8H 2QA4F 4U3JA 3MDOA 1H48A 4XCQA 3M4SA 1YGYA 3IMPA 3KHNA 1M90H 1Q8RA 3JARA 3CCSF 2CVLA 2CWJA 3GTZA 4ZOLA 3HKCB 3KIZA 4EB6B 2CSLA 4RQOA 2RHLA 2R751 3RYFA 4RHAA 2LBWA 3UT5B 3B6NA 1XHOA 5A2QM 3VOBA 2KG4A 2VGMA 2KGWA 2OTJF 1GO0A 1SDSA 1YJWF 3HKEB 3IKEA 2MQEA 3RYHA 3F0GA 5AVMA 2AMTA 5IJ9B 1ONIA 3ELCA 3SIVA 4BT6A 1W41A 5JQGA 3WXMB 4BT5A 5EO3A 4B5CA 3LWPC 1H47A 5GONB 3KJKA 3HKDB 1X52A 4FFBA 1JJ2F 2YYEA 2UYPA 4NUTA
chains in the Genus database with same CATH topology
2I6DA 3HAXD 3V7EA 3J7AR 1YJNF 3I56F 3CPQA 3LWOC 5HY4A 5FJ4C 5HY2A 1YJ9F 1GZ0A 3VMFB 5HXUA 4BVQA 1Q7YH 1NJIH 3FFMA 1KD1H 3D00A 3NVKE 4LCKA 3ON1A 2WALA 1T0KB 1K9MH 3CCRF 2ALEA 1Q82H 3N4YA 2LBXA 1VQLF 3RA6A 1RLGA 4BY9D 4TZZA 2JNBA 3JAMM 2KTVA 5HXZA 3CG6A 2GLZA 2OZBA 1N8RH 3CMEF 1VQNF 1VQ5F 1KQSF 4BVTA 3G4SF 1IPAA 5HY0A 1VQ8F 3CCJF 4BVSA 2OHWA 1VQMF 2AIFA 3G71F 3LFOA 4NQ3A 1YHQF 3CCVF 3O85A 3JCMM 1W2BF 2QI2A 2CZWA 3I55F 3PLAC 3NK7A 3J80M 5DCVA 3N4ZA 5GINC 3PAFA 5GIOC 3CPWF 3IR9A 1VQ9F 3OBWA 3LWQC 3LWVC 4BVRA 3CCEF 3VI6A 3V3TA 5GANK 3CC2F 5GAPK 3OW2F 1YITF 1X7PA 4X3LA 2QEXF 3CMAF 5FLXM 3LWRC 2QA4F 1KC8H 1XBIA 3E1YA 3GYQA 3RA5A 1W3EX 4XCQA 1QVGF 1VQ7F 1GO1A 1VQKF 2FGYA 2VGNA 3CCMF 1K8AH 1M90H 3NVIB 2KTUA 1YIJF 3CCSF 1M1KH 3CCUF 1W40A 1PXWA 5HWEA 1X7OA 4EI8A 3NK6A 2OTLF 2LBWA 3J81M 5G4VC 1DT9A 2HVYD 1ZWZA 4EI9A 5A2QM 2KG4A 2VGMA 1H7MA 1W42A 2FC3A 1K73H 2OTJF 1GO0A 3HJWC 3CD6F 1CN7A 1SDSA 1VQOF 3OBYA 2F9ZC 3E20B 1YJWF 5G4UC 3CXCF 1S72F 1Q86H 3CC7F 3V7QA 2BO1A 5EWRA 5GIPC 1Q81H 1RA4A 3SIVA 1W41A 5HY1A 3WXMB 5IT9M 1VQ6F 4C4WC 5EO3A 4BW0B 3SIUA 3LWPC 3G6EF 4EI7A 1VQ4F 1YI2F 1NMUB 1X52A 4X3MA 1JJ2F 3CC4F 3NMUC 1QVFF 3CCLF 3MCAB 3CCQF 1CK2A 1VQPF 1E7KA 3AGKA 4NUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  3HAX D;  3V7E A;  3J7A R;  1YJN F;  3I56 F;  3CPQ A;  3LWO C;  5FJ4 C;  1YJ9 F;  1GZ0 A;  3VMF B;  1NJI H;  1KD1 H;  1Q7Y H;  3FFM A;  3NVK E;  4LCK A;  3ON1 A;  2WAL A;  1T0K B;  1K9M H;  3CCR F;  2ALE A;  1Q82 H;  3N4Y A;  2LBX A;  1VQL F;  3RA6 A;  1RLG A;  4BY9 D;  4TZZ A;  2JNB A;  3JAM M;  2KTV A;  3CG6 A;  2OZB A;  1N8R H;  3CME F;  1VQN F;  1VQ5 F;  1KQS F;  3G4S F;  1IPA A;  1VQ8 F;  3CCJ F;  2OHW A;  1VQM F;  2AIF A;  3G71 F;  3LFO A;  1YHQ F;  3CCV F;  3O85 A;  3JCM M;  1W2B F;  2QI2 A;  2CZW A;  3I55 F;  3PLA C;  3NK7 A;  3J80 M;  5DCV A;  3N4Z A;  5GIN C;  3PAF A;  5GIO C;  3CPW F;  3IR9 A;  1VQ9 F;  3OBW A;  3LWQ C;  3LWV C;  3CCE F;  3VI6 A;  5GAN K;  3CC2 F;  5GAP K;  3OW2 F;  1YIT F;  1X7P A;  4X3L A;  2QEX F;  3CMA F;  5FLX M;  3LWR C;  2QA4 F;  1KC8 H;  1XBI A;  3E1Y A;  3GYQ A;  3RA5 A;  1W3E X;  1QVG F;  1VQ7 F;  1GO1 A;  1VQK F;  2VGN A;  3CCM F;  1K8A H;  1M90 H;  3NVI B;  2KTU A;  1YIJ F;  3CCS F;  1M1K H;  3CCU F;  1W40 A;  1PXW A;  1X7O A;  3NK6 A;  2OTL F;  2LBW A;  3J81 M;  5G4V C;  1DT9 A;  2HVY D;  1ZWZ A;  5A2Q M;  2KG4 A;  2VGM A;  1H7M A;  1W42 A;  2FC3 A;  1K73 H;  2OTJ F;  1GO0 A;  3HJW C;  3CD6 F;  1CN7 A;  1SDS A;  1VQO F;  3OBY A;  3E20 B;  1YJW F;  5G4U C;  3CXC F;  1S72 F;  1Q86 H;  3CC7 F;  3V7Q A;  2BO1 A;  5EWR A;  5GIP C;  1Q81 H;  1RA4 A;  3SIV A;  1W41 A;  3WXM B;  5IT9 M;  1VQ6 F;  4C4W C;  5EO3 A;  4BW0 B;  3SIU A;  3LWP C;  3G6E F;  1VQ4 F;  1YI2 F;  1NMU B;  1X52 A;  4X3M A;  1JJ2 F;  3CC4 F;  3NMU C;  1QVF F;  3CCL F;  3MCA B;  3CCQ F;  1CK2 A;  1VQP F;  1E7K A;  3AGK A;  4NUT A; 
#chains in the Genus database with same CATH topology
 2Z01 A;  2IG8 A;  3EOR A;  5EYP A;  4BT2 A;  3LWO C;  5HY4 A;  4B45 A;  5FJ4 C;  2QTP A;  3FBA A;  3JAR B;  5J2U A;  5KX5 A;  5HY2 A;  3R0P A;  3VYU C;  5LP6 B;  1KD1 H;  3MQW A;  2UYJ A;  4O4J A;  3P0Z A;  2Z1F A;  5KMG B;  4C82 A;  4DXD A;  1JN1 A;  3RYF B;  5CA1 A;  2LBX A;  4HNA A;  2UYN B;  1RLG A;  3MBM A;  1JD1 A;  4TZZ A;  4BY9 D;  2JNB A;  2VAP A;  4O4L B;  3T80 A;  2OZB A;  3FD6 A;  3CME F;  1VQN F;  4BVT A;  1KNJ A;  4DRX B;  1VQM F;  3MCQ A;  3LFO A;  4NQ3 A;  5LYJ A;  1YHQ F;  3JAW A;  3V4D A;  4I4T B;  3JCM M;  3RYC B;  1XRG A;  2EWC A;  3F0E A;  2BTU A;  5GIO C;  3P4E A;  3CPW F;  3HKC A;  3LWQ C;  5J2U B;  2PHN A;  5IJ0 B;  3CYP B;  1IV1 A;  4C8I A;  4E6E A;  3S0Y A;  1T0A A;  3OW2 F;  1YIT F;  3N2K A;  4X3L A;  5CA0 B;  5FLX M;  2LCA A;  4O2A B;  1XBI A;  3UT5 A;  4ZHY B;  1X25 A;  1FNJ A;  3E1Y A;  4O4J B;  4G4Z A;  3RA5 A;  3VYS C;  1QVG F;  1GO1 A;  1IV2 A;  2VGN A;  3CCM F;  5CA1 B;  3NVI B;  1DBF A;  1TVK B;  3S0W A;  2RHO A;  4X20 B;  3HKE A;  2H8C A;  3FPI A;  3C9U A;  5HWE A;  3TD3 A;  3D01 A;  1X7O A;  4BT3 A;  4EI8 A;  3JVH A;  4C8G A;  3J81 M;  5GON A;  1UFY A;  5G4V C;  1ZWZ A;  5EZY A;  4EI9 A;  2OTM A;  5JVD A;  1QD9 A;  5LYJ B;  4C8E A;  3JAW B;  3VCZ A;  5JH7 B;  1K73 H;  3HJW C;  4I50 B;  4WBN B;  3CD6 F;  1VQO F;  5G4U C;  2Z1E A;  1Q86 H;  2BO1 A;  3ZP7 A;  3C8L A;  3VOA A;  5GIP C;  1Q81 H;  4G4Y A;  2PMP A;  2HP0 B;  2Q1X A;  3WGN A;  5LP6 A;  4BW0 B;  1RQ2 A;  2ZVY A;  4EI7 A;  1NMU B;  2H6L A;  3TD5 A;  5KMG A;  3S03 A;  1UI9 A;  5ITZ A;  3E22 B;  2CHT A;  3N2K B;  2N48 A;  2UYN A;  3K2X A;  3HAX D;  3V7E A;  3J7A R;  1YJN F;  3I56 F;  3CPQ A;  5EB0 A;  4O4L A;  2GVI A;  3TD4 A;  1PF5 A;  1SA0 A;  1YJ9 F;  1GZ0 A;  5EIB C;  5JCO C;  1W5B A;  4DRX A;  1U3P A;  3WGK A;  4I55 B;  4X1Y A;  2ALE A;  3N4Y A;  4I4T A;  4ZI7 B;  5BMV A;  4B46 A;  3RYC A;  3CB2 A;  5EZY B;  1QU9 A;  5HXZ A;  3CG6 A;  2CW4 A;  2GLZ A;  5JVD B;  3JAS B;  1N8R H;  3VIU A;  3ZOP A;  4G4W A;  1IPA A;  3CCJ F;  5EB1 B;  4NWO B;  1J7H A;  2V9Y A;  1JY8 A;  3VO8 A;  5IJ0 A;  2OHW A;  3D54 A;  3G71 F;  3K0T A;  1W5F A;  5CA0 A;  5LA6 B;  1W58 1;  2QI2 A;  2CZW A;  4O2A A;  1GX1 A;  4X1K A;  4O2B B;  3JAT B;  5ITZ B;  3NK7 A;  1TVK A;  3F0F A;  3ERN A;  4IIJ B;  3ESJ A;  2ZF8 A;  4TV9 A;  4X20 A;  4ZHQ A;  5HP8 A;  3CCE F;  1SA0 B;  2UYK A;  1FFX B;  3QUW A;  3WJR A;  4ERH A;  1W3E X;  1VQ7 F;  5FNV A;  4TV8 B;  1VQK F;  2FGY A;  4X1Y B;  1K8A H;  1YIJ F;  5JH7 A;  4IHJ A;  4O4H B;  1M1K H;  4YJ3 B;  4I50 A;  5BMV B;  3CCU F;  3P10 A;  2W8B C;  3VTI C;  4WBN A;  1PXW A;  2HX0 A;  4M8I A;  1VK3 A;  3RYI B;  2HP0 A;  2OTL F;  4X1I A;  1KNK A;  2HVY D;  5EIB D;  3QHD A;  3IKF A;  5CB4 A;  3E22 A;  2I6R A;  4ZK7 A;  3OBY A;  3E20 B;  4X1K B;  3CXC F;  1S72 F;  1TUB B;  2HRY A;  5EWR A;  1SZQ A;  4LNU B;  2K1S A;  2VAM A;  3L7Q A;  3N2G B;  2VAW A;  4TV9 B;  2Q1Y A;  3Q8H A;  1R1M A;  4G4V A;  4ZHQ B;  1VQ6 F;  1RQ7 A;  1VQ4 F;  3HKB B;  3NMU C;  1QVF F;  4PWT A;  3CCL F;  1U3L A;  2ZOD A;  5IYZ B;  3MCA B;  4BT7 A;  1CK2 A;  4I55 A;  3CCQ F;  1VQP F;  3AGK A;  2I6D A;  3WGL A;  4ZI7 A;  5LXT B;  3I7T A;  5FNV B;  4F6R A;  1JFF A;  3HTN A;  3JAS A;  4IHJ B;  5J2T B;  3GHZ A;  3JAK B;  1Z5W A;  3VMF B;  5HXU A;  1NJI H;  1Q7Y H;  3FFM A;  3NVK E;  3ON1 A;  2RHJ A;  3WPW A;  3WJQ A;  1NQ3 A;  3C9T A;  1K9M H;  3HWU A;  4YJ2 B;  1W59 A;  1Q82 H;  2L26 A;  4X1I B;  5LA6 A;  1VQL F;  5MN4 A;  1OFU A;  3JAM M;  3OON A;  4O2B A;  3JAT A;  5C8Y B;  3C9S A;  5CB4 B;  1W55 A;  3QTY A;  2IQQ A;  3FD5 A;  3KE1 A;  3WPX A;  4IIJ A;  1KQS F;  3G4S F;  2DT4 A;  3S02 A;  3LME A;  3CYQ A;  2ZVZ A;  2H8E A;  1FSZ A;  1FFX A;  1Z5V A;  1RLU A;  3VYT C;  4TV8 A;  3ZP4 A;  4G4X A;  3J80 M;  3KJJ A;  5DCV A;  4O4H A;  3JAL B;  4YJ3 A;  4B62 A;  5GIN C;  3IR9 A;  1VQ9 F;  4F6R B;  2HQS C;  3IEW A;  1JFF B;  2Z1U A;  5LOV B;  2HS0 A;  1IV4 A;  3VI6 A;  3V3T A;  5GAN K;  1YQN A;  1W57 A;  3CC2 F;  3S0H A;  3RYI A;  4R40 B;  5MN5 A;  3GYQ A;  2AIZ P;  2KTU A;  2Z1T A;  3RE3 A;  2P6Y A;  1VHA A;  2HS4 A;  1U43 A;  1W40 A;  3LYB A;  5MN6 A;  1TUB A;  4O4I A;  1W5A A;  3F6M A;  4LNU A;  2GZL A;  3K14 A;  3N2G A;  5JCO A;  3NK6 A;  1COM A;  3HKB A;  4U3J B;  1DT9 A;  4TUY A;  1H7M A;  1W5E A;  3M84 A;  5IYZ A;  1W42 A;  4G88 A;  2FC3 A;  4ZOL B;  1IV3 A;  2HP3 A;  1CN7 A;  2F9Z C;  5LXT A;  3DC2 A;  2IAF A;  3CC7 F;  3V7Q A;  4KWE A;  1RA4 A;  2UZH A;  5J2T A;  5HY1 A;  3JAK A;  4ZHV A;  5IT9 M;  4C4W C;  3SIU A;  3G6E F;  1QAH A;  1YI2 F;  4X3M A;  3CC4 F;  2G9I A;  1U40 A;  1E7K A;  4YJ2 A;  3BYQ A;  1OAP A;  3S06 A;  2YXZ A;  2RHH A;  5C8Y A;  3RYH B;  3M1X A;  2VXY A;  5EAZ A;  5JQG B;  4BVQ A;  2ZOV A;  3D00 A;  4LCK A;  4O4I B;  2WAL A;  4FFB B;  1T0K B;  2BTO A;  3U0O A;  3CCR F;  2ZAU A;  3RA6 A;  4TUY B;  2KTV A;  5EYP B;  4EB6 A;  5KX5 B;  1ODE A;  2LBT A;  3DDN A;  1VQ5 F;  3WJP A;  3JAL A;  4C81 A;  2CHS A;  1VQ8 F;  2NMU A;  3I3F A;  5LP6 C;  5HY0 A;  2HRU A;  3K12 A;  3C9R A;  4BVS A;  5LOV A;  3ZO8 A;  1VH8 A;  3WGJ A;  3IEQ A;  5HP7 A;  2AIF A;  4BT4 A;  5B8F A;  3CCV F;  4HNA B;  3O85 A;  3LDT A;  1VQV A;  3WGM A;  1CLI A;  1XV2 A;  1W2B F;  2HS3 A;  2RB9 A;  2DYY A;  3F0D A;  4ZHW A;  2BTQ B;  3I55 F;  3PLA C;  2B33 A;  2R6R 1;  5IJ9 A;  3N4Z A;  3PAF A;  3OBW A;  4U39 A;  3LWV C;  3HKD A;  1FNK A;  4BVR A;  5GAP K;  1X7P A;  2QEX F;  3CMA F;  3LWR C;  1KC8 H;  2QA4 F;  4U3J A;  3MDO A;  1H48 A;  4XCQ A;  3M4S A;  1YGY A;  3IMP A;  3KHN A;  1M90 H;  1Q8R A;  3JAR A;  3CCS F;  2CVL A;  2CWJ A;  3GTZ A;  4ZOL A;  3HKC B;  3KIZ A;  4EB6 B;  2CSL A;  4RQO A;  2RHL A;  2R75 1;  3RYF A;  4RHA A;  2LBW A;  3UT5 B;  3B6N A;  1XHO A;  5A2Q M;  3VOB A;  2KG4 A;  2VGM A;  2KGW A;  2OTJ F;  1GO0 A;  1SDS A;  1YJW F;  3HKE B;  3IKE A;  2MQE A;  3RYH A;  3F0G A;  5AVM A;  2AMT A;  5IJ9 B;  1ONI A;  3ELC A;  3SIV A;  4BT6 A;  1W41 A;  5JQG A;  3WXM B;  4BT5 A;  5EO3 A;  4B5C A;  3LWP C;  1H47 A;  5GON B;  3KJK A;  3HKD B;  1X52 A;  4FFB A;  1JJ2 F;  2YYE A;  2UYP A;  4NUT A; 
#chains in the Genus database with same CATH homology
 2I6D A;  3HAX D;  3V7E A;  3J7A R;  1YJN F;  3I56 F;  3CPQ A;  3LWO C;  5HY4 A;  5FJ4 C;  5HY2 A;  1YJ9 F;  1GZ0 A;  3VMF B;  5HXU A;  4BVQ A;  1Q7Y H;  1NJI H;  3FFM A;  1KD1 H;  3D00 A;  3NVK E;  4LCK A;  3ON1 A;  2WAL A;  1T0K B;  1K9M H;  3CCR F;  2ALE A;  1Q82 H;  3N4Y A;  2LBX A;  1VQL F;  3RA6 A;  1RLG A;  4BY9 D;  4TZZ A;  2JNB A;  3JAM M;  2KTV A;  5HXZ A;  3CG6 A;  2GLZ A;  2OZB A;  1N8R H;  3CME F;  1VQN F;  1VQ5 F;  1KQS F;  4BVT A;  3G4S F;  1IPA A;  5HY0 A;  1VQ8 F;  3CCJ F;  4BVS A;  2OHW A;  1VQM F;  2AIF A;  3G71 F;  3LFO A;  4NQ3 A;  1YHQ F;  3CCV F;  3O85 A;  3JCM M;  1W2B F;  2QI2 A;  2CZW A;  3I55 F;  3PLA C;  3NK7 A;  3J80 M;  5DCV A;  3N4Z A;  5GIN C;  3PAF A;  5GIO C;  3CPW F;  3IR9 A;  1VQ9 F;  3OBW A;  3LWQ C;  3LWV C;  4BVR A;  3CCE F;  3VI6 A;  3V3T A;  5GAN K;  3CC2 F;  5GAP K;  3OW2 F;  1YIT F;  1X7P A;  4X3L A;  2QEX F;  3CMA F;  5FLX M;  3LWR C;  2QA4 F;  1KC8 H;  1XBI A;  3E1Y A;  3GYQ A;  3RA5 A;  1W3E X;  4XCQ A;  1QVG F;  1VQ7 F;  1GO1 A;  1VQK F;  2FGY A;  2VGN A;  3CCM F;  1K8A H;  1M90 H;  3NVI B;  2KTU A;  1YIJ F;  3CCS F;  1M1K H;  3CCU F;  1W40 A;  1PXW A;  5HWE A;  1X7O A;  4EI8 A;  3NK6 A;  2OTL F;  2LBW A;  3J81 M;  5G4V C;  1DT9 A;  2HVY D;  1ZWZ A;  4EI9 A;  5A2Q M;  2KG4 A;  2VGM A;  1H7M A;  1W42 A;  2FC3 A;  1K73 H;  2OTJ F;  1GO0 A;  3HJW C;  3CD6 F;  1CN7 A;  1SDS A;  1VQO F;  3OBY A;  2F9Z C;  3E20 B;  1YJW F;  5G4U C;  3CXC F;  1S72 F;  1Q86 H;  3CC7 F;  3V7Q A;  2BO1 A;  5EWR A;  5GIP C;  1Q81 H;  1RA4 A;  3SIV A;  1W41 A;  5HY1 A;  3WXM B;  5IT9 M;  1VQ6 F;  4C4W C;  5EO3 A;  4BW0 B;  3SIU A;  3LWP C;  3G6E F;  4EI7 A;  1VQ4 F;  1YI2 F;  1NMU B;  1X52 A;  4X3M A;  1JJ2 F;  3CC4 F;  3NMU C;  1QVF F;  3CCL F;  3MCA B;  3CCQ F;  1CK2 A;  1VQP F;  1E7K A;  3AGK A;  4NUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...