3CC2F

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc2F00
3CCVF 2KG4A 2BO1A 2FC3A 1ZWZA 3E1YA 1X7OA 3CPQA 1YITF 3N4ZA 2OHWA 5GAPK 3VI6A 3LFOA 1VQNF 3SIVA 1NJIH 2KTVA 4BW0B 1Q7YH 1CK2A 1GZ0A 3NK6A 3NVIB 1IPAA 2QI2A 3AGKA 5GIPC 1E7KA 1N8RH 3CCRF 1RLGA 3E20B 3N4YA 1Q81H 3VMFB 5G4VC 5FLXM 3JAMM 3CCJF 3CCQF 3RA6A 2OZBA 1QVGF 3PLAC 1X52A 1X7PA 2OTLF 3CXCF 2KTUA 3CCSF 2AIFA 1JJ2F 3JCMM 1CN7A 1M90H 3CMEF 1K73H 1NMUB 3I55F 1K9MH 3MCAB 3CCMF 3OBYA 1YJWF 2WALA 3I56F 1VQ6F 1M1KH 1Q86H 5G4UC 3NK7A 5A2QM 5DCVA 4C4WC 2QA4F 1W40A 1DT9A 3OW2F 3CG6A 2JNBA 3G4SF 1VQLF 3GYQA 5EWRA 1H7MA 1VQ9F 3CC4F 1YI2F 1GO0A 1YIJF 1S72F 2ALEA 5EO3A 1SDSA 2QEXF 5IT9M 1VQKF 3HAXD 1KQSF 3LWRC 1T0KB 3CMAF 1XBIA 3SIUA 3HJWC 4LCKA 1W2BF 5GINC 5GANK 3CCLF 3V7QA 5FJ4C 1W3EX 2VGMA 3PAFA 2VGNA 1KC8H 1VQMF 2LBXA 3FFMA 3RA5A 3CC2F 3CD6F 3IR9A 1KD1H 3LWOC 1VQ5F 1YJ9F 1RA4A 3G6EF 1YHQF 1VQ7F 1GO1A 4TZZA 3LWPC 3V7EA 3LWQC 3G71F 1PXWA 2HVYD 2OTJF 1W41A 3CCUF 1Q82H 1VQOF 3J81M 1YJNF 1K8AH 4X3LA 3CC7F 4NUTA 2LBWA 1VQPF 4BY9D 1VQ8F 3O85A 2I6DA 3NMUC 3ON1A 4X3MA 1QVFF 3J7AR 5GIOC 3CPWF 3J80M 1VQ4F 3LWVC 3CCEF 3OBWA 3NVKE 2CZWA 1W42A 3WXMB
chains in the Genus database with same CATH superfamily
3JAWB 4YJ2B 3CCVF 2HP3A 2BO1A 2B33A 1X7OA 4TUYA 2IAFA 2HRUA 3MBMA 4U3JA 1YITF 3IEWA 3JAWA 4YJ2A 1VHAA 4DRXB 1TUBB 3LFOA 2W8BC 3ZO8A 1GZ0A 4DRXA 3NVIB 1TUBA 1IPAA 5GIPC 1SA0B 2PHNA 2ZODA 3CCRF 3JAKB 3E20B 3JAMM 4EI9A 1CLIA 1SA0A 3JAKA 2OTLF 3C9TA 1OFUA 2KTUA 3CCSF 2IQQA 3D01A 4B62A 1K73H 3I55F 3ZP4A 3MCAB 3JATB 3OBYA 3CCMF 1M1KH 1Q86H 3NK7A 1DT9A 5EAZA 2GVIA 3CG6A 4RQOA 3JATA 5EWRA 3S03A 2Z01A 5HP7A 1YGYA 1UI9A 3WJPA 5JVDB 1W5BA 4ZHYB 3JVHA 1QAHA 3WPXA 4BVQA 3DC2A 5J2TB 5IT9M 1VQKF 5HY2A 3M84A 3CB2A 3CMAF 2DYYA 5LXTB 4EB6B 5JVDA 3HJWC 1W2BF 3U0OA 3V7QA 5J2TA 2VGMA 4FFBB 5LXTA 4EB6A 1U3PA 3Q8HA 2EWCA 2Z1FA 3FFMA 3KIZA 4BVRA 5MN4A 3ERNA 4C8GA 2UYNB 1KD1H 1JY8A 4G88A 3VYUC 3S02A 5ITZA 4FFBA 3TD3A 3G6EF 1VQ7F 1W55A 2VXYA 3C9RA 2RHJA 4TZZA 3LWPC 4ZOLB 2UYNA 2HVYD 5IJ0B 1ODEA 1W5FA 5EYPB 2LBWA 1JN1A 1YQNA 2L26A 3QUWA 4ZOLA 5JCOC 2V9YA 5IJ0A 5LYJB 3ON1A 1QVFF 5EYPA 2RHOA 1ONIA 3RYHB 3OW2F 3OBWA 2JNBA 3WXMB 4R40B 5LYJA 4ZI7B 3CPQA 3KE1A 3RYHA 5HP8A 4LNUB 3FBAA 1IV3A 2BTQB 4ZI7A 1Z5VA 5FNVA 4NWOB 3MDOA 1U43A 2G9IA 3VYSC 4BW0B 3K14A 4O4JB 1KNJA 3UT5B 3WGJA 4LNUA 3RE3A 2QI2A 2AMTA 4O4HB 1E7KA 1N8RH 2KGWA 3TD5A 3VMFB 3UT5A 4I4TB 4O4IB 4O4HA 3RA6A 3WGKA 1NQ3A 3CYQA 5HWEA 4BVTA 1JJ2F 3HKCB 4I4TA 4O4IA 5LOVB 3V3TA 2YYEA 1OAPA 2H6LA 3I56F 2QTPA 5G4UC 5A2QM 3HKCA 4IHJB 3HWUA 1H47A 4ZK7A 5LOVA 3K12A 1VQLF 3GYQA 1VQ9F 3CC4F 3V4DA 4PWTA 3D54A 4IHJA 3HKBB 3HKEB 1SZQA 1VQVA 3M4SA 1YIJF 1S72F 1PF5A 3I3FA 1XRGA 1SDSA 4G4ZA 2QEXF 3IMPA 3L7QA 4BT2A 3HKBA 1RQ2A 3HKEA 3B6NA 2P6YA 5HXUA 3F0DA 3HTNA 3RYCB 5FJ4C 1W3EX 5JCOA 3RYIB 1U40A 4G4VA 3ZP7A 3S0YA 1VQMF 4EI8A 3RYCA 3RA5A 3HKDB 4YJ3B 1Q8RA 3WJRA 2VAPA 3RYIA 1VQ5F 3F0GA 1YHQF 1GO1A 3HKDA 4YJ3A 2Z1UA 3V7EA 5J2UB 1K8AH 2HS0A 4NUTA 5EB1B 2NMUA 2AIZP 4BY9D 1VQ8F 4X1IB 4BT5A 2ZVYA 3O85A 5J2UA 5CB4B 4O2AB 1FNKA 3DDNA 4X1YB 3CPWF 5CA0B 3J80M 3CCEF 2CZWA 4X1IA 5MN6A 3VTIC 5HY1A 3SIVA 1R1MA 2UZHA 4O2AA 5CB4A 4F6RB 1ZWZA 4X1YA 3E1YA 3C9SA 1X25A 2VAMA 1QU9A 2HX0A 5CA0A 1U3LA 1W5AA 3D00A 2MQEA 3N4ZA 2OHWA 5HY4A 4F6RA 5GAPK 3WGMA 4I50B 2CWJA 1VQNF 3ESJA 4ERHA 2KTVA 4B46A 1Q7YH 3VIUA 3NK6A 4I50A 2UYKA 3AGKA 5EIBD 3IEQA 2Z1TA 5G4VC 5FLXM 3CCJF 4WBNB 3C9UA 3K2XA 3GHZA 3MQWA 3PLAC 3MCQA 4KWEA 4G4XA 3CXCF 5HXZA 2HS4A 4WBNA 1CN7A 1FFXB 4M8IA 1M90H 3S06A 2UYJA 5IJ9B 1K9MH 5LA6B 2H8CA 2ZOVA 3K0TA 1YJWF 3RYFB 3TD4A 1VQ6F 1IV1A 4BVSA 5DCVA 5BMVB 1FFXA 1TVKB 1W57A 1DBFA 3FD6A 5IJ9A 1JD1A 1FSZA 3G4SF 5LA6A 2UYPA 1J7HA 3RYFA 4EI7A 4O4JA 4BT7A 5BMVA 1YI2F 1W5EA 1TVKA 2Z1EA 1GO0A 3M1XA 2I6RA 2BTOA 4C8IA 2DT4A 3KJKA 5EO3A 1VH8A 1H48A 3VOBA 4C8EA 1KQSF 3LWRC 1T0KB 3LDTA 1XBIA 4LCKA 2Q1YA 5GINC 5GANK 2VAWA 3LMEA 2LCAA 3F0FA 3PAFA 2VGNA 1KC8H 2GZLA 1KNKA 3P10A 2N48A 2FGYA 4I55B 3N2GB 5IYZB 4B5CA 2OTMA 3JALB 4ZHVA 4C82A 2RHHA 1YJ9F 1RA4A 5KMGB 5AVMA 3KJJA 5EZYB 4I55A 3N2GA 4ZHWA 5IYZA 3LWQC 1Z5WA 1QD9A 4IIJB 1PXWA 3G71F 2YXZA 2OTJF 1Q82H 1VQOF 3JALA 3J81M 5EB0A 1YJNF 3CC7F 5HY0A 5KMGA 2ZF8A 3CYPB 5EZYA 1VQPF 1W581 4X20B 2HP0B 4IIJA 5CA1B 1RLUA 5JQGB 3WGNA 1XHOA 3P0ZA 4O2BB 1UFYA 4RHAA 3J7AR 5EIBC 5GIOC 3NVKE 1VQ4F 3CD6F 4X1KB 2RB9A 4X20A 2HP0A 5CA1A 5JQGA 2KG4A 2FC3A 4O2BA 1W59A 2HQSC 3VCZA 2R751 4X1KA 2LBTA 3I7TA 2Q1XA 5MN5A 2RHLA 3VI6A 1GX1A 3VO8A 1RQ7A 3N2KB 3VOAA 1NJIH 2CVLA 3BYQA 1CK2A 5GONB 3KHNA 4NQ3A 3N2KA 2H8EA 3IKFA 1RLGA 4DXDA 3N4YA 1Q81H 5GONA 5KX5B 4ZHQB 4G4WA 3CCQF 2HS3A 3GTZA 5LP6B 3E22B 1QVGF 2OZBA 1X52A 1X7PA 2R6R1 2IG8A 2CSLA 2AIFA 3QTYA 3JCMM 5C8YB 1XV2A 3F6MA 5JH7B 5KX5A 4ZHQA 3CMEF 1T0AA 1NMUB 5LP6A 3E22A 3WPWA 2WALA 4C81A 3EORA 3JASB 5C8YA 2BTUA 3LYBA 5ITZB 5JH7A 2QA4F 4C4WC 1IV2A 1VK3A 2ZAUA 4TV9B 1H7MA 3JASA 3S0WA 2CW4A 3VYTC 4TV9A 1JFFB 2HRYA 2ALEA 1FNJA 3WJQA 3OONA 3HAXD 2F9ZC 3P4EA 3SIUA 1JFFA 2PMPA 4E6EA 3CCLF 2CHSA 5B8FA 3S0HA 4O4LB 1IV4A 3FPIA 3FD5A 2LBXA 4HNAB 3CC2F 3ZOPA 2GLZA 3C8LA 3IR9A 3ELCA 1COMA 3LWOC 4O4LA 5FNVB 4G4YA 3JARB 4XCQA 3QHDA 3F0EA 4HNAA 4B45A 1W41A 3WGLA 4BT3A 3CCUF 4X3LA 2CHTA 3T80A 3JARA 4TV8B 2ZVZA 4U39A 2K1SA 5LP6C 2I6DA 3NMUC 3IKEA 4BT4A 4BT6A 4X3MA 4TUYB 4TV8A 3R0PA 4U3JB 3LWVC 1W40A 1W42A
chains in the Genus database with same CATH topology
3CCVF 2KG4A 2BO1A 2FC3A 1ZWZA 3E1YA 1X7OA 3CPQA 1YITF 3D00A 3N4ZA 2OHWA 5HY4A 5GAPK 3VI6A 3LFOA 1VQNF 3SIVA 1NJIH 2KTVA 4BW0B 1Q7YH 1CK2A 1GZ0A 3NK6A 3NVIB 1IPAA 2QI2A 3AGKA 5GIPC 4NQ3A 1E7KA 1N8RH 3CCRF 1RLGA 3E20B 3N4YA 1Q81H 3VMFB 5G4VC 5FLXM 3JAMM 3CCJF 4EI9A 3CCQF 3RA6A 2OZBA 1QVGF 3PLAC 1X52A 1X7PA 5HWEA 2OTLF 3CXCF 2KTUA 4BVTA 3CCSF 2AIFA 1JJ2F 5HXZA 3JCMM 1CN7A 1M90H 3V3TA 3CMEF 1K73H 1NMUB 3I55F 1K9MH 3MCAB 3CCMF 3OBYA 1YJWF 2WALA 3I56F 1VQ6F 1M1KH 1Q86H 4BVSA 5G4UC 3NK7A 5A2QM 5DCVA 4C4WC 2QA4F 1W40A 1DT9A 3OW2F 3CG6A 2JNBA 3G4SF 1VQLF 3GYQA 5EWRA 1H7MA 1VQ9F 3CC4F 4EI7A 1YI2F 1GO0A 1YIJF 1S72F 2ALEA 5EO3A 1SDSA 4BVQA 2QEXF 5IT9M 1VQKF 5HY2A 3HAXD 2F9ZC 1KQSF 3LWRC 1T0KB 3CMAF 5HXUA 1XBIA 3SIUA 3HJWC 4LCKA 1W2BF 5GINC 5GANK 3CCLF 3V7QA 5FJ4C 1W3EX 2VGMA 3PAFA 2VGNA 1KC8H 1VQMF 2LBXA 4EI8A 3FFMA 2FGYA 3RA5A 4BVRA 3CC2F 3CD6F 2GLZA 3IR9A 1KD1H 3LWOC 1VQ5F 1YJ9F 1RA4A 4XCQA 3G6EF 1YHQF 1VQ7F 1GO1A 4TZZA 3LWPC 3V7EA 3LWQC 3G71F 1PXWA 2HVYD 2OTJF 1W41A 3CCUF 1Q82H 1VQOF 3J81M 1YJNF 1K8AH 4X3LA 3CC7F 4NUTA 5HY0A 2LBWA 1VQPF 4BY9D 1VQ8F 3O85A 2I6DA 3NMUC 3ON1A 4X3MA 1QVFF 3J7AR 5GIOC 3CPWF 3J80M 1VQ4F 3LWVC 3CCEF 3OBWA 3NVKE 2CZWA 1W42A 5HY1A 3WXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV F;  2KG4 A;  2BO1 A;  2FC3 A;  1ZWZ A;  3E1Y A;  1X7O A;  3CPQ A;  1YIT F;  3N4Z A;  2OHW A;  5GAP K;  3VI6 A;  3LFO A;  1VQN F;  3SIV A;  1NJI H;  2KTV A;  4BW0 B;  1Q7Y H;  1CK2 A;  1GZ0 A;  3NK6 A;  3NVI B;  1IPA A;  2QI2 A;  3AGK A;  5GIP C;  1E7K A;  1N8R H;  3CCR F;  1RLG A;  3E20 B;  3N4Y A;  1Q81 H;  3VMF B;  5G4V C;  5FLX M;  3JAM M;  3CCJ F;  3CCQ F;  3RA6 A;  2OZB A;  1QVG F;  3PLA C;  1X52 A;  1X7P A;  2OTL F;  3CXC F;  2KTU A;  3CCS F;  2AIF A;  1JJ2 F;  3JCM M;  1CN7 A;  1M90 H;  3CME F;  1K73 H;  1NMU B;  3I55 F;  1K9M H;  3MCA B;  3CCM F;  3OBY A;  1YJW F;  2WAL A;  3I56 F;  1VQ6 F;  1M1K H;  1Q86 H;  5G4U C;  3NK7 A;  5A2Q M;  5DCV A;  4C4W C;  2QA4 F;  1W40 A;  1DT9 A;  3OW2 F;  3CG6 A;  2JNB A;  3G4S F;  1VQL F;  3GYQ A;  5EWR A;  1H7M A;  1VQ9 F;  3CC4 F;  1YI2 F;  1GO0 A;  1YIJ F;  1S72 F;  2ALE A;  5EO3 A;  1SDS A;  2QEX F;  5IT9 M;  1VQK F;  3HAX D;  1KQS F;  3LWR C;  1T0K B;  3CMA F;  1XBI A;  3SIU A;  3HJW C;  4LCK A;  1W2B F;  5GIN C;  5GAN K;  3CCL F;  3V7Q A;  5FJ4 C;  1W3E X;  2VGM A;  3PAF A;  2VGN A;  1KC8 H;  1VQM F;  2LBX A;  3FFM A;  3RA5 A;  3CC2 F;  3CD6 F;  3IR9 A;  1KD1 H;  3LWO C;  1VQ5 F;  1YJ9 F;  1RA4 A;  3G6E F;  1YHQ F;  1VQ7 F;  1GO1 A;  4TZZ A;  3LWP C;  3V7E A;  3LWQ C;  3G71 F;  1PXW A;  2HVY D;  2OTJ F;  1W41 A;  3CCU F;  1Q82 H;  1VQO F;  3J81 M;  1YJN F;  1K8A H;  4X3L A;  3CC7 F;  4NUT A;  2LBW A;  1VQP F;  4BY9 D;  1VQ8 F;  3O85 A;  2I6D A;  3NMU C;  3ON1 A;  4X3M A;  1QVF F;  3J7A R;  5GIO C;  3CPW F;  3J80 M;  1VQ4 F;  3LWV C;  3CCE F;  3OBW A;  3NVK E;  2CZW A;  1W42 A;  3WXM B; 
#chains in the Genus database with same CATH topology
 3JAW B;  4YJ2 B;  3CCV F;  2HP3 A;  2BO1 A;  2B33 A;  1X7O A;  4TUY A;  2IAF A;  2HRU A;  3MBM A;  4U3J A;  1YIT F;  3IEW A;  3JAW A;  4YJ2 A;  1VHA A;  4DRX B;  1TUB B;  3LFO A;  2W8B C;  3ZO8 A;  1GZ0 A;  4DRX A;  3NVI B;  1TUB A;  1IPA A;  5GIP C;  1SA0 B;  2PHN A;  2ZOD A;  3CCR F;  3JAK B;  3E20 B;  3JAM M;  4EI9 A;  1CLI A;  1SA0 A;  3JAK A;  2OTL F;  3C9T A;  1OFU A;  2KTU A;  3CCS F;  2IQQ A;  3D01 A;  4B62 A;  1K73 H;  3I55 F;  3ZP4 A;  3MCA B;  3JAT B;  3OBY A;  3CCM F;  1M1K H;  1Q86 H;  3NK7 A;  1DT9 A;  5EAZ A;  2GVI A;  3CG6 A;  4RQO A;  3JAT A;  5EWR A;  3S03 A;  2Z01 A;  5HP7 A;  1YGY A;  1UI9 A;  3WJP A;  5JVD B;  1W5B A;  4ZHY B;  3JVH A;  1QAH A;  3WPX A;  4BVQ A;  3DC2 A;  5J2T B;  5IT9 M;  1VQK F;  5HY2 A;  3M84 A;  3CB2 A;  3CMA F;  2DYY A;  5LXT B;  4EB6 B;  5JVD A;  3HJW C;  1W2B F;  3U0O A;  3V7Q A;  5J2T A;  2VGM A;  4FFB B;  5LXT A;  4EB6 A;  1U3P A;  3Q8H A;  2EWC A;  2Z1F A;  3FFM A;  3KIZ A;  4BVR A;  5MN4 A;  3ERN A;  4C8G A;  2UYN B;  1KD1 H;  1JY8 A;  4G88 A;  3VYU C;  3S02 A;  5ITZ A;  4FFB A;  3TD3 A;  3G6E F;  1VQ7 F;  1W55 A;  2VXY A;  3C9R A;  2RHJ A;  4TZZ A;  3LWP C;  4ZOL B;  2UYN A;  2HVY D;  5IJ0 B;  1ODE A;  1W5F A;  5EYP B;  2LBW A;  1JN1 A;  1YQN A;  2L26 A;  3QUW A;  4ZOL A;  5JCO C;  2V9Y A;  5IJ0 A;  5LYJ B;  3ON1 A;  1QVF F;  5EYP A;  2RHO A;  1ONI A;  3RYH B;  3OW2 F;  3OBW A;  2JNB A;  3WXM B;  4R40 B;  5LYJ A;  4ZI7 B;  3CPQ A;  3KE1 A;  3RYH A;  5HP8 A;  4LNU B;  3FBA A;  1IV3 A;  2BTQ B;  4ZI7 A;  1Z5V A;  5FNV A;  4NWO B;  3MDO A;  1U43 A;  2G9I A;  3VYS C;  4BW0 B;  3K14 A;  4O4J B;  1KNJ A;  3UT5 B;  3WGJ A;  4LNU A;  3RE3 A;  2QI2 A;  2AMT A;  4O4H B;  1E7K A;  1N8R H;  2KGW A;  3TD5 A;  3VMF B;  3UT5 A;  4I4T B;  4O4I B;  4O4H A;  3RA6 A;  3WGK A;  1NQ3 A;  3CYQ A;  5HWE A;  4BVT A;  1JJ2 F;  3HKC B;  4I4T A;  4O4I A;  5LOV B;  3V3T A;  2YYE A;  1OAP A;  2H6L A;  3I56 F;  2QTP A;  5G4U C;  5A2Q M;  3HKC A;  4IHJ B;  3HWU A;  1H47 A;  4ZK7 A;  5LOV A;  3K12 A;  1VQL F;  3GYQ A;  1VQ9 F;  3CC4 F;  3V4D A;  4PWT A;  3D54 A;  4IHJ A;  3HKB B;  3HKE B;  1SZQ A;  1VQV A;  3M4S A;  1YIJ F;  1S72 F;  1PF5 A;  3I3F A;  1XRG A;  1SDS A;  4G4Z A;  2QEX F;  3IMP A;  3L7Q A;  4BT2 A;  3HKB A;  1RQ2 A;  3HKE A;  3B6N A;  2P6Y A;  5HXU A;  3F0D A;  3HTN A;  3RYC B;  5FJ4 C;  1W3E X;  5JCO A;  3RYI B;  1U40 A;  4G4V A;  3ZP7 A;  3S0Y A;  1VQM F;  4EI8 A;  3RYC A;  3RA5 A;  3HKD B;  4YJ3 B;  1Q8R A;  3WJR A;  2VAP A;  3RYI A;  1VQ5 F;  3F0G A;  1YHQ F;  1GO1 A;  3HKD A;  4YJ3 A;  2Z1U A;  3V7E A;  5J2U B;  1K8A H;  2HS0 A;  4NUT A;  5EB1 B;  2NMU A;  2AIZ P;  4BY9 D;  1VQ8 F;  4X1I B;  4BT5 A;  2ZVY A;  3O85 A;  5J2U A;  5CB4 B;  4O2A B;  1FNK A;  3DDN A;  4X1Y B;  3CPW F;  5CA0 B;  3J80 M;  3CCE F;  2CZW A;  4X1I A;  5MN6 A;  3VTI C;  5HY1 A;  3SIV A;  1R1M A;  2UZH A;  4O2A A;  5CB4 A;  4F6R B;  1ZWZ A;  4X1Y A;  3E1Y A;  3C9S A;  1X25 A;  2VAM A;  1QU9 A;  2HX0 A;  5CA0 A;  1U3L A;  1W5A A;  3D00 A;  2MQE A;  3N4Z A;  2OHW A;  5HY4 A;  4F6R A;  5GAP K;  3WGM A;  4I50 B;  2CWJ A;  1VQN F;  3ESJ A;  4ERH A;  2KTV A;  4B46 A;  1Q7Y H;  3VIU A;  3NK6 A;  4I50 A;  2UYK A;  3AGK A;  5EIB D;  3IEQ A;  2Z1T A;  5G4V C;  5FLX M;  3CCJ F;  4WBN B;  3C9U A;  3K2X A;  3GHZ A;  3MQW A;  3PLA C;  3MCQ A;  4KWE A;  4G4X A;  3CXC F;  5HXZ A;  2HS4 A;  4WBN A;  1CN7 A;  1FFX B;  4M8I A;  1M90 H;  3S06 A;  2UYJ A;  5IJ9 B;  1K9M H;  5LA6 B;  2H8C A;  2ZOV A;  3K0T A;  1YJW F;  3RYF B;  3TD4 A;  1VQ6 F;  1IV1 A;  4BVS A;  5DCV A;  5BMV B;  1FFX A;  1TVK B;  1W57 A;  1DBF A;  3FD6 A;  5IJ9 A;  1JD1 A;  1FSZ A;  3G4S F;  5LA6 A;  2UYP A;  1J7H A;  3RYF A;  4EI7 A;  4O4J A;  4BT7 A;  5BMV A;  1YI2 F;  1W5E A;  1TVK A;  2Z1E A;  1GO0 A;  3M1X A;  2I6R A;  2BTO A;  4C8I A;  2DT4 A;  3KJK A;  5EO3 A;  1VH8 A;  1H48 A;  3VOB A;  4C8E A;  1KQS F;  3LWR C;  1T0K B;  3LDT A;  1XBI A;  4LCK A;  2Q1Y A;  5GIN C;  5GAN K;  2VAW A;  3LME A;  2LCA A;  3F0F A;  3PAF A;  2VGN A;  1KC8 H;  2GZL A;  1KNK A;  3P10 A;  2N48 A;  2FGY A;  4I55 B;  3N2G B;  5IYZ B;  4B5C A;  2OTM A;  3JAL B;  4ZHV A;  4C82 A;  2RHH A;  1YJ9 F;  1RA4 A;  5KMG B;  5AVM A;  3KJJ A;  5EZY B;  4I55 A;  3N2G A;  4ZHW A;  5IYZ A;  3LWQ C;  1Z5W A;  1QD9 A;  4IIJ B;  1PXW A;  3G71 F;  2YXZ A;  2OTJ F;  1Q82 H;  1VQO F;  3JAL A;  3J81 M;  5EB0 A;  1YJN F;  3CC7 F;  5HY0 A;  5KMG A;  2ZF8 A;  3CYP B;  5EZY A;  1VQP F;  1W58 1;  4X20 B;  2HP0 B;  4IIJ A;  5CA1 B;  1RLU A;  5JQG B;  3WGN A;  1XHO A;  3P0Z A;  4O2B B;  1UFY A;  4RHA A;  3J7A R;  5EIB C;  5GIO C;  3NVK E;  1VQ4 F;  3CD6 F;  4X1K B;  2RB9 A;  4X20 A;  2HP0 A;  5CA1 A;  5JQG A;  2KG4 A;  2FC3 A;  4O2B A;  1W59 A;  2HQS C;  3VCZ A;  2R75 1;  4X1K A;  2LBT A;  3I7T A;  2Q1X A;  5MN5 A;  2RHL A;  3VI6 A;  1GX1 A;  3VO8 A;  1RQ7 A;  3N2K B;  3VOA A;  1NJI H;  2CVL A;  3BYQ A;  1CK2 A;  5GON B;  3KHN A;  4NQ3 A;  3N2K A;  2H8E A;  3IKF A;  1RLG A;  4DXD A;  3N4Y A;  1Q81 H;  5GON A;  5KX5 B;  4ZHQ B;  4G4W A;  3CCQ F;  2HS3 A;  3GTZ A;  5LP6 B;  3E22 B;  1QVG F;  2OZB A;  1X52 A;  1X7P A;  2R6R 1;  2IG8 A;  2CSL A;  2AIF A;  3QTY A;  3JCM M;  5C8Y B;  1XV2 A;  3F6M A;  5JH7 B;  5KX5 A;  4ZHQ A;  3CME F;  1T0A A;  1NMU B;  5LP6 A;  3E22 A;  3WPW A;  2WAL A;  4C81 A;  3EOR A;  3JAS B;  5C8Y A;  2BTU A;  3LYB A;  5ITZ B;  5JH7 A;  2QA4 F;  4C4W C;  1IV2 A;  1VK3 A;  2ZAU A;  4TV9 B;  1H7M A;  3JAS A;  3S0W A;  2CW4 A;  3VYT C;  4TV9 A;  1JFF B;  2HRY A;  2ALE A;  1FNJ A;  3WJQ A;  3OON A;  3HAX D;  2F9Z C;  3P4E A;  3SIU A;  1JFF A;  2PMP A;  4E6E A;  3CCL F;  2CHS A;  5B8F A;  3S0H A;  4O4L B;  1IV4 A;  3FPI A;  3FD5 A;  2LBX A;  4HNA B;  3CC2 F;  3ZOP A;  2GLZ A;  3C8L A;  3IR9 A;  3ELC A;  1COM A;  3LWO C;  4O4L A;  5FNV B;  4G4Y A;  3JAR B;  4XCQ A;  3QHD A;  3F0E A;  4HNA A;  4B45 A;  1W41 A;  3WGL A;  4BT3 A;  3CCU F;  4X3L A;  2CHT A;  3T80 A;  3JAR A;  4TV8 B;  2ZVZ A;  4U39 A;  2K1S A;  5LP6 C;  2I6D A;  3NMU C;  3IKE A;  4BT4 A;  4BT6 A;  4X3M A;  4TUY B;  4TV8 A;  3R0P A;  4U3J B;  3LWV C;  1W40 A;  1W42 A; 
#chains in the Genus database with same CATH homology
 3CCV F;  2KG4 A;  2BO1 A;  2FC3 A;  1ZWZ A;  3E1Y A;  1X7O A;  3CPQ A;  1YIT F;  3D00 A;  3N4Z A;  2OHW A;  5HY4 A;  5GAP K;  3VI6 A;  3LFO A;  1VQN F;  3SIV A;  1NJI H;  2KTV A;  4BW0 B;  1Q7Y H;  1CK2 A;  1GZ0 A;  3NK6 A;  3NVI B;  1IPA A;  2QI2 A;  3AGK A;  5GIP C;  4NQ3 A;  1E7K A;  1N8R H;  3CCR F;  1RLG A;  3E20 B;  3N4Y A;  1Q81 H;  3VMF B;  5G4V C;  5FLX M;  3JAM M;  3CCJ F;  4EI9 A;  3CCQ F;  3RA6 A;  2OZB A;  1QVG F;  3PLA C;  1X52 A;  1X7P A;  5HWE A;  2OTL F;  3CXC F;  2KTU A;  4BVT A;  3CCS F;  2AIF A;  1JJ2 F;  5HXZ A;  3JCM M;  1CN7 A;  1M90 H;  3V3T A;  3CME F;  1K73 H;  1NMU B;  3I55 F;  1K9M H;  3MCA B;  3CCM F;  3OBY A;  1YJW F;  2WAL A;  3I56 F;  1VQ6 F;  1M1K H;  1Q86 H;  4BVS A;  5G4U C;  3NK7 A;  5A2Q M;  5DCV A;  4C4W C;  2QA4 F;  1W40 A;  1DT9 A;  3OW2 F;  3CG6 A;  2JNB A;  3G4S F;  1VQL F;  3GYQ A;  5EWR A;  1H7M A;  1VQ9 F;  3CC4 F;  4EI7 A;  1YI2 F;  1GO0 A;  1YIJ F;  1S72 F;  2ALE A;  5EO3 A;  1SDS A;  4BVQ A;  2QEX F;  5IT9 M;  1VQK F;  5HY2 A;  3HAX D;  2F9Z C;  1KQS F;  3LWR C;  1T0K B;  3CMA F;  5HXU A;  1XBI A;  3SIU A;  3HJW C;  4LCK A;  1W2B F;  5GIN C;  5GAN K;  3CCL F;  3V7Q A;  5FJ4 C;  1W3E X;  2VGM A;  3PAF A;  2VGN A;  1KC8 H;  1VQM F;  2LBX A;  4EI8 A;  3FFM A;  2FGY A;  3RA5 A;  4BVR A;  3CC2 F;  3CD6 F;  2GLZ A;  3IR9 A;  1KD1 H;  3LWO C;  1VQ5 F;  1YJ9 F;  1RA4 A;  4XCQ A;  3G6E F;  1YHQ F;  1VQ7 F;  1GO1 A;  4TZZ A;  3LWP C;  3V7E A;  3LWQ C;  3G71 F;  1PXW A;  2HVY D;  2OTJ F;  1W41 A;  3CCU F;  1Q82 H;  1VQO F;  3J81 M;  1YJN F;  1K8A H;  4X3L A;  3CC7 F;  4NUT A;  5HY0 A;  2LBW A;  1VQP F;  4BY9 D;  1VQ8 F;  3O85 A;  2I6D A;  3NMU C;  3ON1 A;  4X3M A;  1QVF F;  3J7A R;  5GIO C;  3CPW F;  3J80 M;  1VQ4 F;  3LWV C;  3CCE F;  3OBW A;  3NVK E;  2CZW A;  1W42 A;  5HY1 A;  3WXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...