1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
molecule tags Cell cycle, structural protein
molecule keywords Tubulin alpha chain
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
5LA6A 5JCOA 4O4LA 4IIJA 3JALB 1RQ2A 4B46A 2BTQB 3RYIB 4I55B 3N2KA 5LOVB 2RHJA 5GONA 3JARB 4WBNA 3WGJA 1Z5VA 4DRXB 4EI9A 4I50B 3HKDA 5EIBD 4TUYA 4TV9A 4ZI7A 3HKCA 4HNAA 4O2AB 4O2BA 5FNVB 4YJ3B 4O4HA 5KX5A 2R751 5MN6A 1TVKB 3JAKA 3JAWA 4I4TB 4X20A 4FFBB 5CB4A 5IJ9A 2RHOA 3JATA 2VXYA 3VPAA 5CA1A 5IJ0A 2VAMA 5LP6C 5ITZB 5LP6B 5J2TB 2Q1YA 3RYHA 5KMGB 3HKBB 3RYFB 1W5FA 5EZYB 4EI7A 5JQGB 4LNUB 5BMVB 3RYCA 1W581 1FFXB 5J2UA 3N2KB 1Z5WA 4O4IB 3N2GB 5EYPB 5LYJB 4YJ2A 4U3JA 2VAWA 4ZHQA 4TV8A 1JFFB 4ZOLB 5CA0A 5MN4A 3E22A 2VAPA 4U39A 4F6RA 3M89A 5LXTB 5JVDA 4IHJB 5IYZA 4ZI7B 1OFUA 3HKCB 5EZYA 1W5EA 4B45A 3JAWB 4X20B 3RYCB 4E6EA 5JH7B 5C8YB 4WBNB 4X1KB 3V3TA 4DRXA 2GVIA 2XKBA 4X1YA 4TUYB 4IIJB 4X1IA 3JALA 5GONB 4O2AA 5FNVA 3UT5B 4YJ3A 4I4TA 4U3JB 5EIBC 4ZHQB 5LA6B 4O4LB 3HKDB 4HNAB 5ITZA 4O4JA 3HKEB 2BTQA 3RYHB 3RYIA 4I55A 5KMGA 5LOVA 3VO9A 4O4IA 1FSZA 5CA1B 5IJ0B 1SA0B 4IHJA 1TUBA 1RQ7A 2RHLA 4TV9B 3HKBA 1JFFA 3WGMA 3ZBQA 4O2BB 1RLUA 3ZBPA 4O4HB 5KX5B 5BMVA 3E22B 4EI8A 4X1KA 3RYFA 3JARA 1W5BA 3WGNA 3WGLA 3JASA 3RB8A 3N2GA 5LYJA 4EB6A 4I50A 5LXTA 5LP6A 1W5AA 2XKAA 4XCQA 3R4VA 3C8LA 2BTOA 3CB2A 2Q1XA 3WGKA 1TVKA 3JAKB 5CB4B 3JATB 5MN5A 4TV8B 5IYZB 3ZIDA 5J2TA 4X1IB 3UT5A 3VOAA 5M7EA 5JQGA 4DXDA 4M8IA 5CA0B 1SA0A 4YJ2B 5EYPA 5IJ9B 1W59A 4FFBA 4F6RB 3VOBA 5JCOC 4X1YB 4O4JB 3HKEA 1FFXA 5J2UB 4ZOLA 2R6R1 2RHHA 3M8KA 3VO8A 5JH7A 4KWEA 3JASB 4EB6B 4LNUA 1TUBB 5C8YA 5JVDB
chains in the Genus database with same CATH superfamily
1JWAB 5I7UA 2D2EA 1T5SA 2C03A 4MVRA 2Z08A 4HB3A 3AI7A 5FULA 2GTAA 1B3QA 3IIMA 4QRHA 4CV1A 5H0IA 2RHJA 1TAHA 2IXTA 3DOJA 2UYNA 4RZ3A 1ZHHA 3TZEA 4PV1B 1LPSA 1T0BA 4TMFA 4RH3A 2ZCJA 2EW2A 3KKLA 2PKRA 4MS1A 5FWXA 1TZCA 2P40A 3PQ6A 1SZTA 1X6VA 3UYLA 1JWLA 5TQ0A 3R6DA 3HBNA 2CW4A 5BSGA 2JZOA 4A92A 4LZZA 1VMGA 1Z34A 4C7VA 3L0IB 5BQXA 1XN4A 2WJJA 5K1XA 3K5PA 3PENA 1I7QB 3GELA 2VWJA 2QUAA 3RCBA 4NCBA 1XALA 5FTMA 3IJEB 5KSOA 3AHGA 3QI7A 2CZGA 3T4ZA 1JEEA 1TGYA 4JNCA 2PZJA 3UFBA 1Y76B 1KSFX 3OTOB 1SC6A 2AX3A 3O95A 1NPYA 3UAVA 2F9LA 1DF4A 4LXHA 1ZGHA 3LQKA 1WTAA 2D00A 5KNDA 3LNTA 3GWOA 1OBFO 5ALGA 2BI4A 4U3JA 5CXXA 4A7PA 2YYEA 4P4SB 1E9AA 4AILC 5FL3A 4LYAA 5IC4A 1P3Y1 3HDJA 3L5KA 5H4GA 4D96A 4QBIA 2W6JG 3VHXA 2YFQA 4MVJG 2P4KA 1OXVA 1VA5A 1EFLA 3ASYA 3PUZA 4K3UA 5HFJA 2CWWA 1GDTA 3TXAA 3NFRA 5B2FA 1JHYA 3A6LA 4DIBA 2AGAA 4OP3A 2O23A 1IBLB 3PNYA 1BWSA 3SHWA 1SNYA 1VQPF 1CZRA 2V7EA 3G2MA 4V2IA 1I30A 4FSHA 5EJAA 2WICA 3S2ZA 1ENVA 3MFYA 2YIBA 5K03A 3S40A 3H1LH 1E3IA 1HTTA 5K0NA 1YZLA 5H3CA 3KJNA 3R5XA 3AV0B 3GVMA 1RQPA 2OT3B 4NCJA 3GFSA 1WP7A 1PD0A 5IYZF 3L7YA 4OFXA 3VR6H 4E2WA 1JG1A 2O1EA 1E4EA 4OBBA 3PZBA 5J63A 5IDXA 2KW5A 1KS9A 4ZHQB 1J4AA 3U0VA 2C4UA 5GIPE 3BRQA 3D3WA 4N5IX 1U8FO 2E3CA 3VYTC 4ZHYB 2YJ5A 3I39X 4KPUB 3IDSA 1IYZA 2FSVC 3GJZA 2ARKA 3A3OA 3KDSE 2FMFA 5CA1B 3BJIC 3KD3A 4K9LA 2ANBA 4LRXA 1RFLA 4PQYA 5IC6A 5AKKA 3E9ZA 2F90A 4PO8A 1U11A 3ORHA 4FCWA 3TIVA 4MRRA 2J3DA 2QJTA 5FPRA 4OXIA 1M8PA 5H3LA 4EI8A 5G4KB 2IPLA 1FQOA 1NYQA 1DT9A 2OT5A 3BIJA 1GXSA 3EG5A 3KVYA 3MTGA 1N9ZA 5H4HA 3BYZA 1YZGA 1V45E 2LCAA 5IBPA 1ZOSA 3C4VA 3FLMA 3OU6A 1EVLA 1C1DA 2PXAA 3BB1A 1YDHA 5HDQA 3VOTA 1I5RA 4U4AA 3WWOA 1Q6HA 5A2QM 1NOKA 5KKAA 1SUIA 2QG4A 3O8DA 1M2NA 1LPPA 2IYUA 2YJ6A 3N3BC 1BXZA 2HL6A 1WN7A 1JHPA 2XB6A 4EH1A 2YBEA 1EX9A 3H2GA 5FOUA 4O02B 3GTZA 1E0KA 4MJLA 5DTMA 5FBHA 4Z6KA 3SYLA 5C7IO 3ZBHA 4LMPA 3DMYA 1HDIA 2IV3A 4ZVKA 3BGOS 2OVFA 4PRZA 2QD1A 3RVBA 3MJEA 3G6EV 4PCUA 5K8UA 4S05A 1R4NA 3DPIA 3BOSA 3OPXA 4D9CA 4LF9B 2YJZA 4HFNA 3OCCA 2YBDA 5KQMA 2MINB 4CH6A 1OCCC 2R47A 1NMEA 3BN3A 4L57A 4COKA 3KB6A 4I99A 4DA4A 3NVIB 4F6CA 1EGHA 4WECA 2R68A 3CISA 4G1BA 3B1YA 1U4NA 2PKYX 4UEJA 3WHIA 2ZYIA 4AWBA 1DNPA 1XZFA 1U2ZA 4JYCA 4P7BA 1YHQV 4IHAA 1GZVA 1BH2A 3DNMA 3Q87B 4UD2A 1ZBDA 2C5BA 2G7MC 2G1KA 4K9PA 3DL0A 1DKNA 2QT1A 1LDBA 2YJGA 3DOFA 1GWNA 2XNSA 4EVQA 2A4KA 2R1VB 5AUPB 3R7AA 3L07A 5FPYA 2PX0A 3G6WA 1VCNA 3O9ZA 4TQFA 3R41A 4Z0PA 1Z7GA 4DM4A 3TGLA 3DEAA 2FDRA 2FPIA 3MMPA 4MGZR 4R5HA 4RPKA 2RHBA 4UOEA 3FD9A 2AFVA 2ECPA 4JZGA 2WTNA 4FTWA 4C76A 4YUXA 3A36A 2PR7A 1PS9A 2QYSA 3FJ1A 1RWVA 3H2JA 4J1NA 3PFHA 3QKRB 4LYEA 1BEEA 4WN9B 3VSDA 5T7BA 4KTTE 3AFGA 3V4LA 2JHPA 1U90A 3CW2A 4UCTA 3DBRB 3CS5A 4AO8A 1R0YA 1FMCA 5JARA 1IQRA 1QKKA 2VSNA 3IP9A 3FVRA 2QMYA 4FMCB 1FDUA 3KR2A 4B3SB 1DJQA 3EFOB 4TGLA 4H3KB 5JS1A 1DAFA 2P6RA 5C53B 3OIFA 1I4OA 3REQA 3Q3IA 3L7MA 4MKXA 2GCOA 2R6JA 4ISCA 3Q3EA 5H3HA 5B1SA 1R4ZA 2QPTA 5H8WA 4HNSA 3C7KA 5EHNA 5AM4A 3R4CA 1CBUA 4BIOA 3SC2B 3TTWA 3U3XA 1UFQA 3ICWA 4AY2A 1AS2A 3HP7A 3MWFA 4KGVA 1Z35A 2ZSBA 3GPBA 4E7OA 3BPZA 2YXZA 2C2OA 2BCEA 2CYAA 3VJRA 2OCIA 1NQTA 2ZEJA 2HDOA 4LBEC 4L9AA 4JAAA 5LQNA 4WJLA 1PQPA 4J2OA 2XXJA 1H22A 1W48A 4B09A 2DQ0A 1FSFA 2VTDA 1IXKA 3V46A 3CG0A 1ZK2A 1ZXLA 1NVPB 5CT6A 2HO4A 4C0QC 2BFFB 2R65A 1LGYA 1OA1A 2ZJYA 4H1VA 3EXFB 4OATA 2LIVA 5EZSA 3VYVA 2RI0A 1GGJA 3Q5DA 3U10A 3OBWA 1Q86H 4PC6A 4DTCA 3PNSA 3LUBA 4Y6OA 1Q14A 4DY4A 1AGPA 2OMEA 3FYEB 1WXEA 4DUGD 1K0FA 4ZXPA 3CC4F 2ATIA 4FJ0A 4KDRA 1RA4A 1AILA 2O0LA 3E9CA 4CT5A 4V0QA 4BJ5A 4Z9BA 1W6UA 1XZJA 2J33A 2QRVB 3E9NA 2HS4A 3FOBA 4M98A 3ODPA 4PAOA 4QAQA 3TSAA 3TTVA 2BO1A 4EA6A 1UPAA 1F48A 3H11A 2G4VA 2H59A 4JKOA 5CNMA 5DXAA 3CSUA 3CZRA 1I01A 1NKSA 4FX5A 3EZ6A 4IO1A 2C1EA 2UUAO 1KNJA 2C5LA 3IEMA 3WYDA 3PX7A 2EZUA 2HUPA 3BM5A 3P8ZA 4GR5A 1Z0ZA 2JEXA 2IW5A 1Z2CA 2C8VA 4W9NA 5HA5A 2IHNA 1J33A 2QSYA 3BC1A 2G9IA 1MAUA 3KL4A 1AVMA 4DNQA 4QPZA 5JT1A 1P4AA 3UEOA 2C4WA 4GYYA 5FWAA 4JL8A 2D5BA 4AZSA 5B1NA 2EIMC 1PTJC 1E5VA 4PYRA 1C9MA 4M53A 4LNUA 2N1BA 2IXFA 3FMFA 2VNHA 4RY9A 2OVBA 5C18A 2VHQA 4A36A 2ORED 5DSTA 4CCWA 3ESQA 5A4FS 2CTRA 1Y1PA 1HA3A 3IAS6 4FLFA 4C6TB 4NR0A 3WDSA 3AFMA 5EP1A 2BOCC 3ZBTA 4KBGA 1DFHA 4OLJA 4EA8A 2B5OA 4K9SA 3RC2A 5HKKD 1FL9A 4ZK6A 4D8VA 3ZJTA 1KDZA 2F1JA 4BGIA 3L1HA 1Z0DA 4MS2A 2HPZA 3D7SA 4AULA 2DJ5A 3GUUA 3EC7A 4NXMB 1OX5A 3BMCA 5TF0A 3ZWAA 4AUKA 4ARSA 4GZRB 3HCRA 1TZMA 4AX8A 5LQUA 3MELA 1WMDA 3FMVA 2DCUA 2EWWA 1EA5A 1W0KG 4ILKA 4J2HA 3I0NA 4IS3A 4B4UA 1BH6A 1E20A 4LYHA 1ZH0A 2QTGA 3CO0S 4Y2GA 4V0LA 3EPLA 4P0QB 4KHPO 1GZ7A 4Q3LA 3D4IA 3ORQA 5HBRA 5AOCA 3DXRA 1E3MA 3AVPA 2OAGA 3GCGA 2O59A 1KP9A 1ZL0A 1Z75A 2JGIA 3CWZA 5CP8A 1KDTA 2E87A 3C74A 3L72H 1JJFA 2A67A 2I2BA 2P5UA 1DK1A 3KOZA 5C5EA 2KS6A 3DHNA 1AD2A 1BROA 3B9RA 3K04A 3L7DA 3P2YA 4K6GA 4LS3A 4B31A 2RMKB 1Y7IA 2RH9B 4XJXA 4PSAA 4P2BA 2M1ZA 2OXTA 2AR7A 5DHPA 3V3KA 4DA0A 2UZ0A 4CMKA 2AI3A 2Q5LA 3DC5A 3ZOKA 3TUIC 3WGGA 4JTDB 2CLHB 3BGWA 3MS7A 2QI9F 3CNEA 3O0DA 3EX7C 4ZT6A 3OMLA 2OYSA 4DR6B 1GY8A 1C80A 4HP8A 1I5XA 3TNDA 4XWKA 1PJCA 1EEXB 3OFJA 4G1UC 1JLSA 3EF3A 4NJEA 4TLMB 1CY1A 4BJ6A 2QN3A 3QLVC 1RBQA 2W0SA 3NLLA 5TEWA 4E5NA 4IFEA 5E4FA 2WHXA 3RR2A 1TCCA 1VZ2A 3OLYA 2DSTA 4FI3F 4CG3A 2YWXA 4S1WA 4DAOA 2Q2VA 4RMIA 1N77A 5K8IA 3S81A 2IBTA 4Y2UA 3RTGA 4DWWA 3PT5A 3OCYA 5ISMA 3U81A 4MP3A 5GTHZ 4IHJA 2BEVA 4IX1A 2IRWA 3BXGA 4WW0A 4YQFA 4KRFA 4WFAV 1H5UA 1K3TA 1Y48E 3RV4A 1LR1A 1XHXA 1Z5OA 4RVUA 4UTOA 1W57A 1PCXA 4X95A 3RS8A 2WJ3A 1UDWA 5KWJA 4DJFC 4TTRA 3TQRA 4BZPA 3MPOA 1ZP6A 2AOVA 4Q3KA 4CETA 3JYNA 5LHGA 4FDMA 1RC1A 1TYCA 1NASA 4W5QA 2VPXA 1OASA 1QUEA 5HXUA 1O7JA 2NTNA 1OIWA 3HM9A 5AVMA 3C3AA 1N8TA 2BFEA 5IU6A 2GKGA 3C97A 2JCGA 2D7CA 1XDBA 2J9YB 4YJKA 1NBHA 1PR2A 5BR1A 1WJZA 5A3JA 1ZWKA 3RFTA 2F1IA 1XEQA 3QEKA 5DSZA 4DJ5X 3F0FA 4XDGA 3ZD8A 5KDOA 4AUMA 1K5QA 3O3MB 2DHCA 1WCV1 1UK6A 1L8LA 3HYRA 3FUTA 1WJGA 1TM7E 4AZ0A 3V4SA 3JQGB 1VTKA 2ANCA 2VDKB 2X86A 3U62A 1OV4A 4KSYA 3ZXXA 3S2IA 3GEBA 2NV6A 4WA8A 3ZI7A 3WGTA 1AX9A 2V7XA 3EXIA 3FVTA 1X7OA 4CG1A 2YRFA 4ETNA 3NAGA 3EBOA 2GYUA 2F1OA 3SYNA 1Z2EA 5FPSA 1R6UA 1F4NA 1H2WA 4ZT7A 4EQZA 4BGDA 1QOQB 1TM1E 2FWPA 2EDCA 4G5QA 4GM0A 4LYYA 1AKMA 4LDRA 4YJ3B 4XYBA 2CH7B 4WLEA 1TUEB 3L74H 3KSRA 3NBUA 5DZSA 5E4YA 3GUHA 1CZHA 1KMIY 5T4EA 3WYAA 2G0AA 3LYBA 5FV4A 2XGJA 2WU1A 4ZU3A 4WNIA 1EN4A 1DINA 5CCDA 4UFNA 5JBIA 4BVSA 2YZ7A 3L77A 1Q84A 4JI7B 4LNUB 3MS2A 1U6KA 1U9ZA 2CBZA 1VA4A 4JKYA 4C2UA 1RHMA 3JYOA 5TS2A 3SQNA 2X22A 3TZCA 2PQ6A 2DRIA 5KYVA 3KHNA 2CHUA 5KYUB 2JRCA 2FQXA 5KYGA 4ZVVA 1P75A 1MOSA 2AFHB 3L18A 5JJ5A 3AEUA 4DIDA 5JYBA 2XAUA 4QPKA 1JDSA 4INOA 4C8IA 4XI9A 4B2IA 1HY3A 4XWGA 4ARIA 2M98A 1V8DA 3CC4V 1XCBA 2I55A 2QG9A 4IINA 3WFJA 3ZE6A 1OFTA 4DQDA 1C7RA 3M70A 3MT0A 3BCUA 1G9SA 3E22A 3F3YA 3WYEA 1Z4MA 1BCRB 3QNMA 4A6PA 4YRGA 2VCEA 1V8ZA 4II3A 1UXOA 2FF5A 3AIIA 4QU9A 4WY8A 3ZDQA 2DYSC 3HFRA 3ETGA 4YCSA 4OI0A 4PA6A 2X41A 3M5DA 5JLAA 3S3XA 3Q7EA 1SKYB 3DOHA 2P9EA 2G70A 5CTAA 1R6AA 3L4EA 3T99A 1C9DB 3U44B 1YR9A 1XF1A 2PUBA 4RL4A 3E8HA 3PQEA 1XMXA 5REQA 2QNBA 3RREA 1EXNA 2BI7A 4HWGA 1U2DC 3RSFA 3JALA 3I04M 1YRAA 4YV2A 2OP1A 1UXHA 4EJSB 2VZ9A 3D3QA 1YJ8A 1Z6GA 2OQVA 5EIWA 2VT7A 1FUYB 3WK5A 2PKQO 1A4XA 2XECA 3PV0A 1YS6A 2YYYA 5FDFA 2IJKA 4LE0A 4PVCA 2XMGA 2GXSA 2QX4A 4IS2A 4CGZA 3PPWA 4WJKB 3APQA 3ERNA 1Q3TA 1E3EA 2AK2A 3I9NA 2RHLA 4DCVA 1E60A 1U3UA 3KDPA 2HK6A 5A3VA 4MS1B 4N21A 1H6CA 1NZJA 4U0JA 4RTSA 5CDFE 2Q68A 3RTCA 2J3MA 1EK2A 4R3UC 3VU8A 1N2ZA 2UVPB 2VZ8A 5TRTA 3QFTA 4TT3G 2ZUVA 2Y0EA 4MI3A 2X6QA 1XMOO 3WJQA 1ZESA 4B84A 1IOVA 3R8FA 2P9GA 3V8QA 1JQ3A 1GPDG 2X2EA 3NONA 3SICE 5IJWA 1OLUA 2ZBUA 1WF6A 2W6CX 3PTZA 1KY4A 1PDOA 4C3ZA 3CKYA 1U9YA 1IZ9A 4F2GA 4N8DA 3ACCA 4C6RA 1BE0A 4I9QA 2ZWPA 3MTIA 1I3MA 5DLQC 4EPXA 1CDDA 2AOXA 2Q1SA 2ONYA 2AXNA 4X3MA 4L3WA 2P3QA 3T4EA 1LQ2A 3WAGA 4QQKA 3SDBA 1LW6E 4ZEXA 2F3PA 2AD5A 3HRHA 4DC1A 4RSRA 4Q6WA 2EJRA 1J20A 3WLLA 2BM9A 1KVQA 3CUKA 2D1TA 3ZDYB 4XTRA 2IYRA 3BZUA 1IM8A 3P9KA 1M56C 4UNIA 2LKDA 3JASB 3FKSA 3W06A 3ZTYA 1WO8A 1ZCZA 5KQPA 4H4EA 3U7EB 2W2KB 1NRXA 1FYEA 3R44A 1JVMA 3LYUA 5A4DA 3AILA 3IAM1 2WNIA 2XUIA 3AJ8A 4A15A 5CITA 3EDOA 2WILA 1U0BB 1L4KA 1VHWA 1ENOA 1Z0AA 2C2BA 2XA2A 2HG5C 3K32A 1EINA 3J80M 1Y1QA 3K6KA 1X9IA 5HQJA 5IAEA 4BNKA 2D54A 1M67A 2IZ5A 1NP6A 1I2MA 1PJAA 2O7VA 4UPVA 5FYQA 3K96A 3R7SA 1GDDA 4FFOA 2J3HA 3PXCX 4KH0A 4R7ZA 4XD2A 1PVDA 1IHPA 4Z4HA 2V0NA 4Z2WA 2C2AA 1ESMA 2Z2KA 2GCEA 3W8RA 3K0SA 8ABPA 3DM9B 2O5VA 3HWRA 2IU4A 4QDZA 5KOYA 2V1DA 1QP7A 3K1JA 1TF7A 3AY0A 1FFGA 5F23A 1N8RH 4B48A 2QG6A 2OBBA 1R6KA 3L7IA 2F9MA 1T2UA 1SKBA 4HK4A 2IH5A 1PNMA 3D00A 3KOOA 1XPJA 5JAUA 2G5GX 5EB1B 1ZRMA 3ONWA 3P2MA 4D42A 4BFTA 2VK1A 2WF5A 1YHYA 3AOEC 1ZHOA 4L4SA 1NZDA 4NHEA 3OX3A 1DQRA 1QS0A 5CHEA 1E7MA 2QTLA 4GE0A 1S8OA 1TIKA 3M6XA 5BR7A 3FHCB 4B3MB 4EDFA 5GIOE 5JSZA 4JI2B 4RMGA 3CMEF 3QNUA 1F4VA 1QH0A 2MDTA 1J0DA 4LJSA 4N47A 1N1MA 4FQ5A 4JI4B 2VC2B 3BL6A 3CNOA 3QMWA 5JVDF 4LE1A 3C14C 1I6KA 4MW3A 2Q27A 3W5UA 2DERA 1FLAA 4R1LA 2FHPA 4JUIA 3TIFA 2NADA 1NDUA 1E9DA 3B8MA 3LSSA 1RP1A 4Z1MG 2GKSA 4Q0MA 1QF7A 1XWFA 2Q3HA 1DPGA 1SETA 1FLDA 1XTUA 1DJOA 3QKTA 2QRQA 3I09A 5FNVF 3GG2A 1FJGO 2UXDO 1NR1A 2CW5A 4HAUA 2PFSA 3IALA 4LYFA 1GUDA 1A95A 3HCAA 3WLSA 4DYVA 2IUYA 1XTRA 3S02A 1QE5A 4XDZA 4X1YA 5KYUA 3DZKA 3N6RA 1CLIA 3I9OA 3VKVA 2I76A 3LY5A 4K46A 1R6VA 2QENA 3ZTWA 1KSHA 4YIHA 4G89A 2N1MA 4MUFA 3MWJA 4F3RA 4KN8A 4GI3A 4RH1A 3NJ4A 1SM4A 4WFQA 4DQXA 5I7OA 2O5CA 2XA1A 3LDTA 1EG7A 2W2LD 4D7SA 1EM8A 1NXSA 1ZY2A 2X9NA 4KMOA 3RABA 4EM6A 4D46A 4BYMA 2HHHB 1BSMA 2OD2A 3F5SA 5EP2A 3EQ9A 3W6NA 5HKOA 3KJHA 1ICEA 3AW8A 3NB0A 1G6Q1 2NYRA 4AI6A 2Y4UA 1HP8A 4JSRA 4S1OA 3RUDA 4AN1A 4GP6A 1A2BA 1NVFA 3LVFO 1B42A 3OE7G 2HIAA 4LMRA 4G37A 3KR0A 2Y27A 4OQFA 5FBKA 1RE0A 1D2AA 1DAIA 4OQDA 4R9SA 2WSSG 3LY8A 1Q90D 1FNJA 3AGKA 5HY1A 1E1LA 1DXOA 2ATXA 2RK3A 5INTA 1HSOA 2A9RA 2I66A 1GKFA 3KLPX 4Q66C 4RD1A 3N4ZA 4J43A 1PJQA 2V7PA 2PYIA 2W2OA 2LBTA 4A6DA 4BFVA 1JP7A 2ZVDA 3DW1X 2HRDA 4DCJA 4MI9A 1BJTA 5JJNB 1FQKA 1PZEA 2FPWA 3W1WA 5DM6V 1J8VA 4WXEA 4HHEA 4M7OA 2ZR3A 3OW2F 3H9CA 5AT1A 5G3ZA 5JJCA 1MR3F 1ZO8A 2DP4E 4QDKA 3KZKA 3G9TA 3SZGA 1JEJA 1MAHA 2R8PA 4FXOA 1JILA 2GR9A 3NX4A 4Y30A 1OCEA 2ILMA 5JYDA 2PE5A 3B1WA 5BW4A 2VQ6A 4L16A 1GX1A 5C1DA 1GKLA 4N9WA 4L2IA 5FUQA 2WC1A 3N86A 4EB6B 1EUZA 3D7MA 4ZYVA 2VYFA 3N7TA 3THOA 3HWWA 2RKOA 4FX2A 5K3SA 5LA6A 4PI0A 2C5EA 5DK4A 3K94A 3K2EA 1HL3A 1Z9BA 2BR5A 4PRYA 3UCSC 1A88A 5AHOA 4ARZA 2JLUA 2WAOA 2YRWA 1I1NA 1ZSYA 3P9NA 4QUAA 4XSHA 2W8BC 2EYUA 2DQ3A 4XX0B 1Y8QA 1JMVA 4WKPA 4DDTA 5CFLA 1RKQA 5LBTA 2K1SA 1F9AA 2G9VA 1D5WA 2V3VA 1FSSA 1FXKA 5BNIA 5MN6A 4JVMA 5LFAA 3G8AA 3CPWF 2YVAA 5AP9A 4YRBA 1FC0A 2HR3A 3GR6A 3FPIA 5F1KA 1DIGA 1N8KA 3NIGB 4KLZA 4DW1A 1B6TA 2PL3A 3S1AA 4MV4A 3U56A 4IDGA 3OCXA 4LSGA 3ZWKA 1IY8A 1M2KA 1YRHA 1B93A 1YTFB 5HCUA 2BSKB 1P2BA 3EBLA 3IDZA 2WD7A 3C6ZA 4JSTA 4YCAA 5JSHA 2HHCA 5CLIA 3WYNA 4KP4A 3TLEA 2ZBEA 2OAQ1 5AW6A 3VTFA 2OENG 1XUOA 2GPNA 2Y9MB 3OBYA 2FNAA 4LJYA 1E2LA 1V55C 1JHRA 1G1XB 1XMQB 3LF1A 4DL9A 1VP9A 3C6MA 3EIUA 3Q9SA 4LZWA 2HHHO 2XTJA 2WTAA 3HSYA 1X87A 3AB3A 2FU5C 3N39C 1DQPA 3LA6A 2XQJA 4OA5A 3LI2A 2EC5A 4F8YA 2EFYA 1A9OA 5JCPA 4PAGA 4XQ9A 1JMKC 3QWFA 2CMGA 1VQMV 3HXPA 5K0JA 1TQ8A 5F7ZA 2WVHA 1RBMA 1TT5A 4YAFA 1J7KA 1D6JA 1O87A 2HV8A 3IFXA 4Q4CA 4RUKA 4CEJB 3MCWA 4R1MA 1E1NA 4HDKA 1LVUA 3AK4A 3SHFA 5BORA 2G9QA 2L6LA 5FBZA 1OBOA 1QAHA 1K5SA 1EU1A 1GUAA 3CMAF 1VIVA 2GEBA 4NYJQ 4UBMA 2VA9A 3RIHA 3AZPA 1Z5UA 1GCUA 3OOJA 5LVAA 1X7DA 1BU8A 2JLCA 1MVNA 2UU9B 4IJUA 1ZM7A 1GTMA 1XKLA 2LCIA 2X0RA 3TYXA 3VC1A 1LC3A 1BGYH 3AEKB 4GU5A 5CYPA 1SERA 1KQ3A 1L5HB 1U9IA 2I67A 2NACA 3HCOA 4XM1A 2AFIE 3O1LA 2L19A 2OYCA 3FZNA 1X7YB 1PK9A 2GUWA 4QOFA 1FJXA 1JQ5A 1EBFA 2B5WA 1F8XA 2GM3A 2QMZA 2R11A 3LPAA 3DBRA 4G2TA 4IFBA 4J1SA 4LHXA 4OKNA 4PNZA 3F0DA 4IDPA 4RIFA 3O91A 2FXVA 4MS3B 2EFJA 3T1CA 3EEIA 3NHUA 5AH0A 2BP7A 2OGTA 4LGYA 4P93A 2YV3A 3L01A 3MHPA 3O47A 5E9JA 1Q0RA 1RZRA 4KSCA 3H5VA 2EDAA 1MUUA 2ORWA 5KO2A 4RD0A 4K7JA 3UUEA 2QHXA 3WG7C 2NU7B 1GQ2A 1VYVA 3L05A 3U1BA 2ZVJA 1K9VF 3CPWU 2PX5A 3JR3A 1JS1X 4JGGA 1QGED 4UEOA 2VJLA 2FWRA 5KHGA 1N34B 1RQXA 3LWNA 4JA2A 4RHAA 3PD7A 1DG1G 3NGMA 1C7IA 1Z3CA 4CC5A 3EXG2 4KKVA 4P4SA 1BNCA 5C51B 3Q88A 2NR5A 1CY0A 1EM8B 3RE1A 3REGA 3OUSA 1C7EA 5J2UF 1Q0TA 4QNRA 2GBLC 3AGQA 4H1TA 4MV5A 5LIPA 7ABPA 2F62A 2XTNA 2VWQA 4L8GA 5B1HA 2RGUA 3UC9A 3ZLTA 1N36B 3ER9A 5G4UC 1JPJA 5G0TA 3TQFA 5EE5B 2HX1A 1W59A 3D3IA 2NSLA 2QF7A 4PFKA 4NJOA 5ETJA 5ALJA 5GZ1A 3Q9UA 4N3GA 3SD7A 5FLKA 1KJNA 3NH6A 3O8QB 4Q1DA 3VU1A 3IUJA 3VR6D 1FNSA 4OTZA 4BFZA 2BEUB 5JZBA 4BQPA 1DBFA 4JELA 1VPTA 3TTTA 2BJWA 1Q1ZA 1U28C 1ES9A 1LH0A 3VPXA 4FFSA 4BDSA 5CLHA 5LBUA 1KNXA 4A6EA 4XOUA 4C06A 4F5EA 1BHAA 5EJMA 4U7OA 2DYRC 1DKQA 2FSVA 4ESOA 4WBNA 3F5TA 1PF7E 3FAKA 4JITA 2F8SA 3WIBA 2ISQA 3NOXA 5EXPA 2DX7A 2ZQYA 5TVGA 3COJA 5EMKA 4IQ8A 4JI1O 3OE1A 1U98A 2VJAA 5K6RA 5AHKA 1MOFA 2HD4A 3C3DA 5DBGA 2PX8A 4H35A 2DUUA 3M4ZA 3PU6A 4QTUB 4WK4B 4JJEA 1UI9A 2G1PA 4LCUC 4UCQA 3GLIE 1KIMA 1QZZA 1EP2B 3GFQA 1G38A 3B77A 1GM9A 2QKCA 1OFUX 3ENZA 2MK3A 2PANA 2QYOA 2PKWA 3IDQA 3OJOA 4OKSA 4X60A 5K3DA 3UJCA 3BD6A 3L49A 3KJQA 4RV4A 3U4DA 3BB4A 5AM3A 3E9YA 4L28A 4HAXA 3RSCA 3GUCA 4EJ2A 1YASA 1LK7A 1NBWB 4IGEA 2WJZB 2WIBA 5GMOA 4ARZB 1H4TA 5CYGA 1P91A 2C95A 5KUMA 1LI7A 2QRZA 2CUKA 4KV7A 4RNCA 4UZFA 4FYIA 1UK7A 2XVAA 4NYIR 4TRJA 2XT9A 4Z1OA 2CFOA 5FLEX 3WL5A 4BE4A 2IYEA 3EZYA 1QF6A 3B6IA 3A4VA 1Z4LA 2PZMA 2ZSDA 4K05A 2I7VA 1SZQA 4MTLA 4YRZA 2FPSA 3OZCA 4R3WA 2ZR9A 4I5GA 5NULA 2IIQA 2XLBA 3T4PA 2X0KA 1TZBA 3RANA 4CE6A 4EMBA 5JWOA 1EESA 4ESEA 2V4UA 4OHMA 4J0FA 1F8GA 3PKIA 4QT0A 4TKMA 5D84A 3BRSA 5FHRA 3G88A 5E6RA 4AN4A 3GJ3A 3NTLA 1G8AA 1IMJA 2I2FA 2OPBA 2YY7A 3PE6A 2B9ZA 4JB3A 1CJKC 4OQZA 4K9DA 1IBLO 3T3GA 1IQUA 4Q4AA 3CZAA 1IHYA 2GLTA 2QAGA 5ULLA 4BNUA 3HBMA 4JJGA 2GAOA 3M4XA 4PHTA 4YR7A 4U3JB 1U6JA 2O05A 2PWAA 2UXCO 3MBIA 3FOFC 4MKZA 4PPFA 3DBHA 1F7YA 4BVTA 2Z6UA 4W8GA 2R6HA 4HRYA 3ZQUA 1EJ0A 4C7XA 1R6TA 1NLYA 2XXBA 2RHGB 3FI0A 4JODA 7YASA 1RWKA 3EXG1 3KVVA 3ZE7A 4DNFA 4DMUB 4MQUA 1WKVA 4ITRC 2VDRB 1GEGA 3R76A 1W41A 1RI3A 5AESA 3RVJA 1DLIA 3NVDA 2G1AA 2AQ8A 3TCNA 3H5TA 4BJHB 1IG0A 3PUYA 4N5LA 2QUKA 4KFCA 1N2XA 1XLTC 4DBLC 1JG7A 1KYYA 2ZSEA 1K9SA 3CWCA 3QBTA 5LYJA 1DXHA 4U7NA 2B7CA 5LJLA 4JC8A 4D9EA 4KREA 2VDNB 2YR0A 1FXWF 3UB4A 1PJ2A 3E2MA 1HEIA 5BMVF 5FWXB 3P2JA 5TGZA 5DYIA 4FHDA 4I3GA 1GGMA 4NP6A 2HP0A 3PA8A 5H82A 3V32A 4CV2A 1PS8A 1LPNA 1R8JA 5EPOA 3KXKA 4KX5A 1XHLA 3W3AA 4DB4A 3MBOA 2OL4A 3BTSA 4FM0A 1U96A 1E6WA 4KI7A 2FCRA 3ZIUA 4J0DA 1AV7A 4UVAA 4LNAA 3S7TA 4FFBA 2WP8J 2BZ1A 3H8SA 2QJWA 2C94A 3K92A 4I19A 4MCIA 3PR3A 3T3IA 1UXKA 1A7JA 4I6GA 1UP7A 3K0HA 2VPPA 5IXSA 1QVRA 2PGOA 3UJ3X 1FW6A 2PQ0A 1UDBA 4JVOA 3DL2A 1XEFA 1M1ZA 2X3YA 3NVAA 4RAOA 3AG3C 3QWHA 2WP0A 3R6LA 5AD1A 2RGCA 3IVAA 2Q0HA 2KYRA 3G7NA 3C1AA 4NZNA 3MQFA 3W5HA 3WLJA 4RHCA 1OVGA 2D1SA 2VLBA 5B57C 4FGKA 2FUCA 1HOXA 3ENQA 2XAHA 3GLTA 4URYR 3RUAA 5ICGA 4AZTA 5IVKA 3SEFA 1XL6A 1GN8A 5DYNA 1RWXA 3GEHA 3I52A 3ROMA 4WNAB 4O2AB 3MWEB 1QGOA 4F86A 2BONA 2A0WA 3T7JA 4A2WA 1T5IA 5JWRA 1VP3A 1FFBA 4WDQA 4TWKA 3QUCA 3VC2A 3S8EA 1EFHA 1BCSA 2BFEB 1TAGA 3ND5A 4TT8A 4HDMB 3RQIA 4IMPA 4PV7A 4MW8A 5CJ2A 3GJYA 1M2HA 1C9KA 1J23A 1CPYA 2C9MA 2WWIA 3NTRA 1AJPA 4J6EA 3RHSA 4C0KA 4GMGA 3VMMA 4AJKA 3EBPA 1Q19A 4EPWA 2RGWA 1D0IA 3NVKI 3RWMB 4YRIA 5J2UA 1IXZA 3BEDA 2EINB 1RZ3A 4RMJA 1SZXA 3OM9A 4RF5A 5KSPA 1XJCA 3CG4A 3F7OA 1ZX3A 2WSLA 3DFUA 4B4DA 5HF5A 3FCSB 2IYQA 1M5UA 1WA8A 3OT1B 3UKJA 3D59A 1GPUA 3BERA 5BW8A 3N8IA 3U4GA 1OCCB 2FMLA 2Q7GA 1NF3A 2NN4A 2ZJ7A 4II2A 1O0SA 4IVNA 1D9XA 5G4KA 4XRGA 1UXJA 2IPXA 4GKKO 3TJTA 1KQOA 2H17A 2DOSA 1LJLA 2ZUSA 1VQ5V 1DOAA 2HLNA 1H2LA 3OZWA 2VRZA 3Q41A 4YRRA 5T4BA 3PUIA 4HX9A 3S6JA 4A0FA 1X42A 2HPAA 5CVTA 5JMTA 1KY2A 3ZCSA 5SY9A 1XXHA 3H1EA 4J0HA 5WRFA 1EFPA 3VJKA 4KR3A 2W6NA 1U2EA 3WK9A 3MF4A 1S2IA 1L5QA 4CM9D 2Z8XA 1YZFA 4TZ0A 4XQCA 3EPPA 5HY0A 2BGNA 4RWZA 3CO5A 3OZDA 3ZKWA 4AF7A 3UQ8A 2Q28A 1MO3A 1WL8A 1XZQA 3G5TA 4JV5B 3PE4A 3FTCA 4TKVA 5JRJA 2PUCA 1QR9A 2PZ8A 3LC0A 4OL9A 1MB3A 4PQGA 4DXHA 3A3YA 1R9JA 2EFHB 4MQMA 3EFOA 1ILWA 5EB0A 4CDGA 2X7HA 4OHXA 4I55A 4H0FA 1N57A 4PGHA 5A7GA 2W9XA 4OUKX 1XMVA 4G9BA 5A2GA 1O1YA 2OC9A 3BMCB 4J29A 4JP2A 3S8MA 2NYAA 3E27A 5ALSA 1YQTA 2EX0A 4C6HA 1JI3A 2UYPA 3OIVA 3HUDA 4IGKA 2JIZG 1FTYA 2APJA 3Q8XB 3SC2A 3PFNA 1VGVA 4DR1O 4LI0A 2B30A 2CLSA 2P27A 1IBMB 5FUMA 5I5EA 2NNWB 1OD6A 2HJHA 2IW1A 4ZI5A 4XEUA 2Y71A 2XKAA 4OYYA 4QOJA 3GRYA 4GVXA 4I0XB 2QW1A 3EIFA 2DCMA 1HF3A 2OB2A 3FGOA 3DDOA 1X0XA 2H18A 5BXYA 4YCNA 3M6UA 1DC8A 2CE7A 3FCOA 4MLZA 4MKIA 4PSVA 3CD6V 3KTDA 5KSWB 1ISRA 3HB1A 4X3LA 1XQ9A 4B83A 2QRUA 5DTIA 4FN5A 2NZ2A 4FE7A 4J0EA 2QVCA 3RFCA 3WLNA 1QHXA 3HY6A 4PR3A 5ALXA 1EUCB 5DU2A 2IBSA 4MQEA 2Q6AA 4QOEA 1EUDA 1DTOA 1GO0A 4ICIA 1H93A 4EW6A 4UFPA 2FB9A 4IIDA 3H84A 4KE9A 3EASA 1KQSF 3K20A 3C5VA 2R8XA 3OMNB 2Y0BA 3LMEA 1Z8NA 4XGIA 4RCVA 4E4EA 3SZOA 3EDRA 4XDLA 5K09A 1ZPDA 4M87A 4CN9A 1SHKA 2P5TB 5DGDA 3LPCA 3Q2OA 4YP6A 1G4AE 3MGKA 4REMA 1DWPA 3B7PA 1NTZH 4BWFB 2YWRA 3OHPA 4OVKA 4Q24A 4ZQGA 3D7NA 3C0KA 3C39A 5U1PA 5MFPA 4UBJA 2KSQA 3P9YA 4ZDKA 1GPH1 1KI9A 4ZK7A 2P4SA 3DVRX 3ESAA 3GVHA 4PRLA 3AG2B 4QU0A 1U81A 1FDVA 2A1TS 2H5JA 1T2VA 3DAHA 5C7LO 3CC2F 2D13A 2UUCB 2HJ9A 4MUHA 4MYCA 1N3LA 4IDEA 2LJ2A 4FFBB 1THTA 3BA6A 1BQ4A 1IQ0A 1E1YA 4GW3A 3CIOA 1MC4A 4PGGA 2VOEA 1A32A 3I9V1 4JQOA 4X85A 2Z0AA 1E9BA 1EAYA 3FI9A 4CUKA 4PG5A 3AKZA 1MA1A 5CB4F 3JR7A 1I0LA 3U11A 1NFRA 4IXNA 1PNKA 1IXRC 4BNIA 3F7NA 1Y37A 1W52X 1JZSA 1C1HA 1X8XA 3DYIA 3T7EA 1W2BF 1J2RA 2LRHA 1KZ1A 4V1CI 1DKMA 2HWWA 1K0UA 1YTUA 1T1GA 5CEFA 1C1YA 4EKGA 3PC2A 4DV4O 4QQRA 1ZUHA 4XQEA 4XOIA 5KVVA 3W4IA 2G3YA 1X52A 4B4KA 1PJ8A 3KXPA 4W4LA 4E08A 5J5CA 3S4YA 1KK2A 5TPWA 1OYWA 4DV6O 3CCVV 4D26A 3PC7A 3SKVA 3E70C 3LL4A 4G9GA 4HVAA 4DMCA 1DC5A 4DIMA 4M83A 4EZBA 5IN4A 2Y69C 3WQSB 5JMWA 4WBSA 2HU2A 4Y3UA 4BT6A 1NXOA 4EEXA 3WMXA 1OFUA 1NW7A 3D36A 1XQWA 3H5LA 1A1VA 4TYPA 3W5AA 3G1TA 5AICA 4UUQA 4UFOA 3ZXYA 3PF8A 1G8HA 4HD8A 1E98A 4RULA 3B2QA 1KXJA 2YI8A 5TGTA 3DXRB 4DIEA 1P7WA 4EZIA 2R6DA 4JIGA 5IAGA 4UCWA 2FEXA 4AG5A 2CN1A 1J1ZA 2YWCA 4OK3A 3GJ4A 2VTBA 4MIOA 5LA6B 1Q82W 3B6NA 3MJCA 4R68A 3UV7A 4YCCA 1G63A 1T5EA 1OTXA 1E3DA 4YN3A 3TZBA 2CSXA 2WIKA 4UQLA 4TRNA 2X8WA 3W1EA 1W2GA 1R0WA 3ZLVA 4TMKA 3MCTA 1O58A 3JQAB 4TL6A 1RLOA 3F46A 4YT8A 2P6OA 1VH8A 1LBIA 2W8BB 1NLUA 5JY6A 4PDVA 3BWEA 3NXSA 1QE0A 1K27A 2PS1A 2XUJA 5HKKA 3GAFA 2HIHA 1NDHA 2NG1A 1QJCA 1FUEA 1OGYA 3FMOB 2DTEA 4JJKA 4PGAA 2Q4DA 3CSDA 4LJ9A 4L87A 1TYAE 1IG3A 3F6BX 16PKA 2JIPA 1NA5A 3KNZA 1D04A 1UMKA 3IVMA 1K7YA 3K4QA 4KE8A 3RV3A 2OQ2A 3WLKX 1NJGA 1YDEA 2GCPA 2XQIA 2ZVYA 1OV9A 5A4IS 1J2UA 2W22A 2LW1A 2BGMA 2NMVA 1GAQA 5JQGF 5CB0A 2OWDA 2ZIAA 4TTTS 4QFMA 1G5TA 2RJOA 1Z68A 5KHJA 1MO5A 1ZLYA 2PSEA 3IOYA 1IZ8A 5JQGA 4WK0B 1YZBA 1C30B 2BV3A 1E7QA 4H6PA 4J75A 4Q03A 4X7MA 3V34A 2AMFA 2NXCA 5JXHA 1E6MA 4F6RB 3LCJA 4XE5A 3F6EX 5AVZA 3QELB 1IV3A 2ILVA 4TKUA 4TMZA 3SKXA 3TZ6A 1JV2B 5JH7A 1YKGA 2R9VA 3WFZA 2ZE5A 3AY7A 4OLAA 4DVJA 2ZRLA 4OHRA 4O4LA 4YK7A 3OQOA 4FUQA 1NGSA 5IHXA 2VSQA 3EC2A 4IZHA 1FDWA 4QXAA 1DRKA 3SSOA 3RYIB 2BGUA 4F9TA 5HS4A 2YNMD 4X44A 1OXBB 3QIVA 2GFHA 5D1NA 1DF5A 1L5WA 4MUBA 1PUJA 4DR4B 5JW6A 3AR7A 1B26A 2YDYA 1FXHA 3G9XA 1W4LA 2E4UA 3JZFA 5JHHB 3JPWA 4PDLA 2P2NA 2V7VA 1SUDA 2G7ZA 1OYVA 3P19A 3N75A 2LE0A 2WV7A 1G21B 1UBHS 1U94A 4U6QA 2FWNA 3ANLA 3SM3A 4AMZA 4R8KA 3DONA 4AYWA 4YP9A 8OHMA 6LDHA 3DPUA 4HDSA 5CT8A 2ZXUA 4NDZA 2Y1KA 2Z30A 5IT5A 2I2CA 4Q39A 2FFBA 2Z43A 3O94A 1KEEA 1NW5A 3C3EA 3DGFC 1GSOA 3DKIA 5L3QA 2I9KA 3LKVA 1IXSB 2G9RA 1E5TA 4R01A 4P3KA 1GH6A 1GZ6A 4EHIA 1E69A 1DCFA 2IJGX 4XUGB 2DFLA 4GLFA 2QE7G 1AHIA 4MV7A 4I9HA 3ELBA 3IIEA 4QGAA 3X3HA 4N41A 2DUWA 2IH1C 1BHO1 1RP7A 2GN2A 2J4FA 1SWVA 3E61A 3DR3A 4ZVSA 4PN3A 2HSJA 1YT5A 5DMHA 1PT9A 4I9GA 1J0BA 3AZQA 3KIPA 4RTNA 4N9QA 5B6JA 2QM4A 1XL0A 1POXA 2QPAA 1JUDA 4KRGA 4HZGA 2ZM6B 4PG6A 3ZRXA 1YZYA 4AUNA 5HWSA 1NUSA 2N46A 3G3EA 2FOLA 1JDJA 3CCJF 2VNSA 1IY0A 1O9GA 1SKYE 1P74A 1Y3CE 2PLFA 3BICA 3T1YO 3GCZA 4BFWA 3VMFA 1PR1A 4ER3A 3QLUC 3I6ZA 1YZNA 2GUZA 2C4NA 4UCVA 2DR3A 2G76A 5JNSA 5I7EA 2RHRA 2M1XA 2MSWA 5U9CA 3MERA 4JC0A 1FP7A 4ZDIA 2QDKA 1USIA 1PQ4A 1F4PA 3HCEA 1AQ6A 1FRNA 1JJ2F 2I3GA 3LJKA 4ZOEA 5HCNA 1NQWA 4PANA 3U80A 9MHTA 1KOFA 1Q1QA 5FPHA 2NNLD 5KMGA 3I04A 1RI5A 4BXOB 1QAQA 1G8YA 3DTVB 3LS2A 3AF3A 3JRNA 4IYRA 4WXMA 3W5CA 4JYAO 4XDYA 2JAHA 3E9QA 3OQPA 3WRYC 1OB2A 3V1TC 1VPWA 2WKRA 5A06A 4MYHA 1H48A 2H4XA 3CF4A 4CXMA 3E5MA 1COWD 1YCIA 5A2QN 4YAUA 1OE0A 5REQB 1WOYA 2GNAA 2YIMA 3GDWA 4V3CA 4CIXA 5LKRA 3LGAA 1MPTA 3AWIA 3K9SA 3R4VA 3WLMA 3ZN2A 4AP6A 5BUSA 3DFMA 4X92A 5AW1A 5JSZB 4RTKA 2ACVA 1RIFA 4WEOA 4Q4JA 5IKPA 4D4KA 2ZQZA 1SR8A 1ZUNA 3NMUF 4TT3A 2ARHA 5CBHA 1CU1A 4C29A 2EFEB 5KSYA 4BT2A 1SKAA 3U3MA 4ZIRA 3VPDA 4MUEA 4QQNA 1SESA 3O74A 3OFVA 3RO7A 1QC5A 1NAHA 4M8IA 4GPIB 1SA0A 2JFNA 3II6X 3LLVA 4IDFA 3T7AA 1BDHA 1M1KW 2JIQA 3QVNA 3GRRA 1AMUA 3NCTA 1T36A 3PLNA 4DREA 5C1PA 1MIOB 3THWA 1EFRD 5DM0A 3U2QA 1B0PA 1XHOA 1FDTA 2IUTA 4AJ4A 4D56A 1SQBH 1L4NA 3ESDA 3IRUA 2VYND 4QM6A 1SHZA 2PY6A 5DBIA 1LF5A 2AIRA 2ZATA 3VR1A 4Q1AA 4M9UA 4AKEA 4QYSA 5BRJA 3GLFA 4UU0A 1E0AA 2PXXA 3KDAA 3C1UA 4CH4A 2W6IA 4GGOA 4PPYA 5F12A 3WB1A 5ADVA 1VSBA 1SK8A 4BFXA 1SCDA 1N36O 1NW9B 1KI2A 3H9JA 1HNWO 3AR3A 2PF4E 3B13B 1I4DD 3WNDA 1H1LB 3WL7A 4AT1A 4YMTA 4IXTA 3WGOA 1E2GA 3BZBA 3K30A 4I1RA 4B33A 2YN4A 1CUIA 2AC4A 1U7TA 1KUQA 3RVDA 1XTIA 1KF0A 1G8MA 2DT8A 4BIIA 2A5YB 5IAAA 2IEZA 4H1WA 1KZ7B 4UBKA 1UWLA 4LOHA 1R0BA 3IR6A 2OFOA 4FT2A 5J59A 1P6XA 5TT0A 1TO6A 4K9QA 2NU8A 3TZQA 3QFRA 5TV2A 1CZUA 3X1ZA 3W2IA 2H4FA 2CYCA 3IKVA 3ICXA 2OZPA 3M6VA 1J0CA 1ONNA 4M4SA 4KAJA 1J5PA 1J8QA 1QH9A 1ISPA 2YIBD 1NMZA 1XQ6A 3EXHB 4H7EA 3TQTA 1HTWA 3K12A 3NOQA 1H3NA 4HQ0A 4PWYA 5BYJA 3I76A 4MLCA 2ZYTX 1J0XO 1JJOA 2KTUA 1Q82H 1J8MF 1HEUA 1LQUA 2V5UA 2QZJA 2NO1A 2DR0A 4RF2A 4EG3A 1TYDE 1V35A 5AJWA 3DGEA 4FMPA 4ADSG 3ZPXA 3R77A 2C98A 2O3TA 4ECAA 5FOVA 2UZ4A 1F7VA 2EIKB 3W04A 1ZAUA 2CNNA 4NFSA 1H4QA 5LXTB 2CLFB 4BIUA 4MW1A 3OURA 1HQDA 4DCSA 2A58A 3MOGA 2NM0A 1MH9A 1CR6A 2F64A 2UVQA 1VSUA 1UQRA 4JB8A 3SBXA 3DC7A 2EQAA 2FZLA 2HF8A 2XKJE 3HPLC 3K5NA 2BI8A 3JQ9C 4TS3A 4YGXB 1M0EA 5FLXN 4GVLA 3W90A 4B3GA 3WWEA 3JD2A 3QHDA 3H19A 3IC5A 5J9FA 4DO2A 1CS0B 2BEWB 4LY6A 2Q7HA 4EO7A 2AQHA 5LQJA 4LG1A 1U0NA 2R87A 3E7DA 2NNUA 1P0MA 4UEQA 1QJ4A 3TNLA 2ZZNA 1ONPA 1SXJC 2W2QA 4CMBA 1ZCBA 5B3SB 1NSFA 3P2IA 3K9WA 3W9YA 1NVUQ 3OJXA 3NOVA 4IWXA 4EFKA 1RLUA 1UMCA 1N2OA 3KK0A 1T0HB 3J81M 1ZD3A 2QYHA 1XZLA 3M9WA 4WSOA 5IARA 4DZTA 3KQVA 3BSFA 4U0KA 5ALNA 3NW9A 2JVDA 1FE8A 4UE2A 4X00A 1YFLA 2DQYA 1ZOLA 4NXMO 1Y4MA 1IU9A 4BTVA 3N2NA 2A9HA 3ABLB 2Q1XA 2PTHA 2VEOA 5D3MB 5IXYA 2XYQA 2UUCO 4JLBA 1BWRA 3A7EA 3R6WA 5MN5A 5HKBA 2L18A 3RJZA 3DBVO 4BXOA 2FP4A 4LBZA 4WZBB 2JZCA 2WNSA 1R16A 4BW9A 1BVYF 3MAAC 4OHBA 1PWYE 4ZO7A 1I24A 1R00A 3GJSA 3A4LA 3M7MX 3G8BA 5DWQA 5AW9A 4DR6O 1U0SY 2JB9A 2ZI4A 4RZ2A 1E1DA 1XUQA 1ZGJA 3CUUA 4PIVA 1M1NB 3SEQA 2B1GA 4RVOA 4AKGA 1JU9A 3UO3A 4KWEA 4HCJA 4W9NC 3GCDA 2II6A 4GSLA 2YWGA 4DEXA 1ILEA 2C9CA 1H0KA 4N6OA 3SFZA 2PWPA 3RFFA 3AEYA 3Q1LA 4FT4A 4CTNA 5JSQA 4KO4S 1OCZC 3H8VA 2PKEA 5EKSA 1GGNA 2JLWA 4GPD1 3O1JC 2NO5A 3G0DA 2BBWA 3V4DA 1NMYA 3DHEA 4NENB 5GADl 3F0TA 4TWZA 1AK1A 3RVYA 1CRPA 1XRLA 4GI2A 4W7HA 3O3OB 4ATNA 5FH9A 1ADYA 2AEJA 4X7PA 3OQMA 3L75H 1FS6A 2YWBA 3FVVA 4EFBA 5IULC 1ZWLA 3A6ZA 3BILA 3OQ1A 3Q5EA 4JBWA 2O54A 2VAMA 4M1ZA 5K4AA 1S7CA 2HP3A 5HQ3A 2VPWA 1NXWA 5EJ7A 2J0SA 2QP3A 3AIKA 3I9LA 3R3SA 4MVYA 3D6UA 3Q6NA 4B7XA 4CF3A 4YNBA 2C2ZA 1E2NA 5G02A 3BAZA 1EFRA 2YEVA 4MTGA 4DR1B 1EH5A 1QZ3A 1WBJB 2FW7A 2CNBA 1RRPA 3L6UA 5CT4A 1SY7A 3TQOA 2DH6A 3WPXA 1FFXB 4PPGA 3WO1A 3HBAA 4JOQA 2RK6A 1RWWA 1HURA 1CY8A 3QK7A 2VFAA 2L17A 4BNGA 2PFGA 5CLLA 1LVGA 1A77A 3JQQA 1L4YA 1K4DC 3OFNA 4HN2A 3RG2A 3B2EE 2VQSA 1OR8A 3BKXA 3KKZA 2GZ1A 4ZP1A 1AQLA 1DHRA 1W30A 4LZLA 1XK6A 4RX1A 4DIFA 2ZIGA 1G9XA 4NARA 1F17A 3LT1A 1EP9A 1C3JA 3UHAA 3GPIA 2DAPA 1CP3A 3GA0A 4KG7A 4N01A 3C3YA 3QFFA 1Z37A 1OLXA 2Q73A 3BQ9A 4HMOA 2I8LA 4X54A 5FA8A 1GJRA 1H94A 1W4BA 3Q72A 3RW9A 3VR3D 4DS3A 3KR9A 2QMUA 1D4OA 1ORTA 2E7ZA 3W5SA 2O1XA 5D6OA 1O8BA 5B7QA 3R65A 1AR5A 1BA2A 1BAPA 4JGIA 3MS4A 2FRDC 1RRKA 3HM2A 4CM1A 4PSDA 2ZXWC 1J8FA 3RTDA 1OZHA 3DL4A 5L8VA 3FB6C 4BX9A 2E85A 5F2OA 5GTDA 3ZXSA 4HNAB 1O3YA 5A6VA 4MINA 2Q3BA 3PFGA 4RTMA 2IAFA 4O4IA 3OD4A 1T2EA 2YXLA 4F6LA 5KVAA 1BXKA 2FQ1A 4L5YA 4N8SA 2GN0A 1J5EO 1XP8A 2MYTA 4MB6A 2FP3A 1CX9B 1LCIA 1OU0A 3U7RA 4LBWA 4CLEA 4CKBA 1K92A 3OQ6A 5IX8A 1C3EA 2PX4A 5EOVA 1U1IA 5AVRA 1XTTA 1CB7A 5LP1A 4GOND 3ESZA 2WSMA 4UAVA 3I2IA 1E3WB 2HWUA 2PGNA 2QTCA 5JNWA 2FX5A 3ZVMA 4RXUA 1X7XA 5IYBO 5EZ6B 5TQVA 3T1NA 3AF5A 3BAFA 3MLAA 4M2LA 4KVFA 4PO1A 4Y1RA 2E75B 2HK7A 4ZDWA 1EZVH 5TMEA 2O3QA 4S1TA 4ZHSA 1B16A 1S76D 1X7ZB 4GX0A 2BGLA 2P35A 4TX1A 4FLTA 4D0RA 2NTYC 5EWMA 5FEUA 4MS3A 4GH5A 3UBMA 1OXMA 3CRMA 1JG3A 2V97A 3CNBA 2QZ9A 3G1UA 6GPBA 2VYVA 2ZSUA 3CSSA 1DT5A 4L4RA 1JYFA 2XB9A 1HQYE 2DFDA 2ZE6A 4B3DA 5LZ9A 3T35A 2AXTZ 1Z47A 3HB4X 1GNLA 3LY7A 5ELLA 2Q29A 5H81A 1JIJA 3C5WP 1O9HA 1CYEA 1MJFA 2H7VA 3AVYA 3K70B 3BQNB 3OJWA 1QIIA 1EXDA 1OUMA 3HLKA 2PM8A 2XI4A 2IY9A 4XIFA 4KIWA 2VHUA 5K3FA 4GO1A 2X15A 2UXBO 2OBYA 5F7JA 3U61B 1N25A 1MHTA 1ABEA 3UANA 4JU9A 5EMNA 1WUTA 5CLGA 1KD1W 2FE1A 3L04A 1IZZA 2OG1A 2Z5UA 3QMPA 4RE5A 3BA1A 5B12A 4DLUA 4DLLA 1AV6A 3WX0A 2ZI5A 1SVOA 3GMSA 2OCXA 5TQ2A 2OXIA 1DPFA 3IP7A 4S24A 3UMGA 1GR1A 3LWRC 3PNQA 2ZWVA 4QLBA 1I08A 2BFAA 5DOVA 5FB3A 3IODA 5ALUA 1V9LA 4DPKA 5BMVB 1PYOA 1KI6B 3ASZA 2EJVA 5F35A 2EBWA 4K3AA 3KX2A 4QE9A 1RAHA 1R0XA 1W581 3A31A 3C4QA 4G0MA 4XYLA 4M1QA 1JPVA 2HP0B 2WWWA 1KQPA 1NU1H 3COSA 4Z4GA 4FOLA 3W4KA 1CSEE 1KMHA 1YQUA 4LWPA 3GPCA 2AHRA 3A6KA 3X43A 1EM1A 4JLWA 3OO0A 4YRSA 2X8AA 3IXMA 3VCZA 3P0RA 4ML3A 2P11A 3PGKA 1DEOA 2VP6A 3ZV6A 1TK9A 3HV2A 1QVVA 1OBHA 1T5HX 1P60A 2AN4A 4P22A 5HJ2A 4G88A 3AM1A 3QPWA 4PSCA 2W4MA 3CLRC 4IKPA 1VQOF 4QXRA 4JI6B 4UAUA 5EP3A 4BVAA 4WCEV 2XR1A 2VUSA 3GEMA 4IJVA 4YWJA 1CEYA 2V7QD 4EL5A 3HXMA 3Q3CA 4DV4B 1Z6TA 2JEUA 4R40B 2C5HA 1PZGA 2GGSA 3FF1A 3MTDA 1JN1A 4DLVA 5JBNA 1WB5A 3M3HA 2Y66A 2CY0A 3ECSA 2QQGA 1H8HA 7MDHA 5L3VA 3D01A 3QLJA 4MWSA 1B3RA 1TQDA 4H4DA 4QDUA 2EWCA 3INTA 4D81A 3K8ZA 2Q8NA 3J80N 1T8SA 2GS9A 2V8BA 4URWR 1WY5A 2QTHA 2R7KA 4TWAA 4WGGA 3UV6A 4NX2A 3ZNQA 4AL4A 2P2LA 5DCWA 3OCVA 2ZSKA 1L7MA 3DMHA 4CCAA 4QYMA 3G0HA 2AG1A 3KT0A 2G09A 4EKYA 3IP1A 5EQTA 4ZTZB 5CK4A 1G41A 1PNTA 3P3NA 2IFTA 1ZMOA 2AOTB 2CK3D 2VPIA 4YHHB 2VRCD 3H9BA 4K88A 5ALHA 3ZWQA 4EHKA 2GSWA 1GFIA 4NC9A 2F8TA 4DV1B 3T5PA 3K3WA 1XL1A 2HFEC 4D4IA 1NONA 1YTFD 1S0UA 4I50A 3N5KA 1UIMA 2C4HA 2GKOA 2QAGB 3NV7A 3F78A 2R97A 4OQEA 4QSHA 3PP8A 4CMCA 3QF7A 1X3SA 3QVSA 1MEEA 2XASA 3PK0A 1TYEB 1QB7A 2D1YA 4HXEB 2B8JA 221PA 3BK7A 1G2OA 1MOQA 3B2EA 1OCRC 3NU1A 1ZK0A 1WA8B 2PO5A 3D4BA 3K9HA 1SD2A 2FFAA 4JWTA 5ILQA 4MVJE 1COWA 1P39A 3ASOC 5DTEA 3NRCA 3RS4A 3WIVA 5IZCC 4FD2A 4EYKA 3NC0C 4JSYA 1ZW1A 3RFRA 1VL2A 1YB1A 5L3BA 1CQJB 1HQCA 1NXQA 2DHEA 2H8CA 2VCHA 1E1QA 2JKZA 2XRYA 1YB4A 1DEXA 3AEZA 5DHTA 1GTJ1 1Z22A 4LF5O 1FJHA 3PDJA 2BM8A 5EWRA 4DV0O 3FKJA 3O92A 3OZBA 5KAIZ 2UKDA 3CV3A 4IJWA 4DZRA 4PLWA 1NY5A 4GBGA 3MCUA 2KG4A 1ORIA 4YP0A 3IQZA 621PA 1OBVA 1YJXA 3PG5A 5BSEA 2HJRA 3TF5A 2VSFA 3IE1A 3BX1A 5P8WA 5ARBA 1BMFD 3ICEA 1WXFA 3E5NA 3HR0A 2D5AA 1ZKMA 3P0JA 4B08A 2UAGA 1T4MA 3M84A 4TYMA 1NXVA 3NDBB 1KKUA 2VJYA 4O0MA 4BVFA 3G9ZA 4IR7A 2K1EA 1C0LA 3A06A 2QR4A 3ULKA 1FA9A 1VE9A 3VR4A 2P2GA 3OZFA 3UK7A 1I3OA 1QQCA 4C0WA 3TFOA 5KMGB 2G4CA 4K1XA 3LX6A 2IEGA 1EJ2A 2OGUA 4QJ3A 1IV2A 3C6XA 1DAGA 4YECA 5DT2A 5HOEA 4ZODA 5HJ7A 2D0OB 1K8XB 4BNMA 4XM2A 4I7EA 1IDN1 1R6NA 2ISSD 2RCYA 3UN1A 1DBIA 1K73W 3QBVA 4HXGA 1P2TA 2Z2IA 4WTOA 3BD9A 3E8FA 3F7MA 4KVAA 3MJ4A 3DKVA 3H4TA 3I28A 3LK7A 3R8XA 3AF2A 2G71A 5F76A 5FOTA 3BA9A 5EXSA 4ZXFA 3MWEA 4AP5A 3GWZA 4EYOA 1REQA 2JLRA 4FI3C 3O9OA 1UJ4A 1HE3A 3IBYA 5LA6F 1SJ9A 1XRJA 1K6XA 3OP1A 3RJTA 3HRKA 3VNBA 4AY6A 3MBKA 2HSZA 4YHBA 4DWVA 1MPXA 3E8SA 2M7WA 4HTAA 1TEVA 2FLVA 3G71F 2K87A 2WMOB 3PE3A 1DIRA 1SRRA 2D0PB 2BTUA 3LA8A 3GGSA 3OZXA 4KMMA 3ZYCA 4CLRB 4P83A 4BP8A 1UDRA 3NTUA 1DS6A 4D9JA 3LWBA 3LUTB 4KN6A 5KA5A 4OAPA 5BOSB 1L7DA 4MVJM 1VRVA 1WQ4A 3UA3A 3WB2A 1T6BY 3KCXA 1CLEA 3MCVA 1J1UA 1ZVQA 3TW4A 3ZHQA 2EJCA 2PWZA 4BL5A 2ZE8A 4H1UA 4HZIA 3TGPA 1A9RA 4NK4A 3GYQA 1UOEA 3I9MA 1FU7A 4NATA 5EKXA 5F64A 4W1RA 1YOVB 1K68A 2F1RA 5KTSA 1Q7CA 3VNAA 3KKEA 1BFDA 4JFRA 2DWUA 1R1MA 2EXXA 1B2RA 4J0IA 5AOAA 5CH8A 3H9QA 3GW8A 1GR0A 1XC7A 4TQGA 2RHDA 4YDHB 4XXHA 3E7FA 2GH1A 4UNRA 2AKEA 2O8BB 4UVCA 1OC2A 1YH3A 6AT1A 1V1JA 3PQ7A 3ZZUA 1VYHA 2RB4A 3HUUA 4HQOA 4JJ8A 4BMXA 1D3AA 3PDHA 1XE3A 4C78A 5I8WA 4MVXA 1YBAA 5A4KA 3GJ5A 1H69A 1RJGA 4G5XA 3S1SA 1VIYA 5LB2A 3DZCA 3GJXC 2AZTA 4FN4A 4ZREA 2JF0A 4I46A 1PT8A 1MZVA 4NBSA 2Q8QA 2OOKA 3TEFA 4POAA 1NULA 4QNNA 1SOAA 1YVWA 4DV1O 3NPAA 4G3XA 4B2PA 4D4JA 4PXSA 2WJHA 4Y2VA 4ZRNA 3LUAA 5T57A 1YRWA 3B7GA 1U7ZA 4HWSA 3LBIA 4KNYA 3VOBA 1M90H 1NUPA 3VPBA 4LDZA 5J2UB 1QLEB 3HSSA 3SS9X 3AR9A 1P9WA 4LHEA 1SIOA 1M2GA 4IJMA 2Y6UA 4KP7A 3TMYA 1E64A 4CIBA 2FSGA 2VKQA 3AF1A 4C5BA 1RKBA 1EVKA 1ZJYA 5ICSA 3H5RA 2GPTA 3K2IA 2Z9DA 3FPFA 4DMGA 1Y9JA 2QXTA 2IYVA 3OT7A 1R6BX 1YZVA 3AJEA 3MAQA 3CY6A 5F3RA 1SUBA 3CT6A 1ZCFA 3K0EA 5KIAA 4KSBA 1Y63A 3T5DA 2R751 2V6GA 3PPYA 2UUAB 1MABA 2GYVA 3LWQC 2HOQA 2ID7A 4G63A 3VU3A 3HJRA 3B36A 1HX7A 1A9ZA 1V8FA 1PFYA 4ID9A 5IUJC 2ODTX 3OC0A 4E6PA 2X7XA 2OKGA 3I2JA 1FXKC 3LUFA 4N0MA 1QC5B 4FB4A 1QV6A 2DQSA 2PQ2A 3BIOA 1YR3A 3IAAA 4UCFA 1KFBB 4QTXA 2X1VA 1V5EA 2WJ6A 1H2FA 4ZVOA 3O82A 3W34A 4Y2TA 2VYVD 1SG6A 4RANA 1SC9A 1VP7A 4HADA 3W6PA 1PVVA 1QMPA 4BX2A 4J0QA 5JD6A 1II8A 1BX3A 2YI9A 1WCWA 1UEXC 3C7TA 5GIPC 1ITZA 3E81A 3UMJA 1RADA 4AO6A 4B7CA 3QLTA 1YS7A 4U9IS 5JZOA 3FFMA 2VHZA 2C77A 4QBFA 4BX3A 1K9MW 1ULSA 3W7WA 3FPJA 4KNWA 4W5HA 4B7ZA 1EWTA 2RI1A 4JMLA 3A4YA 1UH5A 2A5DA 4JYZA 2JRLA 1WPBA 3LQ4A 2BLLA 4HQ6A 2F95B 4O4LF 3ABLC 4F6RA 3UJHA 3JWPA 2D8MA 3IO5A 4XUCA 3QX8A 3T6KA 5FAKA 2O2EA 4C4AA 3FNEA 1PLJA 4KUMA 2FZWA 4CT0A 1SKMA 4MITA 3HYSA 5FKJA 3V3TA 4POOA 3KJEA 3V8MA 1G20E 5FUBA 4YUYA 4Q82A 2PZFA 4AZVA 9ATCA 5B3SC 4LQCA 3NETA 1JQBA 1CXZA 1F2DA 3O8QA 1NT2B 2H3HA 5FNVA 1GO3F 4QG7A 5F5LA 5IS2A 2KBEA 3H0KA 1M34A 3ET5A 1UF9A 3FGNA 4J6FA 4HGNA 1RVV1 2I9PA 4WXPA 5TPWB 2X2FA 4ZOQI 4FSXA 3K2XA 2VRBA 4R8VA 3HGMA 4HAOA 3HKEB 1EK5A 1EGVB 3I6QA 5A1JA 5LOVA 4PPQA 1G8KA 3JQ7A 3AG2C 4JBNA 3HH8A 3OEYA 2G17A 5ERGB 3VU9A 1DO8A 2E21A 5I9LA 1NMXA 1TUBA 3ZYZA 4B74A 5DX0A 1AS0A 3Q8MA 4CU2A 2PA3A 1B23P 2BC9A 1G3IA 3UAGA 1RC8A 3EDYA 3R0IA 1Y7HA 2PRIA 4DW0A 3KCQA 4DPMA 1WVIA 4G0NA 5D85A 5LXTA 5AMXA 3HUEA 3OOWA 1K2WA 4JKIA 1GAJA 4FD3A 2ID8A 4ND2A 4QELA 3V42A 2B83A 3B1XA 3KU4A 5BR8B 3TGUH 3GJQA 1U1EA 3LLMA 3L8HA 3I3OA 5TGDA 5JATA 3JVUA 3CPSA 4QQFA 3KKQA 1Z08A 3KQOA 3ESBA 3JX9A 4G24A 4FLEA 4PX9A 4R69A 1YI2F 1OW3B 2G63A 4NKGB 1S77D 4BMNA 4V0RA 3WA6A 1ORWA 4BLVA 4DBZA 3UW1A 2B1JA 1BS2A 1V26A 2CZQA 1F14A 1E4VA 1G7SA 2CJWA 2NZJA 2ZJZA 2FZKA 4X6UA 2GUGA 4DNOA 3OF5A 3G7SA 5JD3A 4D9IA 3PQCA 5DNEA 3WNCA 3ZY6A 3BSWA 3S3TA 1X59A 1FVFA 4UXHA 1MJ5A 2BFBB 3WLIA 4KQ9A 3SU8A 1XV5A 4YT5A 3C6YA 4D0SA 1RVDA 1NRWA 1O0CA 1GNQA 1W75A 3GFGA 4LF6O 1GQQA 2QN7A 5AW2A 3T1TA 4B34A 3PVSA 4M60A 4W63A 3FYUA 2C0CA 2XBLA 1IQPA 3QWBA 1UOPA 2QR2A 5F4BA 3RHTA 3WICA 3FR8A 4B8ZA 3K4PA 4OF4A 5JNLA 5LMCA 2AWOA 5I51A 2C9DA 1SZCA 1VG8A 3OLZA 4F4LA 1BN6A 1NNSA 3LX8A 2XGMA 3ESXA 1S7GA 1PJTA 3MTJA 4YDRA 1Y6ZA 2Q9LA 4Z0HO 5A5VA 1U3GA 4ZRMA 2OV6A 3U3KA 1KZ6A 3P4UA 3DE4X 2FP4B 2FMXA 4UCSA 4L9SA 1XMOB 1K9MH 5IJZA 3BL5A 4FFNA 1MMFB 4FDTA 1CR4A 3E3MA 5BVGB 1FYDA 2O0KA 2QGZA 3ASUA 3N05A 4YEDA 5HTKA 2Z01A 1Y3BE 4TRRA 4PCAA 5HUHA 5E38A 2JASA 1EFDN 1RXWA 4N3AA 1MU0A 3WYCA 3M99B 4P3PA 4H3SA 2ZJBA 3CJTA 4GD3Q 2Q3FA 3HVIA 4N23A 1RLGA 3BK2A 4B6SA 1M4UA 1AA9A 4E88A 2KWIA 1PV0A 1CF2O 2OHOA 3LBHA 4LIPD 2WT9A 3GQBA 4XD7A 3K59A 3DUWA 3KELA 4D3SA 3C5CA 1DUVG 1CK4A 1BDJA 2OHVA 5ILGA 1TOAA 1O8CA 1YVDA 5DFAA 1QWOA 1U0LA 1V6AA 1WB6A 2ZB2A 3CGWA 3M34A 4PG7A 4WDRA 4NY1A 5AJXA 4BT3A 2OQIA 5EWMB 2HWKA 4GEKA 3SOZA 1ZFNA 4Y1GA 1GKYA 3CCFA 3K0AB 5TEVA 2CXUA 3L1KA 4EY4A 2XYPA 1RZRD 4RENA 2RAFA 5FBRB 3TUZC 4G2KA 4BPBA 3W9SA 2BCGY 1CLUA 3P10A 1WVMA 1XD2B 3CZMA 3C8MA 3KWLA 4OYRA 4Y1EA 2W6OA 3FFTA 1VPVA 2JLXA 4CQMB 4PZ9A 1MORA 3NASA 2FY8A 4R98A 2UUOA 1VMAA 3RT9A 3TLKA 2HRQA 4LF8O 4R6XA 4C0XA 3PQ2A 5AJVB 2OYQA 4EELA 4BB9A 4G0VA 1MXHA 3UCEA 4BP1A 1Z0KA 1RYBA 1D5NA 3NQ41 3CCUV 1H9BA 2H3EA 3NAMA 4YRQA 1XMIA 2C1XA 4MHTA 1PJSA 4PHZA 4LTDA 5JJIA 3FGZA 3SI7A 1NTRA 1GL9B 2FOXA 7REQA 2I62A 5B66Z 1RCTE 3SYAA 1E5LA 3D8UA 4IHJF 4BRZA 1F6BA 1UT6A 1W93A 3Q15C 4D45A 1RD4A 3L7QA 1ONIA 5E3HA 5JUWA 2F9FA 4HDMA 1YITV 2OZVA 2OMKA 3DAGA 2IDZA 1I2BA 1XAGA 2EJWA 1TAQA 3QE4A 3NALA 3AW9A 1KBZA 4Q19A 5GY7A 1F4LA 3FOZA 2MHCA 1CERA 1DV2A 4KAXA 4DCNA 4KO8A 5CB6A 2RGBA 1U7HA 1A5BB 3DEHA 3RC1A 1ODKA 1CG6A 1Z25A 3EK2A 4CEIB 2PLNA 1ZDMA 1TADA 1ZA2A 4EGJA 1OREA 3RS5A 1QRRA 5IJ9B 3JXEA 2C82A 2MYUA 4JASB 1QV9A 4JLMA 4MX8A 3VFDA 3CR7A 1CR0A 1P7YA 5G1PA 4JP8A 4HX5A 4YCDA 1DWQA 3O2JA 4U00A 1W42A 5DLEA 5ADHA 5HRCA 2XRZA 3QVKA 1N6IA 3PGMA 1Y3IA 3ZQ6A 3OBBA 4PQFA 4Q16A 1V3TA 2JBAB 4JAVA 3I9V6 2GYYA 2Y68A 4FFKA 1DEAA 1CS0A 1F6DA 1QIFA 2BEWA 1XA4A 2DPLA 3F5MA 4IYJA 4LRWA 4Z3DA 2V7BA 3WWYA 1T1EA 4RUFA 1OT5A 3R9XA 3P3PA 1EE2A 2BMAA 5ALLA 1V39A 2GWRA 1GNRA 2ZS9A 3QWIA 4HMQA 4PHCA 5J4KA 5CU7A 4NFYA 5DCLA 4HQFA 4ETMA 1Q1GA 2G1UA 1M76A 3PC3A 3URMA 3V6LA 2R60A 4WOBA 5HF9A 1IPFA 5KX5A 3IUYA 4ZYTA 1KYQA 5JDCC 1LXCA 4B5KA 1WOMA 5IDJA 1JL3A 2WHYA 1RRFA 4IJQA 4ZVLA 1JEYA 4EAAA 2WUGA 1W49A 2X6RA 1I0IA 4J0KA 1SMKA 4ZZIA 1KPIA 1B06A 5KHLB 1BC5A 4MRPA 3B51X 2HJSA 2R1UA 4E32A 1YI1A 2ZTUA 3ZEIA 4ABTA 3DBLA 1W8IA 3GAZA 1LVHA 4ZT5A 4Q9DA 4KQ1A 2B99A 4UJ3A 2JFZA 1TVEA 1K3EA 3ELWA 5LU8A 3ZP7A 4FKBA 3DC2A 3CN9A 3IJ5A 4HT3B 1CQPA 3HDVA 2I8AA 1KYOF 3I6MA 3U7IA 3R40A 5GJWC 1AI5A 1U3DA 1W1UA 3K6JA 2QP4A 3NBAA 2BRUC 3LP8A 3OPQA 5DCUA 1C4WA 2D0DA 2OV8A 4TVSA 3CCRF 3NM5A 1U2QA 1QHHA 4U2EA 4MQFB 1UM9A 3ED5A 4FNMA 3EOZA 5BNWA 3QU2A 1IDSA 1HGXA 2XWPA 3PNKA 2VDJA 3IQXA 4P3XA 4U8HA 2XOXA 1MVLA 3S2GA 3OAAG 3V7UA 1WHSB 5KYWA 1PQYA 1KI8A 1D4ZA 2WOJA 4KH1A 2XB2A 5SZJA 1Z6XA 1CZNA 2GTSA 1KNKA 1QGUA 2D3WA 2IYWA 2BKAA 3OKAA 2OCCB 5E7MA 4C7OB 3L7CA 2GVIA 1O4VA 1WZEA 2W93A 3FROA 2HGSA 4CMEC 4J7CA 1DTSA 2YMPA 2EKDA 1PD3A 4IIJB 4J10A 2OE2A 1GU7A 2V6FA 2W4QA 3ENWA 4GPZA 4L50A 4OQPA 3TGWA 3ZDCA 1LD3A 4QVGA 1NIPA 2W70A 4HB0A 1VJCA 5D5HA 2YS6A 5KHHA 3BWVA 2ZTSA 3O2QB 3I7TA 1MIOA 4YUVA 4N8EA 3WS7A 4D8YA 1ZS9A 2WM9B 3KBOA 4EYGA 5AVTA 1Y6JA 2AG0A 2EJTA 1D2MA 2VK8A 4WNYA 4ARAA 3B52X 4DLTA 4EGAA 4FWTA 4WLOA 3TAHA 1ZNQO 4OOEA 3GNSA 4L07A 5TB5A 3AU8A 4ZJPA 5GWXA 3DKPA 3HY3A 4KIJA 3G2KA 2O2JA 3NANA 1O97C 1L7RA 3PEYA 2G5TA 5EL0A 1L5OA 3H2HA 4I55F 1P9RA 4JBXA 3BJZA 4LDNA 2F3TA 3EIHA 3Q3GE 3TXXA 3WHLA 3CP1A 1AKNA 2J30A 1S89A 2XGSA 3FPSA 4TXJA 1JU4A 2IUEA 5BV0A 4B3TO 3ITDA 4DR3B 4HBGA 4TXLA 3A1SA 3E8BA 3C98A 4TN5A 2IU0A 3OM3B 3TCKA 1S5JA 1SRYA 1UCFA 2VPTA 1E62A 3KUXA 1ROPA 1WAMA 4LQDA 3P30A 4Z7QB 1IE3A 1H8EG 4XIJA 1HZZC 3SE7A 3KB1A 5A5FA 1C5KA 1UZUA 2C20A 3F8SA 1Q0LA 2EX1A 5TE9A 3HACA 3ASNC 2QUBA 1NJFA 3SR2C 4HRVA 3ZW8A 4CM8A 4E3ZA 1GG5A 3M6FA 1GTRA 3L7AA 3AMVA 3IRVA 2JJ1D 3IV9A 1SHJA 4HOYA 3PIDA 4XR4A 2OTJF 1XDZA 3KJIA 4TLBA 5FEMA 4LGCA 3AXTA 3NHFA 4G84A 3RTEA 4BZZA 1IMOA 1C9YA 1YR8A 3OLQA 1NW4A 3HJHA 4RKYA 2PUFA 3VPCA 1D7AA 3ZHRA 2OO3A 3WKDA 1A04A 4QYIA 5EIBD 1WABA 4IV5A 2W8ZA 4R8LA 1MDFA 2JKVA 2OSVA 4L6AA 3FTNA 1CNFA 1LSJA 4MKGA 5BOSA 3IPYA 3MJDA 4HO1X 2VK2A 3EJ6A 4V0KA 4J3FA 4BE7B 1Y4AE 2H1SA 3JVIA 1ESDA 3G7UA 3AETA 1BMDA 3V4RA 5DB4A 4W5NA 1MX5A 5H70A 4OK5A 4ZICA 5LP6B 5CN0A 4K8ZA 2ZXWB 2JFFA 5HP4A 5JASA 4YX9A 1ISMA 3CH5A 4R7TA 4LI3X 5LC1A 1JH8A 2WA3A 4OREX 1IXYA 1F51E 2WVJA 5J5AA 3QWAA 3SR0A 1QCZA 2C2GA 4CHTA 2CTQA 1OYOA 5EPEA 4OHZA 1E59A 4Y2XA 4CS4A 3MHSC 1UK9A 4J4BA 2HA7A 2YY6A 2FYTA 3Q8WA 2WAMA 5FYDA 1XNHA 4FQ7A 5AUQA 5T4HA 5BYKA 4CR7A 4Q9LA 2NO9A 3CRNA 4KMRA 1QVZA 4YQEA 3VC7A 3L6RA 3AUYA 1W88B 2UYKA 3ETHA 4I5EA 4X3PA 5I3CA 3IELA 3X2EA 1VQ6F 1YB6A 2EAUA 4CKZA 1R3DA 5HTOA 3CLTD 1V5GA 2HIMA 1WMSA 1XP5A 2HJGA 1DBVO 4PDMA 1X19A 5JVDA 2V6BA 3OWXA 3ASNB 3I32A 1ISHA 2J3LA 2G88A 2WSBA 1RXYA 4WZAE 5EA2A 1WB4A 1H66A 4P30A 1ISIA 1J9EA 2F48A 3UXYA 5IVPA 5CIYA 5BXQC 2R4QA 5AI5A 1VPDA 3SWWA 5AOVA 1BDBA 5T3YA 3RGGA 4D41A 1GNTA 3DEYX 1N2CA 3K2QA 2DPXA 3IUSA 3CUYA 1LDYA 2VO1A 4XFDA 3ZWNA 1U40A 8ATCA 2ZAIA 2VJPA 1I10A 4IQFA 2A3RA 4AP9A 2E89A 4CPDA 1FFYA 3QQPA 4MZXA 4O4LB 2EHDA 2B7LA 2B61A 2EU8A 4A91A 2V98A 4C5CA 1K88A 2NU6B 1ZI6A 3THRA 5TQ2B 1KP2A 3K1ZA 3I62A 1E9FA 5KJEA 4A8JC 4OHCA 1GGEA 1XRPA 1WHSA 1B6RA 2I7XA 4C43A 2IK8A 5LMZA 3G49A 1M8FA 4PBSA 2WU8A 1NKVA 4I4NA 1GZHB 2QRGA 5JS8A 1NTOA 4RVHA 1C50A 3L46A 3UJ7A 3ZJYA 1TM5E 1SCNE 3H87A 1P45A 4FZVA 4P4GA 1TM2A 3SJQC 2FN7A 1SPXA 4AZ3B 3MB8A 3OT4A 5FQNA 1JA1A 1RYZA 3LV8A 2X0NA 2RDCA 1CJTC 1M10A 1RJ9A 2PV7A 2RJNA 2BGRA 1KEVA 4IQ4A 4I1UA 4Z99A 4QIHA 2V7QG 2O2DA 3WGHA 3QHPA 4E15A 5JYCA 1YR1A 5J1SB 3Q8LA 1VL1A 4UASA 4OHPA 4DG5A 1D2CA 3LPMA 3W5BA 2C9BA 1UT8A 1TMGE 2YUIA 1G4HA 2JKYA 2OAEA 3EIOA 4JBLA 3NDRA 4M9RA 3ZWXA 1NVAA 5C4MA 2XGGA 3MUEA 2YN2A 2D2FA 2F9ZC 2Q8PA 3LT5A 4NPCA 3W1VA 3NORA 4EG6A 3ZJUA 2F17A 3ICVA 1XAHA 2H2AA 5HFMA 1UJ5A 1A5TA 3OZRA 4RD4A 5HQTA 1RRVA 4I5DA 4QD3A 1JF8A 1JKMA 2EERA 3SF8B 4CR8A 4DUYB 1CIVA 4OB7A 3ETEA 1KFKB 1FFHA 1ULUA 4CKWA 4CQLA 4RWUA 5AVQA 4TYWA 1VIAA 2D1FA 2H65A 4MLPA 1KYIA 3MBMA 4IIFA 2I4NA 1BE6A 4I7ZB 3MD0A 1QCCA 2HA3A 3FZEA 3ABMC 2PWYA 4GOKA 4IX9A 4Y98A 3R7WA 4P81A 4BIMA 1QK5A 3FSGA 1XL4A 2WA4A 2V9YA 1I2ZA 1PWEA 4JI2O 2ODMA 3PXUA 1U1GA 1OT3A 4HFJA 5AJYA 3GRVA 3N3AC 1XVUA 3NYRA 3D0QA 3JVHA 2RG7A 2XOKD 2XT6A 3O38A 4H17A 4WXHA 5E9WA 3Q7RA 3BE4A 4L5CA 3E58A 1M5RA 3R5TA 1J49A 3STYA 4QFCA 2ITDC 3PR2B 3PGXA 4Q18A 3ZH2A 3WYFA 2D3TA 4TWBA 4C03A 1GRRA 5JALA 1PSZA 2YXDA 3T38A 4IO0A 5CMUA 1UL1X 1P19A 1EHIA 2VF7A 3T7RA 2DJVA 1ADFA 1WMAA 2VRNA 3E84A 4JR1A 1C9NA 2LFSA 2ZIMA 1U7PA 3S0HA 3VPSA 3DE2X 1GV1A 4J7UA 2Y05A 1NYTA 1LLQA 1SVMA 1ZGZA 2JPDA 4FDUA 4I9FA 5FTNA 4R1QA 5GVRA 5JWHA 2QTRA 5DN6A 2YKGA 5AXDA 1YVUA 1ZIDA 3IR5A 2WDZA 3I23A 4DQUA 2H1WA 3V7FA 2DETA 2B8TA 4LZPA 1EFVB 5FOWA 4KDCA 2RKWA 2W2LA 1PN3A 2BMDA 5IFLA 1RHJA 2WAYA 3AHHA 1P5ZB 1I7FA 2GERA 4HAWA 2UXCB 3GBSA 1ZGGA 3CB4A 3PVZA 1Z6QA 4J9VA 3CSXA 4Q4JB 4ZO6A 3D36C