1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
molecule tags Cell cycle, structural protein
molecule keywords Tubulin alpha chain
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
1W5EA 3HKCA 1RLUA 5IJ9B 2Q1XA 5FNVA 3RYHB 4WBNA 4X1YB 4ZI7A 4F6RB 3JALA 1FFXB 4U3JA 5LP6A 1Z5VA 3HKCB 1RQ7A 3HKEA 5JH7A 3E22A 3N2GA 3RYHA 4WBNB 2RHLA 3RYCB 3JALB 4DXDA 1FFXA 3JARB 4IIJB 5IYZA 5LP6C 5ITZB 3WGMA 4U39A 3VOAA 3HKBA 5EYPB 5M7EA 4M8IA 4IHJA 5KMGB 2BTQB 3JATA 5CA1B 3RYIA 3WGNA 2XKBA 5LXTB 2R751 4B45A 4B46A 5CA0B 5JVDB 1W5BA 3CB2A 1W581 1SA0B 3HKBB 5EYPA 1TUBA 2VAWA 3M89A 4DRXA 5CB4A 4YJ3A 2BTQA 3JATB 4E6EA 4ZHQB 4LNUB 1FSZA 4EI8A 5LOVA 3UT5B 1W59A 5CA0A 4EI9A 5BMVA 4X1IA 5LA6A 4I50A 3ZBPA 4HNAA 4TUYA 1TUBB 4YJ3B 3VO8A 4ZOLB 3WGKA 3JAWB 4LNUA 3RYFB 4I55B 2RHOA 3VOBA 4O4LA 5EZYB 3UT5A 3M8KA 3JASA 5C8YA 2Q1YA 2VXYA 5MN4A 3HKDB 3N2KB 5GONA 4HNAB 4TUYB 5KX5A 4O2BB 1JFFB 3JAKB 5EIBD 4TV8A 1W5AA 4X1KB 5MN6A 3VPAA 1OFUA 3HKDA 3N2KA 4F6RA 4YJ2A 4O4HA 4O4JB 1Z5WA 3HKEB 5FNVB 5JCOA 4O2AB 3N2GB 4I4TA 3C8LA 4X20A 5IJ0B 3VO9A 2VAMA 4U3JB 3JARA 4IIJA 5LP6B 4YJ2B 4FFBA 4O4HB 4O4JA 5KMGA 5JH7B 3E22B 3RYIB 2RHJA 4O2AA 3RYCA 4I4TB 4EB6A 4X20B 5IJ0A 4XCQA 1W5FA 5IYZB 5ITZA 5JVDA 2GVIA 4FFBB 5EIBC 2VAPA 1SA0A 4IHJB 4KWEA 5CA1A 2XKAA 5LXTA 4EB6B 3R4VA 3RB8A 5LOVB 5MN5A 1TVKB 5BMVB 5JCOC 5LYJA 5JQGB 4I50B 5J2TB 1RQ2A 3WGLA 4DRXB 5CB4B 3V3TA 4ZHQA 3JAWA 3RYFA 2RHHA 4TV9B 4O4IB 1TVKA 5C8YB 4X1IB 5LA6B 5J2UB 5LYJB 5JQGA 5J2TA 5GONB 5KX5B 3ZBQA 1JFFA 3JAKA 2BTOA 4ZOLA 4TV8B 4I55A 2R6R1 4O4LB 5EZYA 4TV9A 3ZIDA 3JASB 4EI7A 4O4IA 5IJ9A 4X1KA 4X1YA 4ZI7B 5J2UA 4O2BA 3WGJA
chains in the Genus database with same CATH superfamily
1EFCA 4QPKA 1NF2A 1DLJA 4PYOA 5F35A 2UUCB 3N0VA 4MB6A 3TAHA 4EAQA 4U00A 3CRQA 2JI6A 3R5XA 4CLRB 3J81k 4FNOA 3KLMX 1TPYA 4FFMA 3EXIB 2OR3A 4ID9A 4KDCA 1ORWA 1U2SA 2OSVA 4PFQA 5COQA 4LHZA 5I9MA 3I1JA 3SHVA 1Z5VA 2ZNJA 3EZ2A 3CKLA 4EDHA 1JX6A 1NW3A 3N8KA 3ZWOA 3ESQA 1KEEA 2QSZA 3IBCA 2AW9A 2O0MA 3K0HA 1QQTA 4LBWA 5K3FB 2DQKA 1EKXA 3DVQX 4NSNA 2GFHA 3GRRA 3GQBB 3WK6A 1NKDA 1B1AA 2GZ2A 2O7QA 1HLPA 2V65A 3UH0A 4W5WA 4FSDA 3WV5A 2GTPA 4ZIRA 4PAQA 5B1SA 5THKA 1GNSA 1CHDA 3KAPA 1WE2A 1AQYA 4B3BA 2UZ3A 4LYDA 4XGRA 1LBHA 1AG9A 3RU7A 5IPFA 2X5OA 1QZTA 2W6ZA 3CB2A 4DA7A 3SLRA 4YPOA 1CQJB 1D9ZA 4KXMA 5AHRA 2FW7A 4TKUB 5TDHA 3SG0A 4CMEC 4DA0A 4RJJA 3GLIE 4DUYB 4DLKA 4FWBA 5HX7A 4J9VA 2Y0CA 4A0FA 1T5IA 2A5JA 3V1YA 4Q9NA 1CUSA 2X7RB 5DTQA 3UFXA 4CIXA 4EGSA 2FEWB 4BAYA 5C1BA 4H7DA 2VGMA 1EFKA 2GPSA 1EQUA 4TQ9A 2RHWA 1MKYA 1NQAO 3V2IA 1PQYA 1W2WB 4NFSA 3ZZ1A 4PW0A 4NPCA 1R1DA 4RLFA 4UUAA 1FXKC 3FPKA 5L3DA 3SEZA 5BWLA 4EHLA 3BY6A 3DHNA 3TLCA 3HI4A 2P2NA 3IEWA 2QKSA 2YMLA 5FBVB 1CR4A 4DADA 1YQXA 5TT0A 3M5WA 1F0KA 1XJ5A 4QQ8A 4BDTA 4G2TA 3KXPA 3L02A 4UM9D 4DMFA 2ZAGA 3KSDO 2UYGA 4UPDA 1CJCA 1US6A 2QUAA 1VJGA 3V5NA 3IP8A 1GPNA 2FW0A 1RSOA 1QJCA 3ASOB 1NWHA 1JY8A 4GVPA 5I9SA 4CU5A 3FOZA 1YVDA 3NCHA 4IDHA 5CX1A 2BI8A 3LPMA 2CVLA 1L5HA 4BIMA 3ZXUB 2JAQA 4I14A 1JHQA 5H9VA 3VJLA 2JAPA 4KQIA 4NICA 5HCIA 3VH1A 2B9EA 1OH5A 2HMUA 2JKYA 3FSGD 2FG6C 2ZJBA 3P52A 4BWVA 1MMFB 2Q7OE 2D74A 2IELA 3PHHA 1YS6A 4PYLA 3RUIA 4UUJC 1GO1A 2BGMA 4JJKA 2UDPA 3ROKA 3ZHCA 5KUTA 1UC4B 2WU1A 2WAMA 3OMAB 1BHO1 4IYJA 4Q15A 4PIPA 4WKGA 1FJ2A 4H7HA 3FB8C 4WADA 4HEA6 3PHCA 1MR3F 1RCUA 2X8BA 4KQCA 2EW1A 3LWDA 1M54A 4MWGA 5GGYA 4F72A 1PGJA 1O6BA 5IVKA 1U1IA 3ZTWA 4C6SA 1L8AA 3DAHA 1ODEA 3BGIA 3TZBA 2QGFA 1YQTA 2AFRA 2C58A 4B34A 5HOEA 4C81A 1BS1A 3G85A 1F2UB 1WZCA 2JEZA 3GELA 3R8FA 1WM1A 3R4CA 1G6KA 1XXHA 3B3JA 3T5DA 1WA5A 1SC4A 4U7DA 4QFCA 4X85A 3DBHB 4H1VA 4W5TA 4J0GA 1PKXA 4WGGA 4YRTA 4L5AA 3Q7PA 4M1YA 1KEZA 1HX7A 3OUZA 3SE7A 1WHTB 4QFBA 3WS7A 3BIWA 1WKBA 4HB2A 3IDOA 4DSTA 2Z9CA 3OGCC 2G67A 3C4QA 4DBLE 3VR5H 1A7UA 3R6WA 3VFDA 2O4CA 4DK1A 2NAFA 2V55B 5CDUA 1ZN2A 1JFVA 3KPVA 2Q5JA 1FP6A 4UHEA 1VE9A 2Y93A 4ZI3A 4UUPA 2F4VO 2JIPA 1LI5A 1AO3A 2P5UA 2J9YB 2IUYA 3C1UA 2VDNB 5J58A 2BH2A 2CHFA 2QVCA 3RD5A 2IZ6A 1V54C 4RKQA 3GXOA 3L82B 3HSSA 3THXB 5BWOA 4WDQA 2W83A 3WNVA 3DAPA 1WPBA 1HNNA 2HBYA 4BKOA 3DEFA 3GX1A 4HNSA 2HBQA 4Z4CA 3HO1A 4K87A 5JSKA 5I7RA 4QJFB 4ZCQA 2D2EA 1K8AH 2ZYTX 4CR6A 2C3UA 3OC6A 3IEMA 1SUFA 3SE0A 3SOZA 1ZVMA 3PEWA 1AN0A 3BTUA 5EIFA 2YC0A 1B06A 1WL8A 2HN9A 1SC1A 4L6AA 3ZDZB 4FMCF 1VIAA 3GUVA 4G41A 1L7OA 1DPGA 1V3TA 4K1XA 4PSKA 5K7SA 3WB2A 2WD8A 3MBOA 2E37A 4B45A 3F3YA 3LD9A 4H7IA 3K2IA 1HDIA 5DU2A 5FUYA 3X43A 3GJYA 3H6GA 3HJTA 4G1FA 1UP4A 3TZCA 3ZJUA 1CUDA 2AWNA 1KOFA 5CAEB 1I1NA 5JZSA 1C81A 1POWA 1SCIA 2VRNA 3H2IA 4KFTA 1UMDB 1M5TA 2I33A 3L77A 4BMSA 4PN3A 4Q3EA 1UXJA 1DKQA 2HGSA 2HNKA 3L43A 4YQEA 1FS4A 1B8OA 2IW3A 1V9PA 2GJ8A 1YHZA 4DJEC 3WMGA 2QRLA 5ICSA 4XDJA 1QYRA 2C96A 2P69A 1IL0A 3MSCA 4F92B 3HCCA 2VLBA 2J46A 3R6LA 4WZAE 1AD2A 1Y3HA 1Q90D 3LWOC 1A2KC 3CEMA 3GL9A 3AEUA 2G5GX 4XSVA 4PZ9A 2V4MA 3C6KA 4ITUA 3U2QA 3WLQA 3ICOA 4XYBA 4BWFB 3IX7A 2NVWA 3L0OA 5K05A 3FTPA 1XB2A 2DTDA 2UXBB 2ZVZA 1BN7A 4YRRA 3KQVA 2LFSA 4AB1A 2GJKA 4WF9V 3CWQA 4LJ5A 4DCOA 5TVKA 3L8HA 4DY4A 3HJRA 4LFBO 1G291 2KBFA 4O2LA 4Q02A 1ZSNA 4TMZA 5BSUA 1W55A 5JC1A 3KCNA 1W73A 2GJSA 5I45A 2B4KA 2WABA 2VH2A 3FRJA 3O94A 2PAAA 4RQTA 2GEBA 5GINE 3I04A 1P8JA 1E1NA 3QVGA 1FQWA 3CMAV 1Z7EA 2I80A 3IA7A 4G3XA 1EG7A 4JUDX 5CJPA 5CVJA 1YE3A 5AVKA 4B4VA 1C30B 2KG7B 2P78A 3ROQA 2VWPA 2AT1A 3OFKA 5E6RB 1IUOA 3DH0A 4PTLA 4L75A 4EYEA 2XDAA 4AF8A 2GAAA 3FFAA 2WLIA 4YMIA 2C2XA 4TLDA 5ALFA 4MEJA 2BCCH 3QXGA 1N5IA 4BIUA 1G8JA 2XQGA 3K73O 3QENA 5D3QA 5EOVA 4J76A 5EY5B 5F1OA 2Q5ZA 1SXGA 2G0AA 3K15A 3VYUB 1ZBQA 3ZVRA 3FKJA 1H05A 4J7UA 4BW9A 3AX6A 4OJKA 3H65A 4IFEA 4YP6A 1QLNA 1R4MA 4OHBA 5IAJA 4C5CA 4MPJA 5JAUA 1IHPA 2I6DA 4N65A 1NTOA 3B5EA 1IZYA 1SU6A 3U10A 2O3TA 4J4TA 4W99A 1E89A 2PGNA 2CKMA 2V45A 3CRMA 1Z2DA 4MNTA 1GQYA 2R8EA 3EMDA 3IEKA 4Q24A 3HXPA 5F33A 2XUMA 1SXJD 3PUZA 2H8EA 2IZ5A 3WJ7A 5CYGA 3UFBA 2CXRA 2EWVA 4I5FA 4EHBA 1OF1A 2OOSA 2VJKA 2OPHA 4C43A 2HK7A 3P0EA 1OGIA 1G5PA 2C2MA 5HG0A 1Z8FA 4MUAA 3WHKA 1C3OB 4BNDA 2QGNA 2QUHA 3JVHA 3VYSC 4RENA 4ZCTA 1SXJE 3G02A 4HQNA 3RV4A 5EIWA 1DLIA 5KOYA 2V74B 1V43A 5TV2A 1NXTA 3PGKA 1HETA 2IPNA 2QRNA 4MK4A 4LJYA 3X0DA 2WWRA 3JZAA 1PJ2A 1RBMA 4V2IA 2ET6A 4XCVA 5A7FA 1OROA 5KWVA 4IGGA 3PI6A 3TZ6A 1VQNV 3EVBA 2XCTB 1OI4A 1DFHA 3KDAA 4UHDA 2BOCC 3CC8A 3MJSA 1LC0A 4NONA 2OTCA 4P5DA 5LGNA 4PHTA 5D2CA 4HPJB 1AB5A 1E6KA 3QE4A 3CXHF 4EGJA 4NEHB 1QK4A 4W1QA 5E3JA 5EYPB 1FB5A 2SCUA 1WR8A 1KFKB 4IYRA 1M4UA 5G40A 1GMGA 1HRDA 3BGOS 1BJTA 2F1RA 2OWEA 3E3NA 4ZZ3A 5C37A 3UMRA 4A8PA 3SLKA 3N2NA 4JZGA 1IQUA 4JHXA 3JVIA 4BNNA 2DHQA 2H06A 3TL3A 2CMHA 2YMPA 4MVJI 1DXYA 4IGEA 3HWRA 1NI4A 1N2JA 1CF4A 5CDYA 1TYEB 1PFQA 3U56A 2DF8A 1ULUA 1L5MA 5TQ0A 1BVHA 1EZ1A 1HURA 4ZPJA 3M1AA 3MTBA 3R3XA 3ONWA 4QUIA 1EFRG 3CN9A 1Y6JA 1Q16A 4NS4A 5FL7G 3AQIA 3FYHA 1SBIA 1U9CA 1ESZA 1XRQA 3D7LA 3T3OA 1BS3A 1EUDB 2XUQA 4NTWA 3IJPA 4DC0A 4DQ0A 3N7TA 5T6BA 4FZ1A 2WU0A 1J90A 4FC7A 4LC0A 3P9XA 3ZLVA 1GZSA 3KUDA 2JRLA 2NU9A 3OZAA 3OPYI 3TFQA 1L5OA 1MT3A 3COWA 3JQRA 2WIBA 3TL2A 1DEHA 2CCGA 4KO8A 2OFFA 3UJ6A 1I08A 2WIAA 3WICA 4B3FX 2HPZA 4Y2UA 5JATA 4RAIA 1I94O 3W5HA 4E7PA 5M2QA 1Q6UA 5C8ZA 2LW1A 1RXSA 3M70A 5FF9A 5B58T 2V6MA 1YA8A 4J80A 4NBLA 3HCDA 4RH1A 5CVVA 2BFEB 3O7WA 5LGTA 1A8HA 1D9XA 2GERA 1RC0A 3DW1X 4IWNA 1ENVA 1I9CA 3UAZA 3ZDAA 3Q2KA 4UATA 5CNMA 2XY4A 2FV8A 2EFEB 1VJRA 1JZSA 1Q92A 2F4VB 1RLGA 4J42A 1I01A 1YWGO 1K8RA 1NVKA 1TADA 1KYQA 1QBZA 1L5HB 4X20B 2CL7X 4XCQA 4IH4A 1RXVA 3PC6A 4OFZA 3OT5A 3HJHA 1T0BA 4BBPA 3EC1A 4TXJA 1N7JA 4PXYA 1GZVA 3LA6A 1W0JD 2TMGA 1UKVY 2BT4A 2X8LA 5AJVB 3WWEA 1Q17A 2WWIA 3H1GA 4R68A 2BW0A 3NO4A 1N4CA 3WG7B 4HLQB 3JYQA 3NP7A 3I34X 4NWOB 1T8RA 3L7YA 1U2RA 1Y42X 4K9OA 2WT9A 5DMXA 3IPXA 4PYJA 4TWIA 1DKLA 5IT4A 2FZKA 2I7XA 1ZYUA 2ZVJA 4BDSA 4D96A 4EP1A 4Q00A 8ADHA 3K5HA 3RC3A 3KM0A 4OO3A 5LWQA 1NLZA 4D0GA 2ORIA 5B3KA 1GM9A 2DWCA 1GZUA 3HSYA 3TJZA 4GNKA 3VBEA 4EEZA 2W6PA 4W6ZA 5EE1A 4UQPA 4MA0A 1VE3A 4LOLA 3ML0A 1K8XB 5IT5A 3P0RA 1EM8A 4UEJA 1NGSA 1IDOA 4ZGBA 3C8MA 1P0PA 1S2NA 1ZUNA 3R5JA 5J4YA 1Y3AA 2EYUA 3UHPA 3GMDA 2D7CA 1Y6RA 5HMLA 2QN2A 3LY9A 1QVGF 3L8GA 4RETA 2VTBA 3SQXA 2WNHA 3FHCB 3LWRC 2ZKIA 3EMVA 3K08A 4CMIB 2FUG1 2YJNA 2QQEA 4X84A 2GF2A 4R01A 3AK1A 1NE7A 3B40A 2OB1A 2PKXA 4X8HA 4BFYA 3QI7A 1RW4A 4MV3A 4FGZA 3KBOA 2R9IA 3GFTA 2Z9BA 5DISB 2UUBO 1DB3A 2XNJA 5T4FA 2H2IA 3WZMA 4KWIA 4P4SB 4KPGA 2TMKA 2K2WA 1D2RA 4KHPB 5LQSA 1NI4B 2HDNB 3WP0A 1NP3A 4JQOA 4TM8A 4B71A 1B1CA 3LBFA 4GR9A 1E1RG 3ABSB 3PUKA 2LP7A 4B46A 4XUDA 1NTMH 5DNWA 2Z6AA 1UEJA 2B4YA 1ZQ1A 1GHTA 2G6BA 1QIHA 2PIDA 1HFWA 1PR3A 4CT4B 5K0FA 4U9UA 4S1WA 5J1SB 1SVLA 2ZYGA 4OI2A 2ADPA 5AVMA 5IT9M 1UFQA 2EZUA 1EM6A 3D3WB 2H94A 2WB2A 1Z73A 1GZDA 2XUAA 5CBPA 1JAXA 2XTAA 3TK1A 2PJUA 4HI0E 4JFRA 1AQIA 1CY0A 2W4MA 4GSLA 1U1GA 4KQGA 4XWAA 1TGOA 1LZLA 3ZV6A 3A04A 4KX5A 3HR4A 4ER0A 1TVMA 1ZY2A 3IIEA 5CAEA 3H97A 3FBGA 2CSXA 1L3BA 1NIPA 1Q19A 2WLLA 2OAGA 3ELDA 4RE6A 3UO3A 4CKBA 5C5IA 3WJRA 1P6UA 4EY8A 4YP5A 3AK3A 2JFFA 5DM60 2HQ1A 2NZJA 4L2IA 3VJRA 1MAVA 4OK5A 4OIFA 2V7XA 2HOQA 4JLNA 3N2KA 1KYVA 4FPPA 1U98A 4MVWA 2G88A 4QULA 1OB2A 2ISCA 3B1VA 1B8VA 1AY0A 2GX6A 3ER6A 3L4BA 3M49A 4CI0B 3IUBA 4PWZA 3X1WA 3RUDA 2ZPUA 2NNUA 5K0BA 4X20A 2ETNA 4LBYA 2MTBA 4KJZA 4OXYA 3K53A 4Q7EA 1AQ6A 1C0EA 3O65A 1NBOA 4U9IS 5KKCA 1U3TA 1CRPA 3E9QA 1KVRA 4AIRA 4BWYA 5BWCA 4Y9UA 3OZDA 3RC7A 1AZLA 2IUTA 1PYGA 2XDQB 3LQ4A 5CBFA 3W4KA 2IH1C 2P6JA 3DZBA 1PWHA 1NTRA 4MV6A 1YQWA 4TZTA 2Q0HA 2W7TA 3MWYW 1ZJ4A 1TAQA 1U1CA 2GZ3A 4IDNA 2AI1A 3RWMB 1YK0A 3S28A 4QBTA 5AMXA 5L51A 2VHQA 2KG7A 1W8IA 3RVPA 2F43A 4BAZA 1QPGA 2DOSA 3PEVA 1EFPA 1H65A 2IUSA 1YHQV 1Q1BA 3C6XA 1U4SA 3D8BA 3GLTA 2P0AA 2WLIB 2AX4A 1ZAUA 1S8OA 3OKCA 3NLLA 1GDDA 4MH0R 4O5OA 3PICA 2GCOB 4G5OA 3FKSG 2OFWA 4MV9A 4CPDA 3VSBA 1LLUA 3FH0A 4E13A 4P0PB 2E3CA 5EESA 3USCS 4B35A 1QFSA 3EVKA 5D8DA 2J9XB 3C3SA 2XOEA 1ZK2A 4BP8A 1P7CA 2EILC 1FTYA 2DW4A 2BELA 2GNOA 2QUIA 1YR2A 3EZ7A 3ONVA 3T34A 4G0PA 5BW5A 1GFSA 3P0FA 1TA8A 1BKDR 4BATA 3T9AA 1NQ3A 3SOPA 2C3YA 2YTZA 2QQGA 3PA8A 1EE1A 5GJCA 1PI3A 3H19A 3T35A 4J7JA 3SAJA 4CL2A 1MRNA 1AKTA 4ZT6A 5ICMA 1LPNA 1YNOA 4C01A 3C8ZA 4WLOA 5JJNB 4Z2YA 1RE0A 3C14C 3UYKA 3BABA 3GLHA 4PQFA 1T4CB 2VR1A 4DQUA 1V8BA 4KN8A 1ZSYA 1J95A 1G4AE 1YZUA 2I6SA 3HJCA 4QBIA 3WVNA 1XVAA 3QUTA 5JXGA 1E9FA 4IHAA 4QUGA 4DHWA 4B7AA 4NR1A 1KZ4A 3CLSD 4BC1A 5BT8A 3CGGA 4MV5A 2WICA 2XF2A 4MI3A 3TLGA 2PRZA 4YAKA 1PTJA 1X7WB 4JUCA 3MBMA 1C0PA 1WXEA 2GKGA 1P9OA 5FOXA 5KJ1A 2A1TS 4ZO4A 3OQJA 5FYDA 1HE4A 4ATNA 3TG8A 1U81A 5HXZA 3CPEA 2CLCX 4G89A 1G2IA 2UZ1B 4ME6A 4WOCA 1RM5A 3WGHA 1HDJA 1MO3A 5GM2A 3EPPA 2R1ZA 2W8BC 3FNBA 2HS0A 2K5UA 1ZOOA 5KC8A 1ILEA 3W8EA 2WOOA 1OKKD 2WLLB 5LBTA 2RD2A 1DKRA 2R66A 4IZHA 2P4VA 5DJ5A 3PDWA 2SKDA 1FDTA 2WYWA 4LJ7A 5E79Z 1GD1O 3RS4A 1ND5A 4DSUA 1IIRA 1KHHA 1TMOA 4HLNA 5EAIA 5HY0A 1YJXA 1GRVA 2XZOA 1G19A 4JTDB 1H6BA 3N2KB 2XMZA 3FBWA 4ZJYA 1LEHA 1L9KA 1PX0A 2BMAA 3H9GA 1XJQA 5B3SC 1RP3B 1BX0A 2XJ9A 4D8WA 3CC4V 1GWNA 1DCTA 4H1TA 4NB5A 4MKGA 4RQFA 2PKQO 1ZJ6A 4IJMA 4BNXA 3I09A 3HJAA 1F06A 4EFMA 2UKDA 3Q0IA 2Q45A 4KP7A 3A2FA 3F3MA 3KFLA 4H6WA 4O8CA 3ZVNA 1OFUA 1K9MW 2OTLV 4FNMA 1AGYA 5DGXA 2YWFA 4K6FA 1EFTA 1HL7A 5DGDA 1LDNA 2OBFA 3TKAA 5J43A 5KYKA 5DEOA 4LYGA 4O4HA 1WHSA 5I7WA 5GINC 2IBSA 3GJQA 2BR4A 3KJZA 1JU9A 4KWTA 2DPXA 3SQOA 2FSIA 5HJ5A 3PXBA 1EJ6A 3E58A 3ZJTA 1JJ2U 3BB3A 2Y1CA 1M9NA 4UFOA 3RAJA 3V48A 4R1MA 4CFSA 2AOUB 5AXCA 3DE1X 3KT8A 2XMBA 4JROA 3WMFA 1EFRD 4DS3A 1P31A 1X6VA 1WUTA 3DFIA 1DIRA 2Q5OA 4PFSA 5FJIA 3SYQA 2C4UA 3F9IA 2LCFA 3TVDA 3ZKWA 1XT6A 2X0JA 1Z0IA 4KRGA 5C80A 1L4GA 3R7NA 5EMMA 1XRLA 4HTFA 2Z98A 5EINA 4AUKA 4ZO7A 2PFSA 1P2GA 1UPXA 1BCCH 2EJWA 1NHGA 4NZPA 1FXWF 3KSRA 4PQRA 4F97A 2W2KB 3HBJA 3VC2A 2JFGA 1R3KC 1CJVC 2FW8A 5IARA 5I48A 5JWOA 3GLGB 4XKJA 2XNDG 1A5BB 3ZWNA 1EPUA 2VUHB 2GRJA 1SETA 1ZK4A 2DBZA 2J5XA 3EIWA 3GU3A 4PAGA 2G4VA 5DHFA 2NG1A 3I01M 4TZ0A 3BMCB 1VMAA 3AVPA 5HMMA 1UK8A 1WSAA 1GFZA 5DOVA 2VZLA 2Y99A 4V0MA 4XWKA 3TETA 5J9FA 3CD6F 1AB3A 1YC2A 4G09A 2VP2A 3QVVA 4DAOA 1QBGA 5JW6A 2B8TA 2I6UA 3AZOA 3MZ0A 4UOQA 4WKBA 1HNZB 1N0IA 3R3HA 1O6FA 3WLKX 4GECA 1UBMS 4I1IA 3D3QA 3L7QA 2EVWX 2R1VA 5JCXA 4DO2A 2J6HA 4NXMO 3BJMA 1DAOA 1GPLA 3AK4A 3DPSA 3E9YA 3HXQA 3A06A 2HP8A 1XRPA 2KHZA 1VRVA 3LYUA 3B9BA 5I4BA 5EJ6A 2J3JA 4YYEA 1TYBE 3MAJA 3ZZMA 3RW9A 2XCOA 4PI0A 3I04M 4MV1A 4U3FH 4P7KA 4TN5A 1DBQA 3L0DA 4PA9A 1W0CA 2Q49A 5FJJA 1XZNA 4B48A 3B1YA 1YCIA 3K6KA 4G86A 3V4VB 1JJOA 3DEYX 4OHVA 3G8DA 1YDEA 2ONJA 1BMTA 1ODJA 2Q3LA 2Z5UA 4AMGA 4OU4A 4GYJA 4V39A 4FONA 4MO2A 5JJBA 4ABMA 1HKHA 2EINC 3BA9A 1P18A 2AYYA 4CQJA 1U94A 2G36A 1E1LA 3MJRA 2WKWA 3PNYA 2IOYA 1GCGA 1QR6A 2BFOA 3F7YC 4JBXA 1KJQA 4Q93A 4D42A 1NY5A 3LDFA 4G65A 4U6QA 3CKKA 1G7SA 2WM9B 1QR9A 4MRMB 1HZZA 1ZC4A 1A76A 3RRMA 1E9DA 1IU9A 3VR6A 4YT8A 4FTWA 2UZAA 3D6NB 2J0SA 1IOWA 4PG6A 4WZ6A 1KZYC 3ML1A 2NSDA 1RI2A 1Z0JA 1J8MF 2ZEJA 1YR8A 5CNKA 1W0KG 1TUBB 2W42A 3RIEA 1R16A 2QA4V 3ENNA 5BR4A 2QRUA 3CC2F 2MU1A 4BKPA 1IQRA 1C4WA 3SEFA 1SVMA 3D3WA 1AJEA 5EZYB 1NVTA 3PUYA 1OA0A 3IQWA 3QP9A 4O25A 3PCRB 3RDPA 2WA2A 4EHIA 2HVYD 1BA2A 2PGAA 1PR0A 3S1SA 4JQCA 5JYBA 4NULA 4Y6LA 5BN3A 4UARA 3VH4A 5LQAA 1K86A 5G41A 1RIFA 2YDEA 3KTDA 5FCDA 5I8ZA 4GPZA 1MZFA 1B41A 1OLOA 2RHRA 3A3KA 3ICQB 1O58A 2IYXA 4HL6A 4LHWA 5FBHA 5MN6A 2INGX 2QPTA 1IN5A 3EVZA 4WHMA 2XKJE 4Q4DA 3OR6C 2JCYA 3JR3A 4JAUA 3IPCA 3QY0A 2EF0A 3EG5A 1X7HA 4UXJA 4W82A 3SJ7A 3NMUF 3TGWA 1KQOA 3ONNA 5A6VA 1PK8A 3WR5A 2GM9A 3QEJA 1MENA 3ZD8A 4A0HA 1YDWA 3CUUA 5FPQA 1K73W 2NP7A 3EHDA 3Q88A 3EQ7A 3BHIA 3ROEA 1CR0A 1TO6A 2EW2A 2Y77A 1EUQA 3D3KA 2C95A 3LUGA 4IJKA 2J9FB 4HPWA 1RRKA 4AQ7A 3N5CA 4Q03A 1JCHA 2Z43A 4EARA 3KXDA 3DZIA 4XVRA 4OHPA 1D2MA 1CUBA 2X0FA 4QSMA 4FYHA 1ZUIA 1L7VC 2L0XA 2EJ7A 1LK0A 3IHKA 4OI4A 5I51A 4RD3A 2Z6VA 1JSCA 3OTFA 3OPNA 4ICGA 3ZCTA 4BO6A 1VFPA 2CK3D 2HIAA 4HXGA 1ZMXA 1MO4A 2PTHA 2FQ1A 1YF2A 1KQSF 2G09A 5CMLA 4KL8S 2QX9A 3ZU6A 4V1CB 3F2IA 2O1EA 4UU7A 3FCOA 5D6OA 2H00A 1R37A 2JB9A 2QW8A 4F84A 4YRDA 3QXCA 4GP6A 4DY6A 1OLSA 1TW2A 2P0YA 1OXMA 2QTGA 3PD1A 1KF0A 4JT2A 3FPLA 5FA8A 4C3VA 2FPMA 2CE7A 4IOJA 3PK0A 2Y9PB 4W5NA 2CUKA 3EK2A 5IYDO 3BRCA 4N7MA 3G2LA 2EERA 3VZSA 3ICEA 2GESA 2YNMD 1ZIPA 4GNRA 4MB0A 1Q15A 2JA1A 2JI4A 3KUUA 1WRBA 3KZOA 1OREA 2EKZA 4BZXA 2G70A 1QCYA 3LXMA 5F77A 4HLUA 4FW8A 3PUXA 3UJHA 1AZTA 2HH9A 2VHEA 4YCSA 1TAHA 5EWLB 4CEJB 2EARA 2BSKB 3PXXA 2ETVA 3MJTA 5IMBA 5KHOC 3JQFC 1JIKA 2QMEA 3GFGA 5CCBA 4L87A 1M8PA 1PWZA 2JIMA 4CIWA 2GILA 2GKOA 2JC3A 1U5AA 4DKXA 3WOVA 1KI7A 2A1UA 2H16A 3QU4A 1NNUA 1SUIA 2GCIA 5G0SA 2CVHA 1M6NA 1GPDG 3B53X 3W5DA 1I1QB 3KZVA 3DTVD 4HSEA 3O8BA 4CF3A 4YH1A 4HQ0A 5BYBA 1K3UB 1OY1A 2FXIA 3L1HA 3REFA 3TTYA 3LKVA 4F9FA 2Y6VA 3CSDA 2YI9A 1UJWB 1XLTA 1KETA 3S27A 4C07A 5B1AB 1DHRA 1YJQA 2RGNA 3Q6IA 4FMDF 3K2QA 1UDRA 3K7EA 2ALEA 3G71F 3NTOA 5K3DA 4EI2A 3ABUA 2CDRA 3EZYA 3ELWA 3R3WA 2GGSA 3VOTA 3GLHB 5L3QB 2ZBGA 3AU8A 2XITA 4OXIA 4URHA 4B2IA 2JDID 2QRVA 1KI1A 3ABOB 3T5CA 4YT2A 2Y4NA 2IJJA 2P41A 4GI7A 1TUBA 1YR9A 1AO0A 1KY4A 1ZUD1 1TZ2A 2DJ5A 3KE1A 3DBLA 3JQ8A 3CCMF 4O2AF 1EG2A 4P35A 2VCHA 1ZMOA 1SOWA 1VL5A 3M2PA 4AUEA 4EI9A 4LX8A 4HQ6A 2W6NA 2XGSA 2C31A 3SHQA 4M6WA 4NU6A 1G5HA 4W5OA 1TIPA 3KL4A 4PLCA 2RHOA 1GADO 1RPNA 1WCYA 3ZWBA 4DYLA 4P9OA 2O8NA 4HGQA 4HGRA 4ZYYA 4BVKA 1E1CB 1SJ9A 5K0CA 3HKDB 3I9V1 1PD0A 2QT0A 3S3WA 1FP4B 1RAEA 1LK5A 2AZDA 3JRWA 1YZLA 4BVJA 5HQ3B 4M1SA 5F5LA 4OK6A 3MYYA 3VPCA 2HWWA 2VH1A 3OAAG 3GF4A 4X1KB 5ALZA 5ESRA 3C16C 3H11B 1JKMA 1FXSA 4BVFA 4L4RA 3VNUA 1WXDA 2J5RA 1Q2XA 1IONA 2BPOA 2WILA 3MS7A 1IB0A 1RHQA 4HDNB 5GWXA 5I9IA 1UXKA 4Z3OA 3RSHA 2P6MA 2X2FA 4LN1A 1L7AA 3R8CA 1WPRA 5ALJA 5DBEX 4ZCPA 5F4BA 2P2DA 4HLDA 1VRWA 1YONA 4RM3A 4C0SA 1UMCA 5ECWA 4L76A 3CUEF 3QZUA 4R1NA 4DUYO 4NNOA 2GD0A 4L0MA 2GLXA 3K5NA 1GCIA 3C6BA 4FSXA 3HJWC 3E22B 4I0XB 2GS9A 5CB6A 3WIUA 4DBZA 5ITSA 1Y6GA 2FPKA 1X7ZB 2FPGB 3L8DA 4DR4O 1YUNA 3BE4A 4GPTA 2V6FA 1JR3A 1ZC3A 4TMXA 1TK9A 5BNFA 2GVIA 1VFNA 2CTRA 2JHCA 1HO3A 2Q5HA 2Z5FA 2QTVB 3D8RA 1U31A 2WF5A 1KBHA 1C9KA 3FFBA 5H9CA 3QBTA 4FFLA 3WKBA 2QRJA 1RAAA 3VC1A 2N48A 4KR2A 4X7BA 5BUQA 3PJFA 4BCCA 4KVAA 3RIYA 4Q1BA 2ALJA 1SHLA 2AK3A 2CK3G 4N5HX 2OCHA 4OYRA 2HG5C 1LX6A 1ZFNA 4J1SA 1HR0O 4N8DA 4FJ0A 4TV9B 2PLRA 4FZ0A 1T3HA 1WVIA 3P2OA 4OYHA 4IT5A 5G1PA 5CIYA 3OU7A 4GE0A 1JKJB 5GMOA 2ZSUA 2YY6A 3ZXIA 2WLTA 5FWDA 4Y0VA 2PX8A 1VQKV 3E2IA 3RRBA 2ZP1A 4GH5A 5AKLA 1H8HA 4MXDA 5EGSA 5JY6A 1X1TA 4GI5A 2JW5A 4OLHA 4H0LB 2OY0A 5AI0A 4KXYA 3ASUA 3DJYA 3N86A 5AI6A 4HWSA 3C7TA 4BUZA 4DIEA 1RM1B 1XLWA 2FDXA 4JZ2A 2WMYA 3QOFA 1YBMA 4P1ZA 4UBJA 3DNPA 4PELA 3L7CA 2L26A 2REXB 4DCUA 1CRZA 3KYDB 4XLTA 2X6RA 3DL0A 4E1VA 3KSBC 3M9XA 3V80A 4CTOA 3PLAC 2NO1A 4MKRA 4DBVO 2B9ZA 2HSDA 4N0DA 1B3BA 1SC3A 2W6IA 5IXYA 4JKOA 1O89A 1YCFA 1QP0A 4FMPA 1TA9A 2JLRA 1D4ZA 4P7BA 1QMGA 3SEQA 1NDQA 2ZI3A 4X66B 1UP6A 3TUIC 3A6PC 1ND6A 5JWPA 4F71A 2YBEA 3PE6A 3LNTA 3K70D 3RARA 3SGLA 1SQQH 2BLNA 1Y4ZA 3F5DA 4BOYA 3IQGX 4QGHA 2ZRMA 3NIBA 1YITF 2CNNA 3L92A 1AXRA 3TH5A 3VX4A 1TT5B 3BZBA 5AIAA 2ZAYA 1RWQA 1TK2A 2JAWA 1NSFA 4KAXA 4XWWA 1K88A 2IS4A 3B9RA 4K2AA 4FYWA 4ZAWA 1KAQA 3K8ZA 3OCWA 4R6ZA 1H2YA 2O59A 3AJAA 1EFLA 1Z3IX 1N5MA 3CH7A 3BXFA 3MWLA 3OT4A 2PMKA 5CK5A 4OHZA 2YWXA 3I4FA 3PB3A 3II6X 2I7VA 2B1JA 2QTBA 3QQPA 4W7IA 4LCJA 4UTRA 2X3FA 1K5DA 2PWAA 3G5LA 1SOUA 4EEKA 5HA5A 3K06A 2F9LA 1FDWA 1R6VA 3E9NA 1CPYA 1XX6A 4PCAA 5DULA 2WZBA 1IHOA 2C00A 2GV9A 2OCDA 4ADSG 4RO0A 4LOKA 1T1GA 2DUUA 2F66C 1F4MA 1EMDA 1XHLA 1FYDA 1XKQA 1HE2A 2E55A 2P27A 3SZOA 1VKNA 5JY1A 4JYPA 2FPIA 4PQEA 2G82A 1YH3A 1BE8A 3NHKA 1V3QE 3RT9A 1E3SA 1TO1E 2AS0A 2NXCA 1AS0A 4H7PA 3TSWA 1VGVA 5CT6A 4G1BA 2FRVA 1QHFA 4B6OA 4CR7A 1DX6A 1NXPA 5H3HA 1UANA 4Z9BA 1Z5ZA 1WMBA 3CUWA 4OV6B 4BNVA 4FOTA 3PRKE 4I4TA 2D2XA 2AQKA 1RI1A 4W1SA 1A27A 5DHTA 1ZOIA 3RKSA 3SFZA 2N04A 3AM1A 3DKPA 5E0OA 4LR3A 4D3DA 4L3VA 4UXIA 4UCRA 1N0NA 1R8SA 3WRVA 2QU7A 1OIXA 5A5EA 2H65A 4BNIA 2Q3CA 4D82A 3CWCA 3NATA 3NV7A 4TT3D 4HN9A 1PNLA 4BNTA 2X5NA 5HSGA 3CB4A 1OXUA 2IPAB 1XV2A 4AJHA 2Q99A 3IQXA 5B53A 2XUZA 3D5QA 4GOKA 3ANXA 4H16A 2CEKA 2ZDGA 2HBZA 3L7DA 2Q0QA 2G28A 3DT9A 1ZL2A 4M54A 4EK9A 3ZZTA 4CETA 3BQNB 4PZLA 1KZ9A 1GSAA 3B1XA 3C41J 4IGKA 3P9PA 2PANA 1JKJA 2Q07A 4RQBA 1R66A 4V3BA 4A27A 1ECLA 1CZHA 4WY5A 3HYRA 1XDDA 1BHQ1 1E6MA 1S76D 4FUQA 3C5CA 5ERYA 4OHRA 1QHXA 3ABLC 3S68A 3IYLW 1PP4A 3UM9A 4JI6B 4G4WA 1ECCA 1Q0LA 1JFFA 4K8ZA 1G5TA 1G41A 1NF9A 2OV3A 1OLSB 4MULA 2HHLA 2YVUA 5CM8B 3TRKA 2I5PO 2IEZA 2TECE 3OEHA 2EKPA 3PI7A 3ZGZA 2H2HA 5JSFA 3BIXA 3VU8A 4YCBA 2ICAA 1NV8A 1YDGA 1CUXA 1WETA 1RKUA 4HAZA 1EBFA 3HFSA 4G5RA 3F6SA 4V02A 1HTWA 3DULA 5BN4B 4W8HA 4HNUA 1TM5E 2MW2B 5IF9A 4TYYA 2YXEA 2R25B 1LNSA 4QXOA 4LXXA 4PC1A 3AUAA 3V7WA 3C6ZA 2A79B 2OTMA 3L7JA 5CBGA 3G9QA 4LZZA 3VR4H 1RKQA 5U4XA 4MTXA 4IVQA 4N7JA 4NESA 5EE5B 1DX4A 1GNLA 3RYCB 3F5QA 1AROP 5DWQA 2X23A 1RLTA 2BE9A 2XAAA 3A6LA 5IC6A 2HQSC 4N0EA 4DZTA 3OD5A 1BQ3A 4C8GA 2O9JA 1YB7A 4LRWA 4DARA 4F8YA 2JCGA 3AF5A 1MT0A 3OKAA 3P94A 3AYXB 3HU3A 3STTA 1C50A 5JS8A 2O8FA 1A7AA 5HR5A 5JRJA 3W5JA 2C2OA 1HK7A 4GR4A 4ND1A 5KYVA 3DFKA 3M6MD 5SY6A 2PVCA 3WQQA 2WWFA 1RSZA 3ZKAA 4ER5A 5K6RA 1KTIA 3I72A 3NIWA 2WVAA 2ZJ8A 4WCDA 1UT5A 4WEOA 3LBIA 4QJ3A 3EGVA 4J2HA 2C0PA 4HBZA 1SUWA 1BFKA 1NVWQ 2YINC 5JNSA 3DBLB 1H3EA 4ZOEA 3CT4A 1KMHB 3OQIA 3W2EA 1UFYA 1TU0A 1ZN7A 2VUUA 3DYBA 4MCHA 3OLCX 2FFQA 4R9UC 3HAXD 1HYGA 4HNAB 4CN8A 1IK4A 4YT4A 1G98A 2O0HA 3WL6A 1K8YB 4L0CA 3I0NA 4OXQA 4WLUA 2AKYA 5LN1A 2ILVA 4LOAA 1N8KA 5DK4A 4BMPB 2FW1A 5I8WA 2KBEA 5EJGA 3FDFA 1W1IA 3CEJA 4L9AA 5C1OA 4WZAA 4R1LA 4RXTA 1XMSA 2ZAOA 4UU1A 1P3Y1 5I7VA 3FYDA 3VQWA 2WNSA 2QW1A 3RTDA 5CDSA 2GZ1A 2H5EA 1YZTA 1J00A 3OIUA 4R2JA 5ICCA 3GCGA 3RG2A 1G2QA 2NU7A 3NJRA 2IZ1A 3OWOA 3UUEA 3N2GB 2OV8A 2XBUA 4FU0A 4PGAA 3T8YA 3LGSA 5KUMA 4OHKA 5B12A 5EN4A 3OEEG 4K2HA 2XHEA 4JI8B 1BXRB 3T2MA 4LJKA 5IX8A 3CG0A 2YDYA 2C4TA 4PLYA 4QLBA 2C0CA 3S40A 2IE0A 4MTLA 3UWPA 2P4KA 5JH7B 1U2GA 3Q4GA 5L40A 5F9HA 1DIBA 4BGUA 1IHDA 1LBQA 4XARA 4CM9A 2IW5A 2C9OA 2XRMA 4EY5A 5ITZA 1BE1A 2C2HA 2VAPA 2PD6A 1PGOA 2QWRB 2FWMX 4AG3A 2AMYA 3CCEF 1LBEA 5A1JA 2PH1A 3HCBA 1Z38A 2LKDA 3AONB 5AKHA 1ZJWA 1S5PA 4LK2A 2HA4A 4KXQA 5FI3A 5IYZF 3FB6C 1SB9A 3WQSB 3BSFA 1YFJA 3HEAA 1XEWX 3LXUX 1VLHA 3ND7A 3UCEA 1XGKA 2JGDB 3TW8B 3EGOA 3EW7A 3BKWA 4TXHA 3ZJYA 1MQSA 3PQ4A 1L0BA 2P79A 5EHZA 1SXJC 1ODCA 3UB3A 1QVVA 1QDLB 1ZGHA 1F5NA 4TV9A 2DT4A 1PS8A 2HSEA 2XB6A 4M0MA 3T15A 4CIAA 3C87A 1Z2PX 2IBMA 5I9LA 3L79A 1Z6QA 3AG5A 1AX9A 1B6TA 2CLIB 1UAGA 3SC2B 3RA6A 3RRYA 4ALKA 2P90A 4IJVA 3CR8A 5K09A 2QLTA 3PQ3A 2NYVA 2L19A 4PAMA 4RZIA 2V98A 1R7RA 1P8AA 1Z6AA 3GDOA 5BYJA 3X1YA 1QHNA 2XNCA 3JQGB 4PYKA 1WMSA 4PX3A 4XQGA 1G8PA 1GGHA 1Y4UA 1Y5IA 4RDHA 3RRNA 2G07A 1MFPA 4F9TA 4JYZA 5AI5A 3G67A 3CZPA 5B1EA 3CJHB 2WMOB 5ALGA 4FJ1A 4M21A 1YQQA 5A3VA 5HJ7A 1VQ6V 1BOOA 2W6ID 1NVAA 2PT6A 1X4TA 4GMXA 5IM4F 4IHJF 4EZIA 4C5BA 1SULA 5IWAB 1Y80A 4GVXA 1MJHA 1P6XA 2HS4A 2C82A 3E0QA 3B36A 4XRGA 5BXYA 3LMEA 1PUJA 4LWZA 4NMLA 2WJ6A 3ZWQA 4MTFA 1RQGA 3OEHD 4IIHA 1Z5PA 2PX6A 1G5RA 1HEIA 1NMXA 2EL9A 2OKCA 2ZM6O 1VZ2A 2V03A 4NTZA 1K68A 3BJEA 3JQAD 4MPDA 4QBGB 4URUR 5JVDF 2I1LA 2Y0PA 2XNSA 3BG5A 1O5OA 3G0GA 3AFHA 4E5SA 3L49A 2LD4A 4MEAA 3D3IA 4RV5A 1C41A 4RGQA 4JEMA 3VTAA 5C35A 4BW0B 2VDJA 5CA0A 4KG7A 1G6UA 2I4TA 1PV0A 2Y4TA 3ECSA 3EPRA 4RPLA 5AO9A 1ONNA 3CO0S 5AXDA 4EEXA 4HNAA 3DMHA 2RBKA 2ZJOA 3LWPC 3GJSA 2JJMA 1DAPA 3F5TA 3IJ4A 1PL8A 1THZA 3F7MA 2I87A 3HB0A 2QAJA 4DG9A 4ENSA 3T80A 2DFKB 2OEPA 1QO7A 3H5OA 4ZQGA 4Z7OB 3LZ6A 3VXKA 4EMSA 2C78A 4R3UC 3INTA 3A1SA 1AI4A 2BFAA 3GCWA 5KYXB 4EKEA 2OV2A 1A9ZA 3K9FC 2XCLA 3FOAA 3BS4A 1SBCA 4YRCA 1UIRA 4JENA 4ZAYA 4GC5A 4LVUA 1I9GA 4BRZA 2BD0A 4Q7LA 4V3CA 5I7AA 2IGTA 3EC7A 3HWSA 2WPDA 2JKVA 4MAFA 5HBRA 3WAKA 1CQIB 3NC0C 3UPUA 5I3ZA 4X5OA 3CPWF 4D3SA 4XUCA 3LI2A 4BV2A 1YZBA 1XTTA 2Y27A 4HEHA 3ABKC 1MDFA 1OFVA 1Y8QA 5LYJF 3IHWA 2R7NA 5DTJA 2E0IA 4CMKA 2AHZA 1T9HA 2PZMA 5E3HA 4DGQA 4TS3A 2FR0A 2GKSA 4PSUA 5TMBA 4H3KB 3ZCPA 3BJIC 1I14A 3S06A 1FMTA 4X9QA 1N4DA 2XAUA 2ZBDA 3AHGA 2CFOA 3MS2A 1GCUA 4LF5B 1UFKA 4P86A 3ZVMA 3ZIAD 1GL6A 4LFBB 3CX7A 3EBPA 2GEUA 2J3DA 1S7GA 2O2XA 2ONKA 3MTGA 2JFVA 4PZAA 4CM4A 3V4RA 1K8QA 4RWUA 5LXTA 3H5RA 4JYAO 1D6NA 4JODA 2D8AA 1W44A 1P1IA 2XCUA 4K9KA 2IGBA 2YEVB 3ESBA 3K1YA 3AJEA 2PUSA 3WGLA 2L42A 3HO6A 5EG5A 2PL9A 3S2UA 3GT7A 1K92A 4FXPA 4MIEA 4BLOA 5AVYA 5FQNA 3RYFA 2UZ0A 1XF1A 1MV5A 2PSHA 2J3IA 3IP9A 3BFKA 1G20B 2I4NA 1A71A 3LFUA 4X8MA 5L95A 3U31A 1T8UA 1J0AA 2QUJA 4JY7A 1V5IA 1L0LH 1PJSA 2C61A 1X14A 1Y98A 2SKEA 4ZU1X 1QD9A 1PZGA 3GMIA 3IULA 2FFAA 5JS6A 1QZUA 1Z36A 1CDEA 3JZFA 2BHLA 3CC7F 2VK8A 4H7KA 3QVWA 5D85A 3SNKA 2BDUA 3HO8A 3QLVA 4ITRC 4YUXA 4YAUA 4C7OA 2O2JA 5IT9N 3GGJA 1IATA 1KP9A 1ZH4A 1E4EB 2F62A 2UUPA 7ADHA 3LKBA 4PBRA 1DV1A 2Q6OA 4YP9A 2G4CA 3ZQ6A 1CG6A 4X1YB 1CEZA 3VZPA 1WXIA 2I6TA 5B6JA 3CNQS 3ORQA 1N33O 3UKOA 3M4YA 1RM3A 4FD2A 2ZWPA 4IIFA 3TQSA 4D80A 1M0TA 1NW5A 1MU0A 1KDZA 1EJ0A 4MUEA 4EA7A 1K08A 3ZY5A 2VF4X 3AJDA 1WDWB 2NZXA 4JOSA 4QOJA 3HM9A 2FE4A 3OQ6A 5JEEA 1P3DA 2AXQA 3H2ZA 4WCVA 5AVZA 3O2NA 2A7QA 4C88A 4EDFA 4AKHA 1LBSA 1FC0A 1K7FB 1MLDA 2AB0A 2PGXA 3EFOA 4LI0A 2OV6A 4P2BA 1M56C 5ETJA 2NVUB 4UNQA 4ZZ2A 3AUKA 1XVVA 1FRVA 3F71A 1NMUB 4QGPA 3H05A 1SZJG 2RGYA 1S77D 3R8XA 3T6KA 3UAGA 5IAAA 4PG8A 1N6OA 3A2MA 3X1XA 3B78A 2GPJA 3FW1A 4DRXA 2VP0A 2LE0A 1X25A 3EXEB 2LP4Y 4Q4LA 3GB7C 3QEMB 2FNAA 2QNRA 3W7UA 1JEEA 1H2WA 4A0QA 2J3LA 3E7DA 1TU4A 4B83A 2D0PB 1TJYA 1SK8A 1ATIA 1TL7C 2HEIA 1M2HA 5KQMA 4KUMA 1Q5OA 1JG7A 3F6MA 3DXZA 3K71B 4MGIR 2HR3A 4DRYA 1XD8A 3LY5A 4YFYA 1CB0A 5EI5A 1VI5A 2G9NA 4TQUS 1KC8H 2NV2B 2DVMA 3KB8A 3PPXA 3E3OA 2CK3A 3L41A 5JNWA 3GVPA 1EM1A 5GW7A 4MUBA 1RWMA 3CKYA 1FFWA 3Q8LA 1GNTA 4R9RA 1XMQB 4ZT4A 2QN1A 4TL9A 5A6SB 4J6FA 2HRQA 5AD1A 1IWPB 1Q21A 1T8WA 1VSUA 2WJGA 3NDIA 4QU0A 3N28A 4RZXA 1RRGA 2HQRA 4QREA 2RDMA 1NXWA 4FZJA 4TROA 3M9LA 5DWVA 3T3IA 2EIKB 2Q29A 3GP3A 4Y2VA 4CZ2A 5HP8A 4RPKA 3JWHA 3U4AA 1N5OX 2HA6A 2R7MA 2GBOA 4FGLA 2FMHA 1PNRA 4PNZA 5TXGA 1IN6A 1JI3A 2F3SA 2CY0A 1ISFA 2Q0XA 1BMFD 3F7OA 3OP1A 4ZDKA 1BXRA 4ZU6X 4JI4O 2FR1A 5T57A 5EIBC 4TTIA 1S8NA 1P7YA 1U11A 2OQIA 5A7GA 4NLLA 4EMUA 2WW8A 1DIOB 2ZRPA 1KI6B 2BRUC 3QMPA 1CP3A 1FU4A 1OMOA 2ROQA 1BJKA 3HA3A 3LTEA 5BSVA 5KS2A 3OUTA 1ZLYA 4IJ5A 2R5FA 4RHYA 2BP7A 5A5DA 5LMCA 1IAVA 5HCUA 1AKUA 4FOLA 3PC2A 2PGDA 4DC1A 3SP1A 1H5QA 3TUZC 4MCJA 3W7XA 4R69A 4ALJA 3IAYA 3GUHA 2JG3A 3O90A 1UINA 3KQPA 2Y68A 3ETCA 4ZQBA 3CW2A 5FLXM 3MJHA 1DMSA 4Y67A 3K0CA 4TKLA 4AD8A 1P7WA 5BN1A 2ZYVX 1FQJA 3EXG1 7REQB 2BTOA 2Z0AA 2G76A 2FLVA 5KQLA 4C4RA 4PPFA 4QELA 3HCEA 2B1QA 1VCIA 1W36D 4R8SA 5C51B 1IAQA 2F67A 4PLFA 3UCXA 4EQ6A 3DWGA 3GLRA 3UNXA 3KSUA 3GAFA 3BMNA 4U2DA 3GFPA 4YRGA 3EJ6A 1GG2A 1TM1E 3A7EA 3DZFA 3TIVA 3WZ2A 4XLZA 5BNWA 4HEJA 1M75A 4RABA 3KC2A 3BB1A 1NVMB 5FNVA 2D59A 1MORA 1ZMTA 4ONEA 2XA2A 2QA4F 1JEQB 1N5LA 1SU4A 3JALA 3KPJA 4EZBA 2DU8A 2RC5A 1JQLB 1BKSB 4QLAA 4BQPA 4WLEA 3OZRA 3AY0A 3BICA 1Y3IA 3EFOB 1GUAA 4GPEA 1MXFA 3NNDA 3RJZA 3KYIB 3ZXSA 2FLKA 4PZCA 5DM4A 3TSZA 4IL6Z 4R7TA 4OATA 4R51A 1YMUA 2AG1A 3JD2A 4DXDA 1PSWA 2FSVC 4AMYA 2EZTA 3FNFA 4XFJA 2QJFA 4Z1MG 2JZOA 2CBZA 2O0LA 3FA2A 3WE7A 3ZX6A 4MR9A 4M9ZA 2C9CA 4XYGA 3KR0A 3UMFA 4Z1MD 1QX3A 2P67A 1KXZA 1L7EA 1WF3A 1XAHA 2AZXA 4J7XA 2HSZA 3WFIA 4DMLA 3I58A 3FZQA 3VZQA 5DM0A 3L40A 2P40A 1OQAA 2Y71A 3NDRA 3E82A 1TVEA 1ONIA 1YZGA 4EGAA 5GIOC 2GN1A 2IV7A 1ZA2A 2ZBPA 1T4DA 4PWYA 4G4XA 1ZL8B 4KHPO 5EK0A 5A03A 1O4VA 2X1VA 2WPNA 1CZNA 4LF5O 1PV2A 2WP0A 4D6XA 5K5EA 4ZT2A 1KJNA 3W2IA 2AL7A 1QNFA 1I3KA 5EXDA 1FAFA 3NHPA 3V2GA 1K6IA 5BQPA 3ZI0A 4TVKA 1XNQO 1JEOA 2WTEA 4QC2A 4WK4B 1JSLA 1DEKA 1UKEA 1E92A 2OESA 2XYGA 4JH0A 4M46A 5EWLA 3C3JA 2JIRA 1EXWA 4JNCA 1GRRA 3D2LA 3ZNOA 4E4TA 4R8LA 1ZNQO 1ZM2A 2G9QA 2K7ZA 4PS0A 1GK9A 4LXIA 4UVCA 2AKEA 1OC4A 1XZMA 3IKLA 2JEXA 4BX2A 1I2BA 3WYDA 2Q3DA 1XA4A 1F4VA 3PWKA 2HK8A 2ZT8A 4YMHA 5AM1A 3HA5A 3W1EA 4MS3B 5EVJA 1WW8A 2OMKA 4NBRA 4NZYA 4K8XA 4MWSA 3A28A 1SBNE 2M6RA 4YO7A 1OHHG 3G7UA 3I9FA 5EHGA 3AHIA 4A1FA 1YKGA 1T5BA 4MVJP 1YCDA 2IXAA 4Q34A 2OP1A 4JSYA 4A26A 4DSNA 1YIAA 4D02A 2QJWA 3R0ZA 5DSZA 5THQA 3QMVA 1DCFA 1U8EA 3CCEV 1I0IA 1B0UA 3LA8A 4KDRA 4KO1S 2EQAA 4NY1A 3A8TA 4IUBS 5TF4A 1P2BA 5H81A 1TCVA 3PLRA 3IJEB 2X0EA 2GSWA 1MHTA 4G1CA 4AXXA 4YDQA 4JOCA 2WY2D 1ZM7A 4EFLA 4MQMA 3OIWA 1E3IA 3AERA 4BFVA 4UAJA 3TPCA 3ZEIA 1CU1A 1V11B 2VSXA 3NTUA 3UJDA 1Z6GA 4P3YA 4EVSA 1JDSA 2E49A 5IAEA 4KB5A 4DCNA 2WHYA 2J7PA 2QD5A 1ATZA 3DG9A 4BR6A 5A9RA 3BTVA 3JYLA 4PHHA 1EWQA 3HVUA 5ARCA 2IZ7A 5TGZA 1JQJC 1Z15A 3OEWA 4AY3A 5DSXA 3RU9A 1ZJYA 3B52X 1NX6A 2AJTA 2OZEA 3DOCA 4IMPA 1JQAA 3KCXA 4MX8A 3DUFA 4XFDA 5TVGA 1ZR4A 2VYVA 3B8NA 5F73A 2C5AA 1KI8A 2OUKA 4MGZR 4K35A 4UB6Z 1C1YA 2VA8A 3I42A 3P5BA 3QJ5A 4MWTA 3X1DA 3GK3A 2P4EA 1XC7A 5PGMA 1U8XX 3WLHA 2D5IA 1I10A 3NYQA 2FUNB 1HF3A 3LV8A 2FQXA 4RJLA 3ZV7A 3E05A 4YBRA 3EFHA 4BTEA 1O6GA 1ML4A 5TQ2A 4HDSB 1P2DA 3LDUA 3OZVA 4RORA 3OT7A 4OEHA 1J8QA 4FMTA 1JBKA 3ICWA 3P9SA 3OUUA 1QVGU 4IVPA 4MMYB 5JYEA 3KEGA 1XVUA 3GZNB 2WOJA 2YUTA 2KS6A 1Z28A 2RG7A 4UCWA 5K4AA 2HF2A 1ORDA 3NX4A 4S1VA 3H6HA 5LP6C 3T1CA 1HE1C 4XGIA 2L6LA 3TAXA 4MWEA 3FTNA 1HQYE 4QWWA 1R1MA 2FOXA 2I34A 3R20A 1PPJH 1HT0A 2D1SA 2GI4A 5EXXA 2PS0A 2IIPA 3A0BZ 1Q0SA 2P0EA 1EVQA 1H38A 2QN7A 4YWHA 1J97A 5JVDB 1L7RA 1FLVA 3LO5A 4GZ3A 4LVCA 4IIEA 2RBGA 3BGVA 1Z75A 1QUEA 4G1VA 4QDUA 3VHQA 2KGWA 3PUVA 4ZV7A 4XX0B 1F0NA 2FEMA 3A36A 1SM4A 3OEEA 4HEA1 5AVUA 5JZVA 1DIHA 4IIDA 1GAJA 4H1WA 1C7QA 3W5BA 2N74A 4LE0A 4I1SA 3ZBPA 1QFZA 3CZCA 4JUAA 2CZGA 1L4FA 2ZTSA 3KV1A 4IIYA 1ICIA 5K8VA 2XRZA 3I1FA 4OHOA 2YIBD 3QYFA 3OWXA 2QK4A 4B87A 4ZC1A 3ZGVA 1QXSA 1P1FA 4JGIA 1K34A 2G1AA 2W6OA 4J0JA 3HLTA 3D9QX 2YQ5A 3LGXA 2QL5A 3RSGA 5FDFA 4Q3NA 4LZPA 4QUJA 4RXMA 4HVCA 5AHKA 2YZ7A 1CUYA 4FS8A 1TIBA 2BISA 4LRYA 3DSRA 3TIXB 3ABRB 3AF3A 2A59A 2E75B 2R4QA 3QFTA 3SF8A 3ZY3A 4DKJA 5E4FA 4QYWA 3IR6A 3PNSA 2COKA 2OHGA 2X9GA 3BZUA 3EOAI 3P2KA 3P26A 4AO6A 5JMWA 3QEAZ 3SS9X 2D6FA 2D2CB 5CBKA 4K6GA 1EVZA 2ZITA 2ZSDA 4JAVC 5AVJA 4ZVMA 1A4UA 2FSSA 2KQXA 4YV0A 4M1OA 4KKVA 4Q6BA 4NP6A 3VV2A 2UZHA 2IYWA 2PZJA 2YQZA 4YCLA 1U0JA 1OBOA 4JYCA 4BT3A 1NMZA 1R18A 3VU0A 5A5GA 5LZ4A 1ZH8A 1AT1A 1COWG 2Q5FA 4BE4A 1WVMA 1YQ9A 2B4AA 3LNCA 1J7JA 2ZQZA 5HHTA 2R85A 4N5NA 2J8ZA 1BGWA 4ZT3A 4IIBA 1OAOA 3AFIA 3O92A 1Z13A 1ITZA 4PNEA 3RASA 1QP4A 1PVDA 4AKEA 3I9NA 4ZYLA 4GL2A 4NMMA 1MB0A 1SCQA 2W8BB 1X7YB 1E1RD 1RQPA 5FR1A 5AK4A 4CFYA 3WGUA 2CLOB 1LQUA 2VYQA 1AS3A 2ZWMA 1B04A 3ANNA 3TBHA 3AF2A 2CMFA 5JH7F 2HY7A 3BGDA 1SD5A 3K35A 1U4NA 1C3LA 4ZJZA 4EJSC 3M2TA 4YR9A 2G80A 3RRFA 1SHTX 2I3DA 1KC8W 2VI5A 4XIIA 3BULA 2AFHA 4B3JA 4ZALA 5KEIA 2XQJA 3PUWA 3G9ZA 3A6FA 1D2HA 4ZHVA 1UMBB 4DLWA 1P75A 3IAM6 3LPNA 5H4GA 1Y82A 5KVVA 4J94A 5BSWA 5F52A 2ZNIA 2YZGA 3FSEA 1AKYA 4FDLA 4GUAA 5EJIA 5DTEA 2FUG6 4HNRA 3SXUA 4CTKA 5FV7A 1S01A 1Q77A 3K72B 1TT7A 2R70A 3L04A 6Q21A 1IMOA 1RP1A 2Y0DA 3VAZA 4KO4S 4AULA 3E20B 4KBGA 5C32A 3C85A 2ZINA 4TUYF 3JD0A 5JG7A 4R50A 3VM6A 2WSYB 3OLQA 3VMMA 2I4RA 2OTJF 2H92A 2CH7A 2RJZA 3GVHA 3THOA 2EIHA 1W9MA 2VHUA 5LL6Y 3HA7A 4U2BA 1JNYA 3JALB 2WDPA 3RTBA 2HEPA 4PIVA 3WGMA 1ZJ5A 3KDPA 4IDBA 3WXMA 1YMVA 5F9MA 3M0EA 3NGMA 2DPYA 4N39A 4CDGA 4CIBA 2GDZA 1JLKA 2NYAA 4NNPA 4RDIA 2OLKA 2DTXA 3DOOA 5KSPA 5KUKA 2PH3A 2WINI 3ASNB 1NUTA 2XKBA 3GDWA 4HGZA 4P4TA 1KDYA 4EHHA 3RM3A 3PF8A 1FRZA 1YO6A 2A4MA 2OAP1 2PD3A 3SJCA 1MA3A 5ARDA 4EVQA 4FZ3A 4JOQA 3WLIA 1Z7GA 3B1KA 1O54A 1BEEA 1Z5OA 2N3ZA 1GA1A 4D4LA 2CFCA 4P08A 1L4MA 4HR7A 1ORIA 5DW0A 4JSRA 2FQYA 1JQ0A 2QAGB 4RQAA 3CVOA 5GZ1A 3VSDA 1RC1A 1QK5A 1ZICA 1KPGA 2C5FA 4A4DA 4DJFC 3N6RA 2JLBA 4J3FA 1A8SA 5A2GA 4UZFA 4L3WA 4WUVA 2CXSA 5IY5C 2W8ZA 4FILA 4INZA 3ZQUA 1JIVA 4ZEVA 2P11A 1VJDA 4CWAA 2A9JA 4J7CA 4BVSA 2H57A 2RCYA 2ATCA 1BHBA 3RGGA 1GSOA 1R3UA 2FY8A 3E6AA 3PKJA 1NQUA 4FLZA 1II9A 2VDOB 1Q81H 3TJTA 1OCCC 1CZOA 1PJTA 2R2GA 4FS3A 2LJ2A 2OCBA 1BXZA 4L6IA 4XUGB 3T95A 5G02A 5CEJA 3MWJA 4QBKA 3R9XA 3BIJA 5CDFA 1Y0BA 1P0CA 4Q9HA 2AC2A 4MW5A 1ZL0A 4E7OA 3FYTA 2QPLA 2YFKA 5IDXA 2NT4A 4E46A 2FPRA 1T36A 4DM7A 4OXSA 1OWLA 2R1UA 2EP7A 1T2VA 3I64A 5FPPA 4DMGA 5I8PA 3TINA 5FLEX 4IO1A 2Z1DA 4I4CA 2BFFA 4NHOA 4U3JB 4N82A 4DSAA 1RHMA 2ZVQX 4MJ3A 1JEYA 4BPRA 1U2PA 1ZOSA 1W36B 2LBXA 4JVSB 3X3HA 3KQUA 5EXTA 4EOGA 4U7NA 1EIZA 4HFNA 1W57A 3HZZA 4DCVA 2P1ZA 3TW4A 2ZJ2A 3H87A 2VNSA 3X2SA 4WPGA 1BZKA 3LRPA 1JJ7A 1N0JA 3H1IH 1S8FA 4HAYA 4MKZA 2C9ZA 4QJ5A 5K6AA 4HZUB 1Y3CE 2JRCA 1CVLA 1BWRA 2QTAA 4A2WA 4QJBA 1CD5A 2VSNA 3FWHA 1JR3E 4IZIA 2WG0A 3UICA 4CIVA 4F0JA 4PI2A 3G17A 1AIPA 1WWKA 2Z1MA 4JJ6A 4ZFNA 1UPUA 3EOBI 3ONDA 2CXPA 3SYOA 5DI3B 4M1KA 3MHTA 3QTBA 2D2IA 2CNWD 1LI7A 5L4NA 4F2DA 2G04A 5LMUB 1P7BA 3ZS8C 1K2WA 2EJUA 2LRHA 1EUDA 3NBQA 1ABEA 3IAHA 4UCUA 1HDGO 3EB9A 3SN6A 2CW4A 4O0MA 3ZU3A 3JASB 2YNMA 2A9QA 4YWJA 3DKRA 4OYLA 5IBQA 1ZSPA 4LF9O 5ALUA 2CHUA 1QQAA 3W3AH 4O2BA 4EY7A 4ZU3A 3EG9B 3K9LA 4GHWA 4NBNA 2G5CA 1PNKA 1BC5A 3NXKA 1NBME 1KKLA 1PO7A 3ON5A 5CFOA 2NTYC 4B7XA 4QE7A 1W5EA 1SPXA 2N42A 4G01B 4YRLA 3R9IA 4B4KA 3G0HA 2QWNB 3U7FB 4JDPA 4CUKA 1JQEA 1UZLA 1I6WA 3ADBA 1NJIH 5G4LA 4XTCS 4MS1A 3ILXA 2YWJA 1JHVA 2ZYAA 3U4DA 4BV3A 2M7WA 2XT6A 4UVBA 1OFTA 5AOBA 3SNHA 3HDHA 2NP6A 1HE3A 4NCJA 3ZW8A 2XAQA 4EUNA 4FT2A 3MTQA 4FHZA 5FBRB 3JQQA 4M55A 3C7DB 4HDSA 3P9RA 5JOQA 2J9RA 4ITVA 3TQHA 3Q85A 1VBMA 1XFDA 2JNWA 3OPYA 4HUQA 3ZGXA 5BURA 1U63A 3M6IA 4NYMR 1QAQA 2H07A 3K32A 1PJZA 1C4XA 2AEMA 2ODTX 4FJCC 2GB4A 3AF4A 2VT2A 4FGKA 1JFTA 1KAEA 2PBZA 4HP8A 1SS3A 1VSTA 5HFMA 3S2IA 3QFHA 1WD5A 1W581 1SA0B 2QWQB 3CZ5A 3I6ZA 3T38A 4EUSA 4F86A 1V8DA 4ZP1A 5CA0F 2X4IA 2MSDB 3IR7A 3O95A 5AI4A 1NQWA 3SX4A 2QZ4A 4AJLA 2EIMB 3GROA 1N1MA 1H47A 4J0FA 1IXSB 3ZNQA 2YN0A 4HOYA 4QNNA 3RTAA 1EHYA 4DIOA 4D9MA 1OV9A 2B5UA 1MJGA 2GBGA 2OD2A 2OM6A 5K51A 3PNPA 5HKOA 3AUXA 3VO8A 3ZK8A 4COKA 1G4UR 2YHIA 3P7MA 1M1YB 3AOEC 4K6OA 3M7MX 1PT6A 1W88A 3I9KA 2C29D 5J4HA 3TD9A 1L1QA 2HTEA 2JFUA 3E2PA 4UFNA 1DEXA 4M7OA 1E64A 5FLXN 3R23A 4LYYA 3WLMA 1E5LA 3ZGOA 1MF7A 1UAAA 3F2VA 1CXZA 5E6SB 1WOMA 3TCUA 2NMVA 3S3TA 4AKTA 3HYLA 2RGCA 4BT4A 3GJ6A 3CR7A 3HE3A 2W4QA 1FDOA 4LWPA 2KYRA 5D3MA 3SZRA 4ALMA 3CXUA 1LSJA 5FEUA 8AT1A 2DAPA 4IVNA 2DETA 1ZGZA 3I3OA 3OOWA 1KGSA 2NX2A 3L01A 4AO7A 4BASA 1J8YF 1JEYB 1NI3A 5THXA 2RJOA 3K5WA 2JHPA 3STVA 3VKUA 1IQ0A 3JVEA 2Y76A 3W7AA 4OPHA 1TD9A 3FMGA 5HTKA 1Y7PA 1VDZA 3DVAA 5IP5A 2WWXA 3ZU2A 2WJVA 1VMDA 2D7JA 6ADHA 2OSBA 4CFZA 5BYAA 5LP6B 1JFLA 2QTRA 4J0CA 3NETA 3LC1O 1ZD8A 4ND6A 4GMFA 4FE3A 4WXHA 1CRWG 5KYTA 1XZBA 2ADQB 1FFYA 1QOQB 1Z6YA 5H5JA 4EVIA 2C7OA 4L4XA 3NVIB 3P9ZA 2VN8A 3IUNA 4JI2O 4OHWA 5BMVF 3DZ8A 3FZGA 2CV0A 2RAVA 3GAZA 3U3JA 1JN1A 1ETUA 3ZW9A 4KWEA 1PW7A 1QH1B 2R00A 4NZZA 1JVMA 5E4TA 4C7KA 4DANA 2E7ZA 2BEVB 2CGNA 4JX9A 5BSTA 2RB5A 3FE2A 3TNJA 4XAQA 5KYYB 1DUSA 5T64A 1QB8A 2LIVA 4DDUA 1S5JA 2GHTA 3LC0A 4HKTA 1Z0DA 1HH4A 4D74A 4RKWA 2WWYA 1OJLA 4GKKO 3AGKA 1ZEJA 3DO5A 1FU8A 1S2DA 4DV2B 1RZVA 2Q3EA 2XMPA 2OXTA 3QFRA 1USVA 4BQSA 3EEYA 3BXPA 4QTYA 3PYXA 2J67A 2QR2A 3IBFA 3S44A 3I12A 1I3LA 1Y33E 4AZTA 3VKWA 5HBGA 3AG3B 3QHAA 1ZUHA 1IZ3A 4TYPA 4MIOA 1J33A 4CS3A 2AFHB 3S0JA 4TWJA 4JWTA 3AG4C 1Q20A 2P9CA 2E6UX 3K0CC 5ALMA 1QTQA 1XVLA 2ZQMA 1PR5A 1SUCA 1Z2AA 3PJGA 2AYZA 1GKLA 1R6UA 1P45A 2O3RA 3EIEA 3O7MA 1AI5A 4IKEA 5ALQA 5T5QA 2QTZA 5DM70 2C5EA 1R0RE 1J8DA 1XMOO 1N0WA 1R88A 2PMBA 5B3SB 3ABZA 4MQEA 4L28A 3E8FA 3CLVA 1SKYE 4BX9A 4MSWC 4CZZA 2XT0A 3IJRA 4L4UA 3IEVA 3OZXA 3WYBA 3T5PA 4EW3A 2B33A 2CFSA 4DQKA 3E5NA 3ESJA 4PBTA 1WDTA 6REQA 3W9YA 1O5TA 1U0FA 1YZNA 3OH8A 3MSXA 3D8NA 4AYXA 3FCEA 1GZ5A 1KBQA 4ML3A 3WXMB 2HLDD 1VBNA 2W93A 2HJHA 2WFLA 4Q21A 3OM3B 5IW8A 3V46A 4RULA 3TBFA 3IGAC 3FBAA 1QZ3A 1E1MA 2UYNA 1TM2A 2DWPA 1OHHA 4UBMA 4HMOA 5HK8A 2IX9A 4IS2A 4XASA 4RTKA 1ZLZA 1DKUA 5DPMA 5K9ZA 2C88A 5BMVA 2GCOA 3EGEA 4UU0A 4D9KA 4S12A 2ERXA 3QITA 4RTMA 1OAAA 4X6UA 3RSZA 3OG9A 1XTJA 3U0OA 1C0LA 4LJ6A 2QN9A 2OGTA 3DFMA 4QYTA 4RGVA 5F12A 5AVSA 3BXHA 1JQDA 4UVGA 2QHXA 5IUKC 2IW1A 5K0TA 4JT9A 4YMLA 2ZJYA 4BIZA 2OQ2A 4B3MB 2JGJA 2YASA 1VYHA 1VIYA 2GA8A 4PICA 1GVNB 3A9VA 4Z0HO 1A97A 4FFKA 3TVYA 3WK5A 5TB5A 4F5ZA 1T0PA 2HCRA 1UFOA 3IDZA 1TMYA 4PVDA 5CXXA 4BFUA 4ENQA 4ILEA 1HNWO 1JVBA 3I1IA 2Q5CA 3EF0A 1P1KA 1E5DA 3PQ6A 4HDCA 1RKBA 1I1OA 1KAHA 3CD6V 4KXRA 2NN4A 1B0PA 2O06A 3ZY6A 2OAEA 4UFPA 1W30A 4S05A 1GPWB 1DWUA 1E1RA 2WIKA 1H42A 2DKNA 4G4SP 2EX4A 4J0HA 3UAWA 4FHDA 2B94A 6ABPA 4B6SA 1EK6A 2IVZA 3F8TA 3PJRA 1QCDA 2IJGX 4U6NA 2XEXA 2FL4A 4RLSA 5DYTA 1VRCA 5FBZA 3EEBA 2FE1A 3EX7C 1ORTA 2YW2A 1QAMA 3FG9A 4I3HA 2PZGA 4ZBMA 2H29A 4Q3KA 5GTIZ 4EM6A 2V9YA 3C3AA 1TECE 2FPPB 2J32A 1H1DA 4PLGA 2BSXA 1NBMA 2I4IA 5G4KB 1O5IA 2D2FA 3NIDB 4I50F 2FR8C 3H3FA 3CRVA 4RCVA 3HGQA 1GYQA 1XSEA 4GBMA 2B2NA 4QUKA 4ZYUA 4EENA 1L5YA 1JA0A 3AGQA 1FYVA 5DN6G 1KMMA 2BIFA 5BQOA 2UXCB 1KY3A 2VOJA 5JDCC 4DN6A 3F6YA 3ZTTA 1NYQA 1E2KA 3HFJA 4II3A 4WTOA 1XPJA 1G60A 3HBFA 1GTVA 3FMVA 1CUWA 2IITA 1FMCA 1UBKS 5LLSA 1FOEB 1Z5UA 3H18A 3W5AA 2WA3A 1C5KA 4YI3A 4I9GA 1TF5A 1U96A 2NR5A 1VBFA 3GVXA 3DAGA 2X40A 3IRUA 4FFDA 3FMFA 4IHQA 3MVEA 5HJ2A 5EVCA 4LH7A 2PL5A 3UM7A 4KP4A 3RVSA 2R6DA 1HDXA 2X4LA 3QV1A 1X80B 1IDSA 3LYBA 4I3GA 2EIKC 2D54A 3CE2A 4Q3OA 2BBOA 2OK8A 1JDTA 1KERA 2BFBA 3QPBA 3OBIA 4IJ6A 4LWOA 2BGGA 3AVVA 3Q8KA 1YE8A 3JX9A 1SKMA 4LVNA 5BMOA 5BRAA 2BMFA 3TR0A 5C8YF 3GAAA 2PUVA 3ZWMA 1RADA 3C8DA 3MXOA 2ZJ3A 1ZD9A 4FI3C 4KW7A 4TGLA 1G42A 1D7OA 1RWPA 3JAMN 2GTAA 3B13B 5ECYA 2HJFC 1AUXA 2IK8A 3LYAA 1ISJA 4GZRB 3RAGA 5A4KA 3I6MA 4DQVA 5LD2B 3VHXB 2OK7A 3SBDA 1YACA 5F3WB 3B77A 2OGWA 5HP7A 3ZKWB 3KE9A 2NQ8A 1RQLA 2WQZA 3DEJA 3BF7A 3ZZNA 2ORED 4C8EA 1NURA 2WFLB 1Z88A 1U0GA 2AQIA 3AHEA 4RA6B 3W78A 3WSVA 4KR6A 2QG9A 1YZKA 1KIAA 1Y9ZA 2WUWE 4CCAA 1REQB 2R9VA 4BVAA 5KB3A 3DVSX 3DFZA 3M4SA 2C59A 3GFQA 2IHBA 2WG1A 5DX0A 2FP3A 3ONEA 3BCHA 4BT6A 1IRXA 3CE9A 5IF3A 1MX9A 3S2YA 1C7JA 1L5SA 2PIAA 2ZBRA 5AXAA 3MRVA 4MS4A 1UBGA 1P60A 1HL3A 3KZCA 5IH3A 1WV0A 3ADPA 3ZD6A 1SIWA 3WGKA 2PG3A 3PFNA 1BYIA 2QEXF 3A05A 3LCMA 4J6EA 1XNGA 4NBSA 4OL0A 1CJMA 3JQFA 3AVUA 2HJVA 5DLYA 5GJWC 3C9TA 3QE0A 4LPKA 3QM1A 3LM8A 4FX5A 1ADCA 3WL5A 5AVTA 2RE8A 1TYDE 4QVGA 2CJWA 1H0SA 4QZVA 3V9AA 4RUKA 3T7IA 1C3OA 1TLFA 2X3UA 2HJDA 5JTUA 1EK1A 1IYZA 2PSDA 4QPZA 3C90A 3T7DA 4A82A 5B3JC 1M93A 4OIMA 5LM3A 4C3UA 1D09A 3SM9A 3UB4A 4D7SA 4YAGA 1E8NA 1L4UA 3Q0EA 1B0ZA 5ESDA 3R40A 1X86B 1SVKA 3R2JA 3CRRA 2JI9A 5EZ5A 2ODEA 1OHHD 4MP8A 4MR8B 4K26A 1WABA 1NYLA 5HFJA 3RK0A 3HKEB 3CRNA 4UTXA 3T7TA 2VEDA 3I37X 1CQZA 2CHTA 5IJ0B 2XW6A 3TZKA 4Q4JA 5KIAA 4OLBA 2ZE8A 1F0YA 5FUVA 1UUFA 2O5EA 3QOXA 4HADA 5A3SA 2RKOA 2NZUG 3DMYA 3N6VA 1KO1A 4DC9A 5JFTA 1AKMA 1DQNA 1B8PA 5J23A 2RC6A 5DV9A 1Y8AA 3RSQA 3O8CA 3K30A 3NHSA 1JPVA 3ZWCA 2Q8QA 1QRSA 1H1TA 1XKXA 5DIZA 1TJNA 1F5SA 4PVCA 5CPFA 5E38A 5BR8O 3UK2A 1GN4A 3G0OA 4G0WA 1H6CA 5CW1A 4AAYA 4DLTA 4EHJA 2WSSD 4G5FA 1RMYA 5F7XA 5JSQA 1ULBA 3EF1A 3MFYA 1G17A 2QN8A 4RPCA 1JDVA 1PT7A 2CWJA 2MWMA 3EQ6A 4DDTA 1T6YA 2ZB2A 3HU5A 4QG3A 3OW2F 3DDNA 2GT1A 2NUPA 3LPLA 1M72A 1O94D 4PO9A 4WQMA 1Q74A 3L7NA 5IBRA 4ZV9A 5KOHA 1YCHA 4TLMB 1JLLB 4OJNA 5I47A 1NUUA 4NCXA 4REMA 4BAGA 4DIDA 1K0UA 4EY3A 2A9PA 5A06A 3OPQA 4Y98A 4E2XA 4E09A 4ZTBA 3FYUC 4IYHA 3V3KA 4MUHA 4C6RA 5ADHA 3CZ4A 1IXKA 4WEQA 3FPSA 2MSCB 3K0AB 2WTXA 5M3BA 4Y30A 3T3HA 1IBLO 1CY6A 1KE2A 4RIIA 1P2FA 1DCKA 2BM9A 1R8XA 2FRDA 1NJSA 3PNKA 1RCTE 1T1EA 4W8OA 5A0FA 3VHXA 1ZIDA 4CMGA 3TE6A 5I9NA 3TQTA 3SIPA 4JI4B 1FTNA 4F6RB 1VJ1A 2XMGA 4XOIA 5HQTA 3SQDA 1GTRA 4NAVA 3QKRA 4A9AA 1X2BA 2AGVA 1L1RA 3B60A 3IIIA 3K8OE 1TNDA 3CSSA 4Z1VA 1QVFF 4YO8A 1EBOA 4DILA 1EFRA 1Z2GA 4IILA 1N92A 2XNDA 2B25A 3ANLA 4FYIA 2QN6A 3NDBB 4DV7O 2CWWA 2PYJA 4C82A 2QAIA 3WSWA 4IJUA 1ECJA 4MAAA 1GUZA 3S0HA 4TSFD 2I4LA 3IP1A 3QVKA 4BJ1A 1YRAA 1M1ZA 4IXWA 1X59A 1HQCA 3JQEA 3K31A 4JVOA 4YALA 3WL4A 4ARIA 4A6EA 2C7GA 1KECA 3B2NA 3UK0A 5FT9A 2F9FA 4ARCA 2P8SA 1RAGA 2D1YA 2MR6A 1C3EA 4CI9A 3L7LA 4HZGA 4DIFA 6REQB 3PZRA 4HZ3A 2X9VA 3V1TC 3QLJA 3ZRWA 1WV1A 4WK6A 4FDVA 4KAJA 4QPPA 6PFKA 3TKYA 4B3GA 3FAVB 5AM2A 1M57B 1DG1G 1LVGA 1PQ4A 1Y3DE 3L18A 3MAGA 1TJ3A 2WSIA 2UYNB 2RK4A 1ESMA 3LC2O 3QV2A 5HFAA 5AG2A 5CURA 4AJIA 2ZM6B 2DZDA 4LDQA 2LCIA 3GYQA 3MK31 3O73A 5JCJA 5CCEA 2RGRA 3GRPA 2HWXA 3NIGB 4GZ6A 4QHSA 4A23A 4AKIA 2ID7A 1PGNA 3WGTA 4X7MA 1PL4A 2QM8A 4H44B 1BKYA 3KQOA 3KT6A 5D7NA 1PGQA 2IYOA 4ALLA 2CXTA 3ILYA 4ECEA 5H5NA 3VR4D 5BSGA 4LHVA 1USWA 2ZM5A 4U7OA 3D2CA 2XTZA 1XCOA 3DDWA 3EULA 2X6AA 4JCOA 5U4QA 3SC3A 2Q1WA 3WDMA 4YUYA 2R9RB 1U0RA 2X5JO 1Z5WA 2DULA 4YECA 1Y1KE 3DLCA 1GM5A 4CH4A 2PUJA 3GWOA 4PONA 4DQLA 1G1AA 4URVR 4J43A 3D7KA 4MRAA 2BHRA 2ETXA 5KTNA 5FWXA 4DDWA 1JJ2F 4XYEA 5JMPA 1RPZA 3U6BA 2C42A 5JNLA 1PP9H 3CW9A 4BB6A 3QTCA 3F73A 1W0KA 2HIGA 2QNIA 5K3FA 3C5WP 3QA3E 4I1OA 2ATIA 4HMQA 4DEYA 5P8WA 4UB8Z 4IOKA 2OQVA 2HWKA 4MW6A 4UCVA 5IKOA 1FJGB 3Q3EA 4AYTA 4MRPA 3HB1A 3GFVA 1Q57A 4DAEA 5TIIA 2NTEA 3CUSA 1LJ8A 4N6NA 5FBLB 2E4WA 1QH0A 4V0OA 3SBXA 4X6XA 2CDCA 3NFYA 1P17A 1QQ5A 4ER7A 5A9SB 1NKVA 1UQUA 1N4AA 1H5UA 2FLWA 2R6HA 3COPA 1SBTA 5AM3A 2J7PD 3BSSA 2O8CA 4L85A 5JSZA 1WB8A 2ZANA 3E5MA 1TVKA 5ALVA 2GFQA 3I9LA 3K0AA 3V7YA 1E2HA 3DZGA 5FUWA 5LPNA 1V1JA 1I7LA 3ZDEA 3P71T 1XPRA 1LSUA 4K05A 3W90A 4D7TA 1CT9A 2DN9A 3ZS9A 4Z3DA 2ZQYA 1IIBA 4DMRA 2DBYA 3LT4A 4J29A 5ALDA 4TX1A 3G23A 3AK2A 1S0VA 2NO0A 1Q8IA 3C8UA 3L6BA 1YJ8A 1Z0KA 3OSZA 4XLLA 3U3RA 4MTGA 1DRVA 1VL1A 4S35A 4RLHA 1H4SA 1M6YA 5IJ9B 1WOYA 2JHGA 3HS3A 4WNAA 1IQPA 1RM4A 2FMIA 1Y5LA 3UHJA 4HAUA 4QG7A 4R05A 1AJNA 5K0GA 1UI9A 1VLZA 2H0AA 3L4BC 1QSGA 4RIGA 3CTMA 2HJRA 4RVNA 4YJHB 1CS0B 1VE1A 1UMCB 1HYEA 4W63A 4UTNA 1NBIA 4RF4A 1ISGA 2WU8A 4ON9A 1EIWA 1DZ3A 1H4QA 1V55B 5LNK6 1P5FA 4LAFA 1NPYA 4BP9A 1FVFA 4IFIA 5EWMB 2IA5A 5BQFA 1C0IA 4V0KA 1QF9A 3U7JA 3CX4A 4JNKA 2ZWOA 3Q9SA 3NRJA 221PA 2H4HA 3TD5A 3THRA 4UNRA 4B5KA 3H5WA 4O3FA 1GDTA 2OXCA 2DR3A 4WCEV 1FW6A 3DMNA 3FRIA 3GCZA 1D4FA 4FDAA 1YULA 3DDHA 4YJ2F 3D4NA 3R5SA 4R1UA 4F12A 5A6SA 3A4MA 3CVVA 3EVGA 1EFPB 5AJYA 1TIKA 3FZNA 1MJGM 2QR4A 2HGZA 1B74A 1XKLA 1REQA 1GQFA 4BECA 1OZAA 2TRSB 3PIIA 5DBFA 3D0QA 4L16A 5LDHA 1U04A 2IYQA 4YV2A 4IMIB 1H2MA 3BORA 4NE9A 1U8YA 5D51S 4MO9A 1DP4A 2HXGA 2IZZA 2Q3FA 3KZKA 3Q15C 4JC5A 5FOSA