3CC2F

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc2F00
3CD6F 3NK6A 5GAPK 4LCKA 2QA4F 1SDSA 3J81M 1K9MH 3LWOC 3J80M 4C4WC 1VQOF 1QVGF 1X7OA 2KTUA 3JAMM 1W40A 3CCSF 3CPWF 1M1KH 3HAXD 1X52A 2OZBA 3LWQC 2FC3A 3G6EF 1W2BF 3NVKE 3LWVC 3SIUA 5DCVA 1VQ5F 1YJ9F 1S72F 1NMUB 3RA6A 3CCJF 1Q81H 3MCAB 5GINC 3E20B 1VQ8F 3OW2F 2LBXA 2QI2A 1VQ9F 1GO1A 1W3EX 1W41A 2AIFA 1E7KA 1K73H 3N4ZA 2WALA 4X3MA 3CCRF 3CCEF 1YJNF 1VQ4F 1ZWZA 3O85A 1VQNF 1RA4A 3CC2F 3PAFA 3CCVF 3CXCF 3RA5A 1N8RH 1M90H 1VQKF 1VQ7F 4BW0B 2LBWA 3AGKA 3CCLF 3CCQF 3CG6A 1PXWA 3GYQA 1YI2F 3CPQA 2I6DA 1KQSF 1KD1H 3N4YA 3NMUC 2KG4A 1YITF 1H7MA 3NVIB 5FLXM 1NJIH 1VQLF 3OBYA 3V7QA 5EWRA 3V7EA 3NK7A 3I56F 3LFOA 4TZZA 2HVYD 1XBIA 1W42A 2VGNA 1Q86H 1CN7A 3G71F 3JCMM 1K8AH 1KC8H 4X3LA 5GIOC 5GANK 3WXMB 2ALEA 3IR9A 2OHWA 1VQMF 1T0KB 5FJ4C 3ON1A 2KTVA 1CK2A 2OTLF 4BY9D 3SIVA 5A2QM 2QEXF 1IPAA 1YHQF 3E1YA 1VQPF 1VQ6F 1QVFF 5G4UC 3FFMA 1YIJF 2CZWA 2VGMA 5EO3A 1RLGA 1YJWF 1Q7YH 5IT9M 3PLAC 1GZ0A 3CMAF 3OBWA 4NUTA 3CCUF 3CC4F 3J7AR 1JJ2F 1X7PA 3VMFB 3LWPC 5G4VC 1GO0A 1Q82H 3HJWC 3G4SF 2JNBA 3CMEF 3CC7F 2OTJF 3LWRC 1DT9A 3CCMF 3I55F 5GIPC 2BO1A 3VI6A
chains in the Genus database with same CATH superfamily
3VOBA 4ZHYB 4YJ2A 3JAKB 4LCKA 5LYJA 3V4DA 5EB0A 3D00A 1K9MH 3L7QA 1VQOF 3ZP7A 1TUBB 3TD4A 4O4JA 1X7OA 2KTUA 4X20A 4IHJA 3JAMM 2L26A 3GHZA 2HRUA 1GX1A 1VH8A 1X52A 5CB4B 2FC3A 3G6EF 1W2BF 3SIUA 4G4WA 1VHAA 4U3JB 4DRXA 2BTOA 3IEWA 5EIBC 4G4XA 5GONA 2Z1UA 1Q81H 3MCAB 5GINC 5MN4A 1QAHA 2LBXA 5EZYA 1JN1A 2R751 5IYZA 3WGNA 1FNKA 4G88A 4ZK7A 1U3LA 2HP3A 1U3PA 3IEQA 4BT4A 4C8GA 3LYBA 3CCRF 3FD6A 3JATB 3HKDA 4I55B 2RHOA 4O4LA 1JFFA 4TUYA 4B45A 2BTQB 2HX0A 2Q1XA 3WPWA 3RA5A 3VCZA 1M90H 3VYTC 1VK3A 1VQKF 4BW0B 3EORA 4G4YA 4I50B 3CCQF 3CG6A 3N2KB 3GYQA 5JH7A 1T0AA 4O4IA 4IHJB 4TUYB 4ZOLB 4X20B 1JFFB 1UI9A 2KG4A 1H7MA 2HS3A 3WGKA 3HKCB 3F0DA 3JALB 3OBYA 4F6RA 3FPIA 2Z1TA 4O2AA 5FNVB 4TV9A 1OFUA 5J2UB 2VGNA 3JAWA 3JCMM 1JY8A 2ALEA 1U43A 2CHTA 2RHHA 4U3JA 3ZO8A 4DRXB 1T0KB 3RYCA 5IJ9B 1RQ2A 4EI8A 5BMVA 2HQSC 3U0OA 1Z5WA 5CB4A 3LDTA 3D54A 3OBWA 4NUTA 4O4HB 3FD5A 1X25A 4B5CA 1GO0A 3RE3A 4G4ZA 3G4SF 3JARB 1VQVA 3CC7F 2OTJF 3F0FA 4C8EA 5LYJB 1DT9A 3CCMF 3IMPA 4PWTA 3I55F 2VGMA 2BO1A 3T80A 5GIPC 5MN6A 5HY4A 3VI6A 5J2TB 3CD6F 2GLZA 2ZAUA 3JVHA 2N48A 3F6MA 5C8YA 3J81M 3LWOC 4C4WC 2YYEA 3MCQA 4ZHQB 3TD5A 3HAXD 4X1IA 4WBNB 3LWQC 2KGWA 2V9YA 3MBMA 3CYPB 5EIBD 3NVKE 4EI9A 5J2TA 3LWVC 1VQ5F 2CW4A 5C8YB 1S72F 1RQ7A 2Z1EA 3IKFA 3WJRA 4O2AB 5FNVA 5J2UA 3CCJF 4BT5A 3OW2F 1ONIA 4KWEA 3IKEA 1GO1A 4XCQA 2CSLA 3MQWA 5KX5B 3R0PA 4C8IA 1W41A 1E7KA 2WALA 1XHOA 3N2GB 3P10A 4O4IB 4ZOLA 3WGLA 3CCEF 5EZYB 5BMVB 1YJNF 1W5BA 3O85A 1VQNF 1RA4A 4ZHQA 2IQQA 3CC2F 2H8EA 4NQ3A 5JQGB 5HXUA 5HP8A 4X1KA 4RQOA 5HY0A 5EYPB 3E22B 2LBWA 3AGKA 3CB2A 1OAPA 1TVKB 3JAWB 1W5AA 5HP7A 4I4TB 3BYQA 3ELCA 5LP6A 3HKCA 1TUBA 3RYHA 3S06A 3CPQA 5HWEA 1J7HA 4NWOB 1SA0B 2YXZA 4I4TA 4U39A 1QU9A 5JH7B 3HKBB 2HRYA 3K0TA 3V7QA 3E22A 1JD1A 4I50A 2UZHA 5EYPA 3I56F 1TVKA 5GONB 3LFOA 4YJ3B 4TZZA 1XBIA 1W42A 1W55A 3N2KA 3G71F 4BT6A 5EB1B 5GANK 4G4VA 1FFXB 1FNJA 1SZQA 2LCAA 4BY9D 3OONA 5A2QM 1IPAA 2QEXF 2RB9A 3N2GA 2UYNA 3ESJA 1VQPF 2IAFA 1YHQF 4O4LB 5EO3A 4M8IA 1RLGA 3JALA 4F6RB 5IT9M 3CMAF 3J7AR 2B33A 5MN5A 3LWPC 1PF5A 1Q82H 2JNBA 3K12A 5CA0A 3LWRC 3VTIC 4EB6A 4BT7A 3KJJA 3WPXA 4R40B 2BTUA 3P4EA 4ZI7A 5GAPK 3P0ZA 2QA4F 2ZOVA 3J80M 1NQ3A 3WGMA 3HKBA 5LOVB 3QTYA 5IJ0A 3C9UA 1W40A 3CCSF 3I7TA 1KNKA 1SA0A 1M1KH 2RHJA 3HKDB 3KJKA 3V3TA 5KMGA 1FSZA 5DCVA 1CLIA 2AIZP 4IIJA 5JVDB 1YJ9F 2EWCA 4O2BB 3RA6A 3F0EA 1VQ8F 4LNUB 3F0GA 1VQ9F 3S0YA 2F9ZC 3GTZA 5LA6B 5ITZB 2GZLA 4X1IB 2AIFA 2NMUA 3VOAA 3N4ZA 4HNAA 2LBTA 2HS4A 5CA1B 3S02A 1YGYA 3D01A 5LA6A 1ZWZA 5LXTA 1W59A 2CVLA 4O4JB 4EB6B 2Z01A 3PAFA 2ZVYA 4ERHA 2K1SA 3CCVF 1N8RH 5AVMA 4E6EA 1XV2A 5JVDA 3CCLF 2ZVZA 3JATA 4I55A 4TV8A 3ERNA 2FGYA 1YI2F 3CYQA 1W5FA 3Q8HA 5LP6C 5LXTB 1U40A 5IJ0B 2I6DA 4O4HA 1KD1H 3NMUC 3JASB 3KIZA 3NVIB 1NJIH 1VQLF 4B62A 4DXDA 2HP0A 3HKEB 5CA1A 2H6LA 5HY2A 3UT5B 5EWRA 2QTPA 2HVYD 5HY1A 1CN7A 3K2XA 2DYYA 1YQNA 3VIUA 5GIOC 2UYKA 4O2BA 1IV1A 4TV9B 2KTVA 4X1YA 3RYFB 3SIVA 4C82A 1QVFF 1VQ6F 3DDNA 3S0WA 3FFMA 3M84A 3RYIB 5G4UC 2UYPA 1YIJF 1W581 1W5EA 5IYZB 1RLUA 3JAKA 3LMEA 4YJ2B 1YJWF 1Q7YH 1IV2A 1IV3A 1GZ0A 1UFYA 4X1YB 3RYFA 3PLAC 2UYNB 3C9SA 3HTNA 4BVSA 3CCUF 3CC4F 1X7PA 3VMFB 4C81A 5LOVA 5G4VC 4X1KB 3HJWC 3MDOA 1FFXA 3CMEF 4ZI7B 2R6R1 5IJ9A 3KHNA 3RYCB 1COMA 2W8BC 4YJ3A 4X3MA 3NK6A 5CA0B 4BT2A 2CHSA 1IV4A 1SDSA 4RHAA 1H47A 2Z1FA 3WJQA 1QVGF 3M4SA 3QHDA 2G9IA 3CPWF 2ZF8A 3TD3A 2OZBA 2I6RA 4BT3A 4FFBA 1W57A 3DC2A 1H48A 3I3FA 3S0HA 1NMUB 4WBNA 3ZP4A 4B46A 1QD9A 3E20B 5JQGA 2QI2A 1ODEA 1W3EX 3JASA 2VAMA 3B6NA 1K73H 5JCOC 2P6YA 3RYIA 3VYSC 1VQ4F 5KX5A 5HXZA 3FBAA 3RYHB 2VAPA 3CXCF 2HS0A 5LP6B 1DBFA 3QUWA 1VQ7F 1KNJA 1PXWA 1Q8RA 2PHNA 2HP0B 3HKEA 1KQSF 2PMPA 3N4YA 1Z5VA 3VYUC 4BVTA 3M1XA 1YITF 5ITZA 2AMTA 5FLXM 3C9TA 3V7EA 3WJPA 1XRGA 3NK7A 4ZHVA 3C9RA 4FFBB 1Q86H 5EAZA 3KE1A 1K8AH 4IIJB 1KC8H 4X3LA 2H8CA 2Q1YA 3IR9A 3WXMB 2OHWA 1VQMF 5JCOA 3JARA 2IG8A 2RHLA 3WGJA 2VXYA 2GVIA 3ON1A 5FJ4C 1CK2A 2OTLF 3S03A 3HWUA 3E1YA 4BVQA 3VO8A 2CZWA 1R1MA 2MQEA 3UT5A 2VAWA 2UYJA 2DT4A 4HNAB 4EI7A 1JJ2F 2ZODA 4ZHWA 3K14A 5B8FA 4BVRA 3C8LA 3ZOPA 4LNUA 2CWJA 2OTMA 4TV8B 5KMGB
chains in the Genus database with same CATH topology
3CD6F 3NK6A 5GAPK 4LCKA 2QA4F 2GLZA 1SDSA 3J81M 3D00A 1K9MH 3LWOC 3J80M 4C4WC 1VQOF 1QVGF 1X7OA 2KTUA 3JAMM 1W40A 3CCSF 3CPWF 1M1KH 3HAXD 1X52A 2OZBA 3LWQC 2FC3A 3G6EF 1W2BF 3NVKE 3V3TA 4EI9A 3LWVC 3SIUA 5DCVA 1VQ5F 1YJ9F 1S72F 1NMUB 3RA6A 3CCJF 1Q81H 3MCAB 5GINC 3E20B 1VQ8F 3OW2F 2LBXA 2QI2A 1VQ9F 1GO1A 4XCQA 1W3EX 2F9ZC 1W41A 2AIFA 1E7KA 1K73H 3N4ZA 2WALA 4X3MA 3CCRF 3CCEF 1YJNF 1VQ4F 5HXZA 1ZWZA 3O85A 1VQNF 1RA4A 3CC2F 3PAFA 4NQ3A 3CCVF 3CXCF 3RA5A 5HXUA 1N8RH 1M90H 5HY0A 1VQKF 1VQ7F 4BW0B 2LBWA 3AGKA 3CCLF 3CCQF 3CG6A 1PXWA 2FGYA 3GYQA 1YI2F 3CPQA 5HWEA 2I6DA 1KQSF 1KD1H 3N4YA 5GIPC 2KG4A 3NMUC 4BVTA 1YITF 1H7MA 3NVIB 5FLXM 1NJIH 1VQLF 3OBYA 3V7QA 5HY2A 5EWRA 3V7EA 3NK7A 3I56F 3LFOA 4TZZA 2HVYD 1XBIA 1W42A 2VGNA 5HY1A 1Q86H 3G71F 1CN7A 3JCMM 1K8AH 1KC8H 4X3LA 5GIOC 2ALEA 3WXMB 3IR9A 5GANK 2OHWA 1VQMF 1T0KB 5FJ4C 3ON1A 2KTVA 1CK2A 2OTLF 4BY9D 3SIVA 4EI8A 5A2QM 2QEXF 1IPAA 1YHQF 3E1YA 4BVQA 1VQPF 1VQ6F 1QVFF 3FFMA 5G4UC 1YIJF 2CZWA 5EO3A 1RLGA 1YJWF 1Q7YH 5IT9M 3PLAC 1GZ0A 3CMAF 3OBWA 4NUTA 4BVSA 3CCUF 3CC4F 4EI7A 1JJ2F 3J7AR 1X7PA 3VMFB 3LWPC 5G4VC 1GO0A 1Q82H 3HJWC 3G4SF 2JNBA 3CMEF 3CC7F 4BVRA 2OTJF 3LWRC 1DT9A 3CCMF 3I55F 2VGMA 2BO1A 5HY4A 3VI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 F;  3NK6 A;  5GAP K;  4LCK A;  2QA4 F;  1SDS A;  3J81 M;  1K9M H;  3LWO C;  3J80 M;  4C4W C;  1VQO F;  1QVG F;  1X7O A;  2KTU A;  3JAM M;  1W40 A;  3CCS F;  3CPW F;  1M1K H;  3HAX D;  1X52 A;  2OZB A;  3LWQ C;  2FC3 A;  3G6E F;  1W2B F;  3NVK E;  3LWV C;  3SIU A;  5DCV A;  1VQ5 F;  1YJ9 F;  1S72 F;  1NMU B;  3RA6 A;  3CCJ F;  1Q81 H;  3MCA B;  5GIN C;  3E20 B;  1VQ8 F;  3OW2 F;  2LBX A;  2QI2 A;  1VQ9 F;  1GO1 A;  1W3E X;  1W41 A;  2AIF A;  1E7K A;  1K73 H;  3N4Z A;  2WAL A;  4X3M A;  3CCR F;  3CCE F;  1YJN F;  1VQ4 F;  1ZWZ A;  3O85 A;  1VQN F;  1RA4 A;  3CC2 F;  3PAF A;  3CCV F;  3CXC F;  3RA5 A;  1N8R H;  1M90 H;  1VQK F;  1VQ7 F;  4BW0 B;  2LBW A;  3AGK A;  3CCL F;  3CCQ F;  3CG6 A;  1PXW A;  3GYQ A;  1YI2 F;  3CPQ A;  2I6D A;  1KQS F;  1KD1 H;  3N4Y A;  3NMU C;  2KG4 A;  1YIT F;  1H7M A;  3NVI B;  5FLX M;  1NJI H;  1VQL F;  3OBY A;  3V7Q A;  5EWR A;  3V7E A;  3NK7 A;  3I56 F;  3LFO A;  4TZZ A;  2HVY D;  1XBI A;  1W42 A;  2VGN A;  1Q86 H;  1CN7 A;  3G71 F;  3JCM M;  1K8A H;  1KC8 H;  4X3L A;  5GIO C;  5GAN K;  3WXM B;  2ALE A;  3IR9 A;  2OHW A;  1VQM F;  1T0K B;  5FJ4 C;  3ON1 A;  2KTV A;  1CK2 A;  2OTL F;  4BY9 D;  3SIV A;  5A2Q M;  2QEX F;  1IPA A;  1YHQ F;  3E1Y A;  1VQP F;  1VQ6 F;  1QVF F;  5G4U C;  3FFM A;  1YIJ F;  2CZW A;  2VGM A;  5EO3 A;  1RLG A;  1YJW F;  1Q7Y H;  5IT9 M;  3PLA C;  1GZ0 A;  3CMA F;  3OBW A;  4NUT A;  3CCU F;  3CC4 F;  3J7A R;  1JJ2 F;  1X7P A;  3VMF B;  3LWP C;  5G4V C;  1GO0 A;  1Q82 H;  3HJW C;  3G4S F;  2JNB A;  3CME F;  3CC7 F;  2OTJ F;  3LWR C;  1DT9 A;  3CCM F;  3I55 F;  5GIP C;  2BO1 A;  3VI6 A; 
#chains in the Genus database with same CATH topology
 3VOB A;  4ZHY B;  4YJ2 A;  3JAK B;  4LCK A;  5LYJ A;  3V4D A;  5EB0 A;  3D00 A;  1K9M H;  3L7Q A;  1VQO F;  3ZP7 A;  1TUB B;  3TD4 A;  4O4J A;  1X7O A;  2KTU A;  4X20 A;  4IHJ A;  3JAM M;  2L26 A;  3GHZ A;  2HRU A;  1GX1 A;  1VH8 A;  1X52 A;  5CB4 B;  2FC3 A;  3G6E F;  1W2B F;  3SIU A;  4G4W A;  1VHA A;  4U3J B;  4DRX A;  2BTO A;  3IEW A;  5EIB C;  4G4X A;  5GON A;  2Z1U A;  1Q81 H;  3MCA B;  5GIN C;  5MN4 A;  1QAH A;  2LBX A;  5EZY A;  1JN1 A;  2R75 1;  5IYZ A;  3WGN A;  1FNK A;  4G88 A;  4ZK7 A;  1U3L A;  2HP3 A;  1U3P A;  3IEQ A;  4BT4 A;  4C8G A;  3LYB A;  3CCR F;  3FD6 A;  3JAT B;  3HKD A;  4I55 B;  2RHO A;  4O4L A;  1JFF A;  4TUY A;  4B45 A;  2BTQ B;  2HX0 A;  2Q1X A;  3WPW A;  3RA5 A;  3VCZ A;  1M90 H;  3VYT C;  1VK3 A;  1VQK F;  4BW0 B;  3EOR A;  4G4Y A;  4I50 B;  3CCQ F;  3CG6 A;  3N2K B;  3GYQ A;  5JH7 A;  1T0A A;  4O4I A;  4IHJ B;  4TUY B;  4ZOL B;  4X20 B;  1JFF B;  1UI9 A;  2KG4 A;  1H7M A;  2HS3 A;  3WGK A;  3HKC B;  3F0D A;  3JAL B;  3OBY A;  4F6R A;  3FPI A;  2Z1T A;  4O2A A;  5FNV B;  4TV9 A;  1OFU A;  5J2U B;  2VGN A;  3JAW A;  3JCM M;  1JY8 A;  2ALE A;  1U43 A;  2CHT A;  2RHH A;  4U3J A;  3ZO8 A;  4DRX B;  1T0K B;  3RYC A;  5IJ9 B;  1RQ2 A;  4EI8 A;  5BMV A;  2HQS C;  3U0O A;  1Z5W A;  5CB4 A;  3LDT A;  3D54 A;  3OBW A;  4NUT A;  4O4H B;  3FD5 A;  1X25 A;  4B5C A;  1GO0 A;  3RE3 A;  4G4Z A;  3G4S F;  3JAR B;  1VQV A;  3CC7 F;  2OTJ F;  3F0F A;  4C8E A;  5LYJ B;  1DT9 A;  3CCM F;  3IMP A;  4PWT A;  3I55 F;  2VGM A;  2BO1 A;  3T80 A;  5GIP C;  5MN6 A;  5HY4 A;  3VI6 A;  5J2T B;  3CD6 F;  2GLZ A;  2ZAU A;  3JVH A;  2N48 A;  3F6M A;  5C8Y A;  3J81 M;  3LWO C;  4C4W C;  2YYE A;  3MCQ A;  4ZHQ B;  3TD5 A;  3HAX D;  4X1I A;  4WBN B;  3LWQ C;  2KGW A;  2V9Y A;  3MBM A;  3CYP B;  5EIB D;  3NVK E;  4EI9 A;  5J2T A;  3LWV C;  1VQ5 F;  2CW4 A;  5C8Y B;  1S72 F;  1RQ7 A;  2Z1E A;  3IKF A;  3WJR A;  4O2A B;  5FNV A;  5J2U A;  3CCJ F;  4BT5 A;  3OW2 F;  1ONI A;  4KWE A;  3IKE A;  1GO1 A;  4XCQ A;  2CSL A;  3MQW A;  5KX5 B;  3R0P A;  4C8I A;  1W41 A;  1E7K A;  2WAL A;  1XHO A;  3N2G B;  3P10 A;  4O4I B;  4ZOL A;  3WGL A;  3CCE F;  5EZY B;  5BMV B;  1YJN F;  1W5B A;  3O85 A;  1VQN F;  1RA4 A;  4ZHQ A;  2IQQ A;  3CC2 F;  2H8E A;  4NQ3 A;  5JQG B;  5HXU A;  5HP8 A;  4X1K A;  4RQO A;  5HY0 A;  5EYP B;  3E22 B;  2LBW A;  3AGK A;  3CB2 A;  1OAP A;  1TVK B;  3JAW B;  1W5A A;  5HP7 A;  4I4T B;  3BYQ A;  3ELC A;  5LP6 A;  3HKC A;  1TUB A;  3RYH A;  3S06 A;  3CPQ A;  5HWE A;  1J7H A;  4NWO B;  1SA0 B;  2YXZ A;  4I4T A;  4U39 A;  1QU9 A;  5JH7 B;  3HKB B;  2HRY A;  3K0T A;  3V7Q A;  3E22 A;  1JD1 A;  4I50 A;  2UZH A;  5EYP A;  3I56 F;  1TVK A;  5GON B;  3LFO A;  4YJ3 B;  4TZZ A;  1XBI A;  1W42 A;  1W55 A;  3N2K A;  3G71 F;  4BT6 A;  5EB1 B;  5GAN K;  4G4V A;  1FFX B;  1FNJ A;  1SZQ A;  2LCA A;  4BY9 D;  3OON A;  5A2Q M;  1IPA A;  2QEX F;  2RB9 A;  3N2G A;  2UYN A;  3ESJ A;  1VQP F;  2IAF A;  1YHQ F;  4O4L B;  5EO3 A;  4M8I A;  1RLG A;  3JAL A;  4F6R B;  5IT9 M;  3CMA F;  3J7A R;  2B33 A;  5MN5 A;  3LWP C;  1PF5 A;  1Q82 H;  2JNB A;  3K12 A;  5CA0 A;  3LWR C;  3VTI C;  4EB6 A;  4BT7 A;  3KJJ A;  3WPX A;  4R40 B;  2BTU A;  3P4E A;  4ZI7 A;  5GAP K;  3P0Z A;  2QA4 F;  2ZOV A;  3J80 M;  1NQ3 A;  3WGM A;  3HKB A;  5LOV B;  3QTY A;  5IJ0 A;  3C9U A;  1W40 A;  3CCS F;  3I7T A;  1KNK A;  1SA0 A;  1M1K H;  2RHJ A;  3HKD B;  3KJK A;  3V3T A;  5KMG A;  1FSZ A;  5DCV A;  1CLI A;  2AIZ P;  4IIJ A;  5JVD B;  1YJ9 F;  2EWC A;  4O2B B;  3RA6 A;  3F0E A;  1VQ8 F;  4LNU B;  3F0G A;  1VQ9 F;  3S0Y A;  2F9Z C;  3GTZ A;  5LA6 B;  5ITZ B;  2GZL A;  4X1I B;  2AIF A;  2NMU A;  3VOA A;  3N4Z A;  4HNA A;  2LBT A;  2HS4 A;  5CA1 B;  3S02 A;  1YGY A;  3D01 A;  5LA6 A;  1ZWZ A;  5LXT A;  1W59 A;  2CVL A;  4O4J B;  4EB6 B;  2Z01 A;  3PAF A;  2ZVY A;  4ERH A;  2K1S A;  3CCV F;  1N8R H;  5AVM A;  4E6E A;  1XV2 A;  5JVD A;  3CCL F;  2ZVZ A;  3JAT A;  4I55 A;  4TV8 A;  3ERN A;  2FGY A;  1YI2 F;  3CYQ A;  1W5F A;  3Q8H A;  5LP6 C;  5LXT B;  1U40 A;  5IJ0 B;  2I6D A;  4O4H A;  1KD1 H;  3NMU C;  3JAS B;  3KIZ A;  3NVI B;  1NJI H;  1VQL F;  4B62 A;  4DXD A;  2HP0 A;  3HKE B;  5CA1 A;  2H6L A;  5HY2 A;  3UT5 B;  5EWR A;  2QTP A;  2HVY D;  5HY1 A;  1CN7 A;  3K2X A;  2DYY A;  1YQN A;  3VIU A;  5GIO C;  2UYK A;  4O2B A;  1IV1 A;  4TV9 B;  2KTV A;  4X1Y A;  3RYF B;  3SIV A;  4C82 A;  1QVF F;  1VQ6 F;  3DDN A;  3S0W A;  3FFM A;  3M84 A;  3RYI B;  5G4U C;  2UYP A;  1YIJ F;  1W58 1;  1W5E A;  5IYZ B;  1RLU A;  3JAK A;  3LME A;  4YJ2 B;  1YJW F;  1Q7Y H;  1IV2 A;  1IV3 A;  1GZ0 A;  1UFY A;  4X1Y B;  3RYF A;  3PLA C;  2UYN B;  3C9S A;  3HTN A;  4BVS A;  3CCU F;  3CC4 F;  1X7P A;  3VMF B;  4C81 A;  5LOV A;  5G4V C;  4X1K B;  3HJW C;  3MDO A;  1FFX A;  3CME F;  4ZI7 B;  2R6R 1;  5IJ9 A;  3KHN A;  3RYC B;  1COM A;  2W8B C;  4YJ3 A;  4X3M A;  3NK6 A;  5CA0 B;  4BT2 A;  2CHS A;  1IV4 A;  1SDS A;  4RHA A;  1H47 A;  2Z1F A;  3WJQ A;  1QVG F;  3M4S A;  3QHD A;  2G9I A;  3CPW F;  2ZF8 A;  3TD3 A;  2OZB A;  2I6R A;  4BT3 A;  4FFB A;  1W57 A;  3DC2 A;  1H48 A;  3I3F A;  3S0H A;  1NMU B;  4WBN A;  3ZP4 A;  4B46 A;  1QD9 A;  3E20 B;  5JQG A;  2QI2 A;  1ODE A;  1W3E X;  3JAS A;  2VAM A;  3B6N A;  1K73 H;  5JCO C;  2P6Y A;  3RYI A;  3VYS C;  1VQ4 F;  5KX5 A;  5HXZ A;  3FBA A;  3RYH B;  2VAP A;  3CXC F;  2HS0 A;  5LP6 B;  1DBF A;  3QUW A;  1VQ7 F;  1KNJ A;  1PXW A;  1Q8R A;  2PHN A;  2HP0 B;  3HKE A;  1KQS F;  2PMP A;  3N4Y A;  1Z5V A;  3VYU C;  4BVT A;  3M1X A;  1YIT F;  5ITZ A;  2AMT A;  5FLX M;  3C9T A;  3V7E A;  3WJP A;  1XRG A;  3NK7 A;  4ZHV A;  3C9R A;  4FFB B;  1Q86 H;  5EAZ A;  3KE1 A;  1K8A H;  4IIJ B;  1KC8 H;  4X3L A;  2H8C A;  2Q1Y A;  3IR9 A;  3WXM B;  2OHW A;  1VQM F;  5JCO A;  3JAR A;  2IG8 A;  2RHL A;  3WGJ A;  2VXY A;  2GVI A;  3ON1 A;  5FJ4 C;  1CK2 A;  2OTL F;  3S03 A;  3HWU A;  3E1Y A;  4BVQ A;  3VO8 A;  2CZW A;  1R1M A;  2MQE A;  3UT5 A;  2VAW A;  2UYJ A;  2DT4 A;  4HNA B;  4EI7 A;  1JJ2 F;  2ZOD A;  4ZHW A;  3K14 A;  5B8F A;  4BVR A;  3C8L A;  3ZOP A;  4LNU A;  2CWJ A;  2OTM A;  4TV8 B;  5KMG B; 
#chains in the Genus database with same CATH homology
 3CD6 F;  3NK6 A;  5GAP K;  4LCK A;  2QA4 F;  2GLZ A;  1SDS A;  3J81 M;  3D00 A;  1K9M H;  3LWO C;  3J80 M;  4C4W C;  1VQO F;  1QVG F;  1X7O A;  2KTU A;  3JAM M;  1W40 A;  3CCS F;  3CPW F;  1M1K H;  3HAX D;  1X52 A;  2OZB A;  3LWQ C;  2FC3 A;  3G6E F;  1W2B F;  3NVK E;  3V3T A;  4EI9 A;  3LWV C;  3SIU A;  5DCV A;  1VQ5 F;  1YJ9 F;  1S72 F;  1NMU B;  3RA6 A;  3CCJ F;  1Q81 H;  3MCA B;  5GIN C;  3E20 B;  1VQ8 F;  3OW2 F;  2LBX A;  2QI2 A;  1VQ9 F;  1GO1 A;  4XCQ A;  1W3E X;  2F9Z C;  1W41 A;  2AIF A;  1E7K A;  1K73 H;  3N4Z A;  2WAL A;  4X3M A;  3CCR F;  3CCE F;  1YJN F;  1VQ4 F;  5HXZ A;  1ZWZ A;  3O85 A;  1VQN F;  1RA4 A;  3CC2 F;  3PAF A;  4NQ3 A;  3CCV F;  3CXC F;  3RA5 A;  5HXU A;  1N8R H;  1M90 H;  5HY0 A;  1VQK F;  1VQ7 F;  4BW0 B;  2LBW A;  3AGK A;  3CCL F;  3CCQ F;  3CG6 A;  1PXW A;  2FGY A;  3GYQ A;  1YI2 F;  3CPQ A;  5HWE A;  2I6D A;  1KQS F;  1KD1 H;  3N4Y A;  5GIP C;  2KG4 A;  3NMU C;  4BVT A;  1YIT F;  1H7M A;  3NVI B;  5FLX M;  1NJI H;  1VQL F;  3OBY A;  3V7Q A;  5HY2 A;  5EWR A;  3V7E A;  3NK7 A;  3I56 F;  3LFO A;  4TZZ A;  2HVY D;  1XBI A;  1W42 A;  2VGN A;  5HY1 A;  1Q86 H;  3G71 F;  1CN7 A;  3JCM M;  1K8A H;  1KC8 H;  4X3L A;  5GIO C;  2ALE A;  3WXM B;  3IR9 A;  5GAN K;  2OHW A;  1VQM F;  1T0K B;  5FJ4 C;  3ON1 A;  2KTV A;  1CK2 A;  2OTL F;  4BY9 D;  3SIV A;  4EI8 A;  5A2Q M;  2QEX F;  1IPA A;  1YHQ F;  3E1Y A;  4BVQ A;  1VQP F;  1VQ6 F;  1QVF F;  3FFM A;  5G4U C;  1YIJ F;  2CZW A;  5EO3 A;  1RLG A;  1YJW F;  1Q7Y H;  5IT9 M;  3PLA C;  1GZ0 A;  3CMA F;  3OBW A;  4NUT A;  4BVS A;  3CCU F;  3CC4 F;  4EI7 A;  1JJ2 F;  3J7A R;  1X7P A;  3VMF B;  3LWP C;  5G4V C;  1GO0 A;  1Q82 H;  3HJW C;  3G4S F;  2JNB A;  3CME F;  3CC7 F;  4BVR A;  2OTJ F;  3LWR C;  1DT9 A;  3CCM F;  3I55 F;  2VGM A;  2BO1 A;  5HY4 A;  3VI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...