1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
molecule tags Cell cycle, structural protein
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
3JALA 1Z5VA 4EB6B 5GONA 5JCOA 5GONB 1W5BA 2Q1YA 4F6RA 4ZI7A 5LYJB 4U39A 5IJ0B 5ITZA 5J2TA 2VXYA 4ZOLA 3N2GB 4IHJB 5EIBC 1TVKB 5EZYA 4YJ3B 3RYCA 3M89A 4I4TA 1W59A 4O4JB 4I55A 4ZHQA 2R6R1 4O4LB 4DRXB 1JFFA 3JATA 4TV8A 5KMGB 3ZBPA 4EI8A 4O2AA 5LA6A 5JVDA 3JAKA 2GVIA 3VO9A 3R4VA 3WGMA 5IYZA 2XKBA 3JAWA 4O4HA 4WBNA 5BMVB 4WBNB 1W581 3HKEA 5LP6B 1TUBA 3JARA 3RYIA 2VAWA 4U3JB 4X1IA 3JALB 3VO8A 1RQ2A 5KX5A 3ZBQA 5FNVA 4EI7A 2RHLA 4F6RB 4ZI7B 2RHHA 5ITZB 4YJ2A 3HKBA 5J2TB 3HKBB 4ZOLB 3V3TA 3C8LA 5C8YA 5EZYB 5LOVA 4TV9A 3RYCB 1OFUA 3ZIDA 4I4TB 1Z5WA 4X1KA 4I55B 4FFBA 4ZHQB 1RQ7A 5CB4A 4X20A 5J2UA 4TV8B 1JFFB 3HKDA 3JATB 5JQGA 4O2AB 4B46A 5JVDB 5LA6B 3JAKB 2RHJA 3UT5A 5IYZB 4O4IA 3JAWB 4O4HB 3HKEB 5EIBD 3RB8A 1TUBB 3JARB 1SA0A 3RYIB 3E22A 4X1IB 1W5AA 5KX5B 1RLUA 5FNVB 4TUYA 4IIJA 4IIJB 5CA0A 4O2BA 1FFXA 3RYHA 5CA0B 2Q1XA 3WGJA 5CA1A 4YJ2B 4M8IA 2XKAA 5EYPA 5EYPB 3JASA 2BTQA 5C8YB 5LOVB 3RYFA 4TV9B 3RYFB 3WGKA 3VOBA 4LNUA 4X1YA 4X1KB 5JH7A 4FFBB 5CB4B 4X20B 5J2UB 3HKDB 3HKCA 5JQGB 5LXTA 5LXTB 4I50A 4I50B 3UT5B 4HNAA 5IJ9A 4HNAB 5IJ9B 1FSZA 4EB6A 4O4IB 4E6EA 2R751 3M8KA 5LYJA 5IJ0A 1SA0B 2VAMA 3E22B 5MN6A 3N2GA 3WGNA 3CB2A 4IHJA 4TUYB 3WGLA 1TVKA 3VOAA 4B45A 4O2BB 1FFXB 3RYHB 1W5EA 5MN4A 4YJ3A 1W5FA 5CA1B 4EI9A 2BTOA 4O4JA 4DXDA 4O4LA 4DRXA 3JASB 5KMGA 2BTQB 4XCQA 5MN5A 4LNUB 3VPAA 4KWEA 4X1YB 3N2KA 5JH7B 3N2KB 5LP6C 5M7EA 5BMVA 2VAPA 3HKCB 5LP6A 2RHOA 5JCOC 4U3JA
chains in the Genus database with same CATH superfamily
2BEKA 4TQAA 4MICA 4ADSG 1MA1A 1H0KA 3TFOA 4BBAA 1OILA 4XWTA 1PLLA 1M83A 5LA6A 4GM0A 4C5CA 2ZRMA 1V48A 1FMTA 4TS9A 4R1UA 4ZHSA 3LQQA 2FZCA 3SQNA 4JJIA 5K6AC 2JIZG 2HFEC 1QPGA 4ENQA 1V9PA 3PNVA 2VUSA 3V8RA 5BPFA 5IYZB 3GARA 3ERCA 4J7AA 3P4EA 2HLDD 5KX5B 1P5ZB 1XVVA 3RVQA 4MVZA 2EVWX 2J48A 4RXTA 1P2VA 4OBXA 4ER0A 5JZOA 3SZMA 3CU5A 5LNK1 3ON5A 3B5EA 1AKVA 2W90A 2CHSA 4FOSA 1YIAA 4WT7A 1KRHA 4YP9A 5AM2A 2QY9A 2HMAA 2Y1FA 1L4FA 1LPSA 4ALIA 5G1OA 4RGQA 4F0JA 1H8EG 2AK2A 4TN1A 1A9RA 3C48A 3CVOA 3X1KA 2W70A 4D4HA 1XMQB 3EVCA 1K0UA 3EXEB 1A9YA 5BWOA 4MITA 2VJMA 2R6R1 1BDBA 3KYCB 5G4UC 3VM6A 3PTAA 3T1HB 2LP7A 4D42A 2A1UA 4KITB 1GU7A 4UNPA 1E61A 1S3FA 4JB0A 2YXDA 4MQFA 1JZSA 4Z4IA 3CY6A 4YMLA 2H2IA 4PG7A 2IOQA 3T5DA 1EFVB 2HBYA 1K3FA 4YNBA 5B1BC 3CE6A 1JHRA 4O4IA 2ETXA 1Y7TA 2Q6VA 4AVYA 1CKEA 4AY5A 3ODPA 2HPZA 3KOYA 1CS4C 1KI6A 3GJXC 1TAGA 4YR7A 3ZHZA 3SFVA 2V6IA 2B83A 5IJ9B 2FLVA 3N3BC 3W5BA 4FINA 3ZK7A 4BFXA 2G9VA 1RWQA 3OWOA 1MH9A 5HWEA 3ONWA 4XGKA 4O59O 1I94O 2H1LA 3S0JA 5CYOA 3C90A 3CCSV 2DR2A 1IU9A 2AIZP 2WKWA 3HBJA 1IWBB 1YHYA 4KFSA 2Z58A 5FOXA 5B1NA 4MRPA 2HPVA 1LUWA 2QVLA 2Y3IA 3EAGA 5COAA 3W8DA 3F7VC 3KWMA 2ITCC 3CZRA 5JRJA 2UVDA 4YJ2A 2EJVA 5KPDA 3PX7A 4NC9A 1WZCA 1RYEA 4LCBA 5A3VA 1PS8A 1RWNA 1T2NA 5H80A 1MFZA 4W7IA 2VH5R 5FF9A 3II6X 3QEAZ 4MTLA 2XY4A 2OL4A 4JUDX 1SJ9A 2YINC 1GRRA 5LL6P 4EJSB 3DOHA 3RVZA 3CA8A 4Z0TA 4LFAB 1N5MA 1SUSA 2QEXF 1SESA 1JA0A 2XZTA 4OM8A 3D54D 2A0WA 4RFVA 5HOQA 3DE3X 3DHEA 4W1QA 1W9HA 4LMBA 2VJOA 2H0RA 4JJFA 2D13A 1LTKA 3B4SA 2QPAA 1ZPDA 1ISHA 4JXKA 1W40A 3KCXA 1ODCA 2J85A 3ENKA 2GSDA 4WZZA 4C78A 1FFAA 4MYDA 1QVZA 5IDXA 3MMNA 2C2HA 2EQ5A 1ADBA 4RJLA 1MRSA 3RYCA 4GIBA 1Q6UA 2PRKA 4LYFA 1U31A 3FG9A 1FXHA 1DRVA 4TGLA 4BNFA 2PUFA 1N7IA 1Y4UA 2AYYA 1TK9A 2FB9A 4Y2SA 3ZWOA 3TN7A 1SQXH 3M9XA 2FPPB 1V55C 2VATA 1DJMA 4X20A 3COVA 1Z0DA 1YBFA 4GZ6A 2ZVYA 5KBYA 3KTAA 5AJUA 3TD9A 2X6QA 5JJJB 4P8RA 4W4LA 1EFRG 3RVBA 2V59A 2PM8A 5SY9A 2BLLA 4DABA 3WI7A 3OTHA 5IJ9A 1GG5A 1A9XA 4IV5A 2QSUA 3OQOA 4EHNA 1IFXA 3G0CA 5LLSA 1FSSA 3MJDA 5FOVA 4U2BA 4Y2PA 4IM7A 5K0ZA 4LYHA 3SBOA 4UBLA 2RGAA 1NN3A 3W9BA 3HLKA 5DJ5A 1RP3B 4CEJB 3LYLA 2VYNA 3A6ZA 3X2SA 2G4VA 2B33A 3EZ9A 1WA8B 1PJ3A 2EWWA 4FVMA 2GA8A 5DHAA 1PJBA 1KYQA 2GKSA 1V0JA 3AR8A 3UHOA 3HKEA 4PDRA 5HK9A 4P3OA 3ABMC 2BF7A 2XHZA 4X93A 3IEMA 1B8NA 4CMBA 4I55B 3QKRA 1JF8A 4B8YA 3KJEA 1A2QA 2YOFA 3DC5A 4GLFA 3FCEA 4Q9DA 3VR6A 1A72A 4Q3AA 3Q2OA 4HEA1 3REGA 4PZPA 2SHKA 3T3GA 2D1YA 3RUHA 3JQAB 5MGBA 5K1ZA 4DJEC 4RTKA 4V39A 4FD3A 1PFVA 3QVGA 1TLTA 2FK7A 1VF6C 1P5FA 3IOEA 5H3HA 3ZE8A 3V8PA 1X7YA 3N59A 1NI3A 3BKXA 3BWMA 3N9IA 9ABPA 1FX0A 2PSJA 2NYUA 5THXA 5BR8O 2JGAA 3RGGA 5K3FB 1TVKB 3F73A 1Q3HA 3HADA 2PMFA 1N8RH 5F7OA 1ODSA 3KSZO 2Q6AA 1NZDA 1P7BA 4MQ5A 4XFKA 2BKUA 4GM1A 4RX1A 4NDNE 1ZUIA 4O2AF 1VYVA 1R3IC 2BGNA 3VBBA 4TTJA 4KGXA 3FWPA 4ZTBA 3AIKA 1ZJJA 1KR5A 4GNKA 5HXZA 2FG7C 5IFLA 2EIXA 1A4IA 3TAXA 1XKQA 4ZPXA 5CIYA 2J33A 5E8JA 3FPLA 1K97A 3D31A 1WB7A 2C7RA 2HD4A 2JZNA 4MVSA 3BGIA 3ZN0A 2I6GA 3RS9A 1XX6A 2CHEA 3OT4A 2RGXA 3OZSA 4R51A 1OR8A 2W0MA 5JZMA 1A7KA 1NMQA 5FUWA 5DHRA 2AQKA 3JTEA 1PKEA 3ADKA 1FSPA 4LBYA 4XD7D 1EE1A 3Q7TA 4Y2TA 3JZIA 2YIDA 3R6GA 2V6FA 1DC7A 2HF7A 3S2FA 2WICA 3CWCA 3P2JA 3C5EA 4C05A 3JPYA 4KLAA 4KUGA 2ZJ0A 3EXHA 4B6OA 1P18A 1UEIA 5DN6A 2IHNA 3M6FA 1EX1A 3OPYB 4E5VA 3V4LA 1MOPA 3WGZA 2FYUH 4PDVA 3MFYA 1TRKA 3AEIA 1D5NA 2Q5JA 2IYZA 4II2A 4UFNA 5KTNA 1UIRA 1IY8A 1P9WA 3CEPB 4Y2GA 5GY7A 4GQBA 2R4QA 1DXOA 3R3ZA 4TVOA 1PSZA 4GYWA 3LBNA 1HETA 4D7TA 4HDRB 3PI6A 4OBBA 1Q12A 1RRGA 3LM8A 1ZM3A 4EKDA 3PC8A 2Q0XA 1LRJA 2ENWA 5AK6A 1QE3A 1J7KA 3JR7A 4EFKA 4QXAA 4ASUD 2ZB3A 2XDYA 2F9MA 3CX3A 1T0HB 1M2VB 4KR3A 4KAFA 2OCPA 1M74A 3FVTA 3G8YA 3H4IA 4IIDA 2ZXWB 1K86A 5EINA 2AG1A 3UK2A 4KQJA 3H5AA 4HWOA 4ZAZA 2A86A 3ICEA 3LMKA 1R16A 2EKDA 2YXNA 3HKDA 1HQDA 1EIWA 1FAFA 2HCTA 3OCZA 1M34E 3T4EA 5HXUA 1G3UA 3B3AA 3WLKX 2EJBA 1YAJA 5DK6A 3AJ9A 4TV9B 3KQSA 4OXIA 1XEWX 4UOQA 1U99A 1VMIA 4GXRA 4UOEA 3LDHA 1QF9A 2EEZA 3VU8A 1XFAA 3K4QA 3M70A 1E1NA 4FLZA 2BGGA 3IQZA 4G67A 1K0FA 2I4IA 2YZ2A 4B74A 1K7YA 5EJFA 1N2CB 3CUEF 2H0QA 4CLHA 3L3BA 1PG0A 4I50F 3HPQA 1GN2A 1UJCA 3AHIA 1C8LA 3SN6A 3EG9A 5B1HA 2M1XA 5MF6A 4CMAA 3CH6A 2WYHA 3EAFA 1TTQB 1F0NA 1YI2F 1RM5A 1U7UA 3R20A 3KYBA 3MGBA 3CT4A 3OPYA 4Z3DA 3GW8A 1RQ7A 2PRIA 1J2EA 1PYDA 2W2XA 1WMAA 4C4RA 3U37A 3ZYZA 1WPXA 3EXIA 1LPMA 4CUJA 1NE7A 3GG2A 3H1TA 2OCDA 5CDTA 4Q4JA 2GD1O 4J4TA 4KDCA 4NTZA 1U0RA 4PZLA 1AN0A 1K7FB 4ZQEA 1YRBA 5F76A 1P5HA 1WW8A 3GZTB 3A1EA 1KYXA 4TL9A 3WIBA 3ZJ5A 1JSCA 3D36A 1M2VA 3I32A 3WPXA 4RLFA 1R6NA 2WIFA 5C3MA 1ZBDA 3B6NA 2EYQA 4P9PA 2RBEA 1VKOA 2Q62A 5L3SB 3LX6A 1E7KA 3MRTA 3C6KA 4TWAA 3RREA 5FADA 1GU0A 2V5AA 1UDBA 1IN8A 1TD1A 5L95A 3LLMA 2FN3A 3VR3A 3NXKA 1EA5A 5CP8A 5HKKD 1U1IA 2J8ZA 2P62A 4A2QA 3LLUA 1GM5A 1Q0UA 4W5QA 4MRNA 3GH1A 5JSZB 4B7CA 3I6QA 2JARA 3W5SA 4I8IA 4LFBB 3G0DA 1WKBA 3K5WA 4I36A 5CGZA 3L01A 2R0QC 3TQOA 2DX7A 1V5FA 3QOXA 2V3WA 4OD0A 3KETA 6YASA 5JAIA 1GGKA 2COKA 4NZPA 4UAGA 1RT9A 1NMYA 4DV3O 2GTSA 1QR9A 2KI5A 3THWB 3ISTA 5TQ2A 3VHLB 1H3EA 4QGSA 4H13B 3M4SA 3G8AA 2GTAA 2O19A 4EEQA 3EEQA 4GKKO 4C01A 1NBEA 1Z33A 5AI8A 1FLDA 3WHLA 4ZYYA 1L2TA 1ZN9A 2EW8A 3MWEA 3EWIA 2JJMA 1J5PA 5EVCA 2ATXA 3FMFA 4U6NA 2GXQA 4BP8A 2JFPA 1WBJB 2RK4A 4EA9A 3EUEA 1S8NA 4KU4A 2J46A 3AVOA 2IUEA 2RGDA 2PI5A 4OMCA 1CK4A 4D3DA 2WP8J 5FR2A 4B83A 3UO2A 2WUWE 2V0GA 3WBFA 3OUSA 2IDZA 4MTGA 4LJLA 5K09A 1CFZA 2G5PA 5DNYB 1L7VC 3I2JA 1MABA 4U7DA 5LU9A 3IH5A 5C37A 1E77A 4MCIA 1P3JA 1LVGA 1ZH8A 2YUTA 3G6WA 1IZ7A 1JVNA 5HY1A 2FPWA 2P41A 3ZDZB 3VDXA 4NXNB 4S1VA 3VI6A 4E5KA 2FPLA 1PSDA 1DPGA 3OTQA 4PSUA 2XYHA 2CLKB 3CYFA 4L75A 3VHQA 4CQLB 4MV8A 3KV3O 4RV4A 1XILA 3U3DA 1VLJA 5C4MA 4H0CA 3K9BA 3G49A 3PFWO 4ZVUA 4X63A 1N2CE 2PH7A 4F6CA 1NQVA 2FHPA 2YWHA 1UK7A 2ARKA 3MHTA 4HYTA 1H5NA 1Z17A 2W8BB 4UBIA 4EJFA 4RGBA 1E96A 4PBTA 3RRBA 3TSWA 3ETEA 2XDAA 3GCZA 3OQBA 5EAIA 5AW9A 3JWEA 3K08A 3EGXB 4NBKA 4E7OA 4JKOA 4C22A 4DGSA 2V3CC 3RYFB 1RD4A 1DTWA 2IPXA 4I4IA 2IXGA 3H4VA 5DWQA 3G7SA 1NZ6A 1NJ6A 4RIEA 1K2WA 3K70C 4E03A 3JTMA 1PDOA 1BL8A 1VMEA 1O4WA 2W6IA 1XN1A 5K0TA 4GMGA 4OBWA 4DV0B 3GOHA 4OCZA 1YUNA 2AMTA 2HEIA 4P4TA 3RSSA 2A1IA 5I4CA 2HX1A 4J0FA 4N0MA 3NVDA 4B6SA 4I2VA 4Q3BA 4XYLA 4PPGA 2IU3A 4P4UA 4CQMA 2CL5A 2ECQA 2Z95A 1HNXO 1UKYA 2GEBA 4XE5A 2ONCA 1C3VA 2J9FB 5C4GB 4B3HA 5BN4A 3RAFC 3PWKA 4WFHA 4YRCA 4EZEA 2AC4A 2O4CA 4FMCB 1M7GA 3TXYA 1EUCA 5I9SA 3G59A 4ND2A 3ACCA 1WDLA 5DBFA 3LC1O 4GAEA 4Q4CA 2L6LA 1YOBA 3GP3A 1EJBA 2V54A 1L4UA 4NHOA 1BW9B 4OX9B 4AG6A 3J7TA 1P7CA 1PP4A 4LWZA 4HFJA 3ZGYA 3BX1A 3KSBC 1DINA 2H7XA 4KIWA 4N6GA 5EZSA 5GOZA 3ESXA 4QEZA 4Z9XA 4CMCA 3M82A 1CSEE 1ZRMA 1E1QG 1P5JA 1KZHA 1XTIA 2J32A 3HG7A 2QNBA 3W5DA 3GJSA 1II9A 4RCYA 4CQLA 2O7NA 1U8AA 2NVOA 4RWZA 5GZ6A 1ECBA 5MFPA 5SY6A 5B36A 1FMLA 4MUIA 4HUQB 4YCBA 1NYQA 4MGEA 3I45A 1HEYA 3MJEA 1SQQH 1XF9A 2GPWA 1RQRA 4A0GA 3L4KA 1O6GA 3FB8C 2WI8A 3SHOA 4WLEA 4EUNA 2NO4A 3W7TA 1FYEA 3FOBA 3R09A 1CUIA 4BFWA 1BKSB 4ZU1X 3EQ2A 4V1CA 4QL3A 3RYFA 1JEAA 1IVSA 3WK6A 3D4IA 3HJNA 1I2MA 2FEMA 4A5SA 2P6JA 2HUPA 4B4UA 1J9ZA 4D44A 1D2DA 1R3LC 3KPVA 1UBTS 2FEOA 5IY5B 2VK1A 3T7DA 2JS3A 1CR1A 4XR9A 1OFHA 3PVSA 3CZ4A 1S8OA 2KTVA 5DI3A 4JOCA 4MDFA 1XEXA 2BYTA 4L8WB 5FLYA 1EB8A 3N2YA 3MTDA 4HH4A 2V7PA 2SECE 1L8OA 3O8CA 1V54B 5CYPA 4ZKIA 2HA7A 3TPFA 3M5PA 1G6KA 1RFGE 1QQBA 1U0LA 1GSHA 3SF0A 2J9FA 2J9XB 1G6UA 1KC3A 2YC0A 1H2HA 2OPHA 4BBPA 2AOUB 3P30A 1GGFA 1ZMBA 3DMDA 3ASOB 2X4LA 5A62A 2B4RO 5E2IA 3G9TA 4YT2A 1R1MA 1XTTA 3BKWA 4R8VA 1V7QA 1Y4SA 4AU1A 4ZC1A 3O4RA 5AOCA 3EVDA 1LJ8A 2AR9A 3IEWA 1Q82H 1E5TA 3WGUA 2QMOA 3SNKA 3GHZA 1TCCA 3KAPA 2OP0A 2WAAA 1OI4A 3I01A 3P0ZA 2CXQA 2E1RA 4IHJF 4C7JA 2NIPA 4UTPA 3ZCUA 1OJLA 4CC6A 2OGWA 2XGJA 1G42A 2OTMA 1MO3A 8ATCA 5B3KA 2QQGA 1GUBA 4C6SA 2QGFA 1YBMA 1Y63A 1KI4A 1P4GA 1VG8A 1U5AA 3F47A 5J2TF 3QVUA 1P9NA 4UDOA 3TSAA 3PFBA 3NHJA 1U1DA 4D56A 4DBVO 2O2CA 2IEYA 2DJVA 3SIXA 3GPLA 1D4AA 1N2HA 3NM5A 2DULA 1WVGA 1T91A 2XB4A 3SVZA 1VHLA 3OE4A 4JDPA 5CTAA 2IYQA 5H16A 5LQDA 3VKUA 3UMYA 3JQ8B 4JBWA 4O1MA 4I3HA 4EFEA 2LP4Y 4B3MB 4N9QA 1ZGGA 2BEVB 1GP2A 5LBUA 3W8RA 2R00A 4AS2A 4IEIA 3PKJA 3RS7A 4IRXA 3P97A 1Z56C 4DNQA 1N2XA 1WCV1 1L6RA 1HBJA 4IWYA 4NECA 1EVLA 5BXZA 4FKBA 1GFZA 4QYTA 4DLSA 4JJZA 4X6YA 2JCSA 5T6BA 3CCQV 3RSQA 1YITF 3FGNA 2IC5A 1J8YF 1SK8A 5E8RA 4HWTA 3R7LA 2XUJA 3D81A 1RRFA 2MWMA 1UC5B 1M2GA 1F17A 4F9EA 4HLUA 2MTBA 1DQZA 3FZGA 3ANLA 4UD6A 1FLVA 3R74A 2V3VA 3N8KA 4JN6B 2QN3A 1HNWO 2DUUA 2BY4A 4YDRA 3CG0A 2D0OB 2R7KA 3RRMA 1D4ZA 2JGIA 1C4OA 3C9UA 1E1MA 2K2QB 3AR9A 1Q7GA 4QDOA 4XQEA 4E15A 2EG9A 2VYND 4YP1A 3KSAC 4ONEA 3M6VA 3UKDA 1GZSA 2G09A 3EPKA 1GNTA 4MINA 5T67A 1UPXA 3HCFA 3KL4A 4Y2VA 1U11A 3D0KA 5IE9A 1E9SA 3H9CA 2HH9A 1SF9A 4JV5B 2Q9LA 5ALUA 4YAKA 1KYTA 121PA 3H9BA 4G1UC 4WK6A 2C95A 2QAGB 1HURA 1VXRA 1UPGA 5AJTA 1Q11A 1OKKA 5GOTA 4XH9B 1PYOA 2JLRA 2YI8A 1W2WB 2A1TS 1DNPA 1K27A 5BV2P 5GINC 3FZNA 4JGIA 4I9UA 4FYYA 3SQDA 3CF0A 3JSXA 4OJYA 5KO2A 2YHIA 4G8CA 1HXHA 4EYSA 4BNKA 3AFIA 2X4DA 4R1NA 1XTBA 1W5TA 1QLHA 3DB1A 1GLGA 1VLZA 1W25A 4EFDA 1P5RA 1AK9A 3PR2B 2NO6A 4WXYB 2H54A 4Y18A 4YRGA 2HDHA 3JRXA 1L4LA 4IEEA 2EBHX 2X0LA 4U02A 1W52X 1GJRA 4FHGA 1O6CA 3GMDA 3W2GA 3TUIC 4ZCIA 5CA1B 1UBCA 4OAPA 2V0CA 1OTHA 2CFCA 3QQPA 4HDSA 3Q8XB 4WASA 4LMPA 1CUZA 4JFRA 4E22A 4FEGA 3LY5A 1WL8A 2JCBA 1CE8A 5LP6F 2R48A 2CHUA 4YGXB 3RBZA 3JALB 3FMIA 1RZVA 3KYDA 1JH9A 3FHOA 4LNHA 2XQVA 2B4QA 5JS2A 4TV8F 3AMVA 4P3YA 1XU7A 1A77A 2NOAA 1PBNA 5KNBH 3LY8A 4YCJA 3PQ5A 4B44A 2RK6A 2B5VA 3BTUA 1M7HA 2IUYA 3F5MA 3R0QA 4J2OA 5CW1A 4L6CA 1XRPA 1VI5A 3PJGA 2H0AA 1DAKA 3K3PA 1QXSA 4Z9YA 2F66C 3F5TA 1OXVA 2WYIA 3TD6A 4HRAA 4WZAB 1E6EA 1LRKA 1HDGO 1STOA 4O4LA 1YQGA 1MOZA 2X6TA 4EKEA 3TNJA 2O0MA 2X2EA 2QUJA 2KQUA 1ZVKA 2F43B 2AMFA 2OGUA 1SQBH 1LGYA 1S9HA 2DSTA 4N8SA 2IJJA 1TUEB 3DQPA 1HSZA 4OKNA 1L5HB 3WS7A 4B73A 4GFDA 1M0EA 2EJRA 2V96A 1CJUC 1G20B 1T4DA 4PD4F 3QJGA 5FI1B 4BIZA 2FW0A 4TRJA 3FHCB 3THYA 1XZQA 3ET5A 1K33A 1NUPA 4OTZA 3EXG2 3H2YA 3QVOA 4YPVA 5KTMA 3CCRF 5AJVB 4P4SA 5KTPA 4E94A 5B5SA 4IDGA 4J7XA 1RJDA 1DZ3A 3KR0A 5E7JA 1EBBA 4X1YA 1G7SA 3CSDA 4G2KA 5HBRA 2YFYA 1JLMA 3LC7O 2I62A 4ES6A 4M3NA 3PDCA 3RV3A 4CODB 1P19A 4ZT7A 4R41A 3LNNA 3GVHA 3DL2A 5C80A 1T3SA 2I7XA 4QJ5A 1U9CA 3UGKA 2G71A 1Q3TA 2QZJA 4J94A 5E0KB 3EUWA 3UH1A 4BLUA 1TPZA 4AI6A 4QQ8A 3H4MA 1SVKA 5G02A 4AW9A 4D4MA 2Q8VA 2PMCA 1OC4A 5HDQA 3GUHA 3QKUA 5HIKA 5THQA 2JBAA 2WM2A 1BMDA 1U80A 2RAFA 3M5CA 3AG6A 4JYAB 4QDKA 2OMEA 4Z6KA 2OWEA 3K20A 4IWXA 4P9NA 4F4JA 3CJRA 1RYZA 3VX3A 2X0KA 2GO1A 3CCQF 4IUDS 1V5IA 2QUAA 4XIIA 3C97A 1XQVA 1XWWA 1NLZA 4DRYA 3E8MA 1UZAA 4BGVA 2ZRKA 4UM7A 1KDRA 1QKJA 4BTVA 1S5LZ 5J23A 1HZZC 1MCZA 2CF6A 4FM2A 4MV9A 4P08A 1NC1A 1PFGA 5JC1A 2N9UA 2RJNA 1MX9A 4LOAA 3G79A 4ARAA 4FMBB 2XV1A 3H1IH 1G20A 3A6PC 4RV5A 4NQRA 5ESXA 4Q00A 4B6EA 2OOSA 4RZSA 3ANXA 1SQSA 1DWPA 4UMDA 1SQGA 5THKA 4ND5A 4A5UB 4AYTA 3OIYA 1A5ZA 2VA9A 3WHIA 4UCTA 3OMIB 4FWIB 3DC6A 2BUBA 4NCHA 3RU7A 4JI4O 2HEPA 1FXKB 2Z6AA 2D2IA 3KKNA 5FFMA 1T36B 2Q9BA 3V4FA 4GPZA 1JR6A 1H4TA 1WU8A 2LW1A 2P6MA 2Z4RA 4Q21A 2ODTX 2EFYA 3I2FA 2PIDA 3IVGA 3VVLA 4PIMA 1ZTEA 1ADGA 4RAOA 1OF1A 2ODAA 4FZRA 1V16A 3V7WA 4MW5A 4EFLA 2GZSA 3LQ4A 3FM9A 3MMXA 4YAWA 2GSWA 3RYTC 3ZP7A 5FL7A 3HCEA 1WDKA 1MC5A 3FA2A 2C54A 1DEAA 3VR3D 3ZDQA 1PD1A 1L0NH 1KVRA 3JCMM 4D98A 1IBKB 3A0RA 3C6YA 2NM0A 2Z1NA 4LJ4A 3K70D 4DR3B 1BVYF 2NSLA 2NO7A 4WZAE 1U2PA 4JEMA 1HNZO 1H85A 4QLAA 2QWOB 2I1WA 2DYYA 3DTNA 3ER9A 1MSWD 4MKGA 3AHEA 1DGSA 2XGMA 4LISA 3VQTA 4MYTA 3MRVA 2R68A 5B3SC 2GEKA 1GPH1 4I5DA 2H48A 2FSPA 1KEVA 2IPAB 3Q3HA 5I9MA 2DF8A 3FSEA 3ETCA 1A98A 1Z4PX 4GPEA 1U3GA 1XTKA 5EWJB 2I6FA 4I9HA 3HWUA 1RBMA 3VOTA 3AHJA 5B6IA 1C7RA 3OZCA 3UWMA 4OL0A 3UWSA 4A8JB 4YMGA 3PLRA 2PWYA 3NYWA 5KTSA 4TLCA 3IKJA 3ECCA 3Q2IA 2YJ3A 1R4NA 4LNAA 1NVEA 2IIPA 3R1IA 1PT6A 5JAHA 4PSDA 3TJTA 4RHYA 2EZ8A 4L8LA 2ZJBA 1D6JA 5EJ6A 5D1HA 3RN4A 3RAJA 1VTKA 3DEZA 1QHXA 2Q49A 4JY7A 5DM2A 1Y48E 2IS6A 3S2YA 3A28A 1XR3A 5IZ4A 1KYZA 4BO0A 1H1LB 2PMEA 3WFJA 2WHYA 2GF2A 5K99A 4QFCA 1JQ0A 2QJOA 3ZCTA 3ZHQA 3Q7QA 3HN2A 4BAYA 3O73A 1RTTA 3AR3A 4MYRA 3JSLA 2P0EA 4B7KA 3ND5A 3M8AA 2H3OA 2WQ6A 2NUPB 4UHEA 3BFRA 2I3GA 3K15A 1C50A 4Y1EA 2JGDB 1ZHHA 2N42A 1ACMA 4CFSA 3ELYA 5IULC 5TX7A 2GWRA 2NAPA 3LQYA 3NYQA 2ZDQA 4Y0VA 4M1YA 3N2GA 2JHAA 5ICSA 1XMPA 1EU1A 2YWDA 5JH7F 3QYAA 2WAMA 4FUTA 2B1QA 1LLCA 2RGCA 3SJUA 1OCCB 2XXBA 1G4UR 3NV9A 1OYOA 3L0YA 1KNQA 2CF5A 1VIBA 3C9TA 2YXZA 1UMCB 2I78A 5AKKA 1GDHA 2FUG6 4EUKA 3VR2A 5IT0A 3EJ6A 2OENG 1F4LA 1MIOB 2PBLA 1LXCA 4GU5A 4LF4O 5CB4A 2MSKA 3A25A 1A8QA 2OCCC 3HY4A 4LAFA 1M1YE 5A03A 3OLYA 2PG3A 2B0CA 2PGJA 5EC2C 5TEVA 1HL3A 4CM5A 4AQYO 4WOPA 1FS5A 4WESA 3EVNA 3JAMM 2H08A 1F3OA 2XNDG 2H8PC 2OTJF 1TMOA 1O96A 1IMOA 1UFOA 4CIXA 2D1RA 5C34B 3F6BX 3IA7A 5LYJA 1F2TB 3RVYA 4GZMA 3HUFA 3T1NA 3WJQA 4HADA 3AF2A 3WLEA 4B4DA 2HJ9A 4CQMD 3GFOA 3BHPA 1T2CA 3HXTA 5CB8A 2JFBA 3M83A 4EHKA 2JAXA 5JCOC 1H4VB 2F3QA 3K04A 4E31A 3LZDA 1IG0A 1GZ0A 2Z8XA 3RQSA 5IN5A 4G4YA 1K5DA 2JKZA 2GHRA 1HYEA 3FCSB 1IY2A 2X5KO 3LI2A 1CJVC 2ZKLA 4D0LB 4LBWA 1U2QA 8MHTA 4ETNA 1HG0A 5CDSA 1LZKA 4MW7A 2W6CX 1BJRE 5BXQC 5A05A 1KJQA 5JE8A 5YASA 3V1NA 4QBTA 2YXBA 4Q19A 3SMVA 3DMPA 3V4DA 4KHZA 3OTWA 4IJ5A 3NP9A 5FPHA 1LS1A 1PV0A 4X64O 1VKJA 3P19A 1JG7A 3K0SA 3L7DA 1NNI1 3J80N 4PLVA 5E1OA 1UF9A 3CCVF 5EXPA 2WA2A 5BWNA 5I48A 1BU8A 3B6JA 3D6TB 4NZYA 2UXCO 1NGSA 1EDEA 4B34A 4UU0A 2CNLA 2BOBC 1MDBA 3TZLA 5FAXA 1O5IA 3HJUA 1CXZB 1JHOA 5KC8A 4YV2A 1DI0A 3RS8A 2YZGA 3IAS6 4URWR 2JVDA 1YTUA 2W93A 4NU6A 3DEYX 3QXSA 2CFTA 4RF5A 5A6SA 4JTCB 2I33A 1GN3A 4KDFA 1PV2A 3AJEA 4GEKA 4KQCA 3PV0A 4XPZA 5L7YA 1QZTA 1ILEA 2QTGA 3TDKA 3VU1A 2A33A 4BJHB 1Q77A 3TRFA 1ZX3A 1JAXA 3PRKE 4FHZA 2H06A 2HVJC 3W7SA 3NFRA 2CW5A 2K7FA 4R4JA 4XYMA 1SZJG 3JAWB 1YS2X 4MVYA 1N8RW 5FFNA 5F51A 3C74A 1UXOA 1VJGA 3AR4A 3EGCA 2W83A 1PFKA 3BB3A 1P44A 2ZULA 5DXAA 3HKCA 4D0SA 3PNYA 1CJBA 4QBIA 1P0MA 2PYZA 2GDSA 4R3WA 3WGLA 4X6UA 2YI9A 2WD8A 1LK0A 3FW1A 3LWZA 3MJHA 2W48A 3LWPC 4DCCA 2IXAA 3AFGA 3LDUA 3QSYA 1IOWA 4E07A 4KPFC 5KYXB 1E2JA 4GMFA 1NY6A 5DLQC 4AZ3A 2PNJA 5J4HA 2HBQA 3U0OA 1V9LA 4KO1S 1F4NA 4ARBA 5ECGC 2FPIA 2QL9A 3J81k 2V6JA 3PLNA 4CCYB 3LUDA 2CSXA 4LCJA 4JI6O 3MTAA 1W0KG 4B3BA 4QZVA 2EIMC 5CVUA 1JEYB 2O2HA 5GZ1A 2Q4TA 2HP0B 3P9YA 4L4ZA 4YN3A 3A9CA 1OAAA 3VPGA 3DVLA 4FM1A 3H5OA 3L6RA 1EWKA 2V98A 1OLSB 4KB5A 1IDOA 4DEYA 4XIFA 4IKEA 1K8YB 4CLOB 1CU1A 2A5LA 3U7JA 1C1HA 1KZ6A 1Z8HA 2MSCB 3AKZA 5F98A 3OMAB 2RONA 3IAEA 3N0RA 4HNVA 4YGYA 2BGKA 4OQ4A 1NUAA 5E38A 2PS9A 1COWG 3H5WA 3B2NA 2YJNA 3SC6A 3LQKA 3CUKA 3IPCA 1URFA 4W82A 2WF8A 4E11A 1J2RA 3SQOA 4EAAA 1B1AA 1U7WA 4ZYWA 3AUTA 1TB4A 5IAOA 2OA0A 5LQJA 2EHJA 5LC1A 2UYGA 1YZBA 3PEWA 2OCXA 1CUSA 3M6MD 1FYDA 1N25A 4DVJA 4F06A 1Z6PA 4ZQIA 5EGSA 5BV0A 1LRLA 5IVHA 2IM9A 2OD7A 3NCHA 1XPOA 5IT4A 4K35A 1JAYA 4I1PA 2B4YA 4MUKA 3OCVA 1XAIA 4WLOA 1OVGA 1NAHA 2CFIA 1AQJA 4N65A 3AL2A 3OA2A 2H4JA 2ZBGA 1ZK4A 4RPJA 2ZBUA 1GN9A 3D2BA 5KWVA 1ID8A 1DT9A 5BSTA 3O2QB 4V24A 3H16A 4HSEA 1H3FA 4EKYA 1DLIA 2OAQ1 4AB1A 1H0SA 4LBVA 3PX3A 1MAVA 2QM3A 5TDHA 3CT6A 1AQNA 5IRCD 3QWAA 3RKRA 1MFPA 4I1YA 2XCOA 1T1EA 1ORRA 4QO8A 3PHGA 2CH7B 5IYZA 3EMDA 4F1WA 1GUYA 5KX5A 2VT3A 4J07A 3UNXA 3PL5A 3E9DA 1N32B 2ZRHA 4CIDA 1SURA 5JAPA 2NV2B 4KTTE 2OY0A 3U16A 3H5RA 2E5WA 1NVVQ 2WINI 2HP0A 1HDCA 1M5IA 1T2DA 3OTGA 2HG5C 2WVHA 4LJKA 4YJGB 4ENUA 1L7AA 1R0CA 2WYWA 3SXJA 4LMAA 4Z3OA 3GJRA 3D43A 3M9LA 3HM9A 2DWQA 3T7EA 1HE8B 3LOQA 3ZWKA 2HMYB 1ONNA 4UZFA 5I7VA 2N46A 2H5LA 5FI3A 1JFRA 3EXEA 5DT9A 3KYCA 3ES9A 2ZWOA 2QDOA 4OP2A 3C98A 4RA9B 3KRTA 2I8CA 3OE7G 1HDXA 1BS1A 1ZWZA 2ZD9A 4YT4A 5JMWA 4O02B 4CF5A 3UAOA 1M8FA 1Q1EA 3M7IA 1VGRA 1ELOA 4DA0A 5KA5A 3TR6A 2E7ZA 1E6UA 2FMKA 3T1CA 1EFVA 4V02A 5H3LA 4YPFA 1U94A 1UMBB 1V4VA 5TMEA 1KYYA 3CCUF 2OQ2A 1KWKA 1W49A 4JC0A 4EG3A 4P5EA 3AR5A 1ZUQA 1Q15A 2YY5A 2BZ0A 3MAJA 3QVWA 1K66A 4ALMA 2VJCA 3KKOA 2CLDX 4K1LA 5C1BA 2AUNA 4IJMA 4OLHA 4RVFA 4HPXB 5FBRB 3RF7A 2BHSA 1E59A 4GE0A 3HJCA 4CTMA 1VPDA 4G65A 3F1LA 1LSJA 1V7PC 1BFUA 2BHNA 2PT9A 4Z53A 4J91A 1IRIA 2GCOB 3AK4A 3BA9A 2AOVA 4MVJF 1M34B 4RKWA 3ADOA 3OURA 1CN7A 1IBLO 2JA1A 2VTKA 3HFRA 2PD4A 4DM4A 1LBHA 1H8HA 3ZU6A 4E2FA 4PHHA 5K1PA 2WIJA 3VYVA 2P27A 2V8OA 1XNJA 2JS7A 1TZJA 3K0GA 1PDWA 3PFGA 3UPUA 1CD5A 2R6DA 1FYXA 5HILA 4EJSA 1NVGA 4PLPA 2DUJA 1GT91 4MPPA 2RI6A 4G0YA 2AN9A 3ASUA 5K4AA 1DBFA 4CE6A 4GX0A 4PC1A 3HV2A 2Y1XA 3AM3A 4G9GA 2ZR2A 3K16A 3DTYA 1H66A 3VO2A 4QICA 2HCRA 1M1NB 2I7VA 2FUKA 1NBHA 3IV7A 4XWYA 3HNPA 3IDQA 3M6LA 4ARIA 4PFSA 2AT1A 5EQDA 2P9CA 2ISQA 4O1IA 3Q6IA 5TB5A 3OD5A 4M1SA 1OCEA 3RT7A 1CR4A 4V0ME 3HY6A 1EFLA 4QOGA 2HL6A 4DC0A 1SG6A 2PUSA 4GZRB 5D3KA 2IQ5A 4RCZA 3EFBA 1ZK2A 4YRPA 3PCTA 3MINB 3EMKA 3B7WA 2APJA 1CUAA 2ZB2A 1UC4B 2ZK7A 3A0HZ 1N1EA 3AK3A 4MAFA 1CTQA 3L71H 2FPPA 5JEDA 3U3RA 1FFBA 3MT0A 3CN9A 1TIPA 1BC5A 5DK4A 1I7SB 3IQGX 1KSGA 2JH3A 1P9OA 4JXZA 3EY4A 1GQRA 2G9RA 4BIUA 1HL7A 1F60A 5FTMA 4HGYA 3HNOA 4UCVA 3QVSA 3VDRA 4C87A 2JJ2G 3GFFA 2QQEA 2PKQO 1RI4A 5A7FA 5IKOA 2PAFA 3ESJA 2WWRA 3U60B 4UUBA 1ZL8B 3PDHA 3TLJA 3T1YO 4R9NA 4CEJA 4X8LA 2GCOA 3T5PA 4F9TA 4GP9A 3JW8A 4CW7A 4ENSA 3KZIZ 2H4XA 3SDZA 3K8QA 3T5CA 4JI0B 1WA8A 3FOFC 1G3IA 1N5KA 1VPLA 3O3NB 4UXHA 3FD6A 3GRCA 4HEHA 4WQMA 4PG6A 1WQ3A 4HSGA 2AZ0A 4FXOA 3L1IA 1DJPA 2RN9A 3UHJA 1RPZA 3GQVA 3RT3C 4Q3OA 4FB5A 4X92A 4I55A 3H19A 3FBGA 2Y6UA 2XRZA 3M3PA 4RD4A 2G1JA 3CONA 5GM2A 2F1KA 2JIMA 1TJ3A 2ZITA 4LRQA 4S1TA 1UBEA 3CCSF 1U2ZA 3JQAA 3MBKA 4WNYA 1YJBA 2CE7A 1W88B 8LDHA 3L8FA 5L3RA 5BWMA 1M1NA 3BHMA 4A6XA 4IJUA 1JB1A 4GXQA 2CHFA 1LY1A 1YDFA 3UCSC 3VZDA 1SVUA 2FW9A 2AMJA 1JAIA 5CFPA 4JC8A 2O1WA 4GSKA 3I5XA 5JARA 5K3FA 2BEUB 1TVKA 5HF5A 3BJZA 2BGTA 3G5MA 3L82B 3ACDA 4HVAA 5AHKA 4C3ZA 1I6MA 4FLVA 3P3PA 1RBQA 5C7IO 5B1DA 3RSGA 1QIEA 4QYSA 5BNWA 2F9FA 1YS6A 2V58A 1GL6A 3EZLA 3EY9A 2G08A 2QV7A 5HKOA 2AN1A 2WG1A 2Q3MA 1YD7A 1N6OA 2ZBRA 4B7UA 3LY7A 1E1KA 2E21A 4U2CA 4CG1A 4K40A 1Y81A 3WQSB 3BDAA 5AVWA 4J41A 4WKGA 1FDSA 4NYIQ 4PINA 5LD2B 3UMFA 1RXCA 3EOAI 1U0NA 3GJZA 1Q91A 3TLKA 1CBUA 3FYCA 1A7AA 2MCFA 1R88A 3NDIA 3V33A 4JI2B 1XD9A 3EZFA 3R3YA 3D8CA 1ZICA 3PC2A 5FL7D 1KZGB 1Y34E 1KYVA 2QMHA 4JT8A 3BERA 1A2OA 3HN6A 2WB2A 4S2EA 5CEEA 3KXIA 1I10A 1JLSA 4LE0A 1AUXA 1QIGA 4BGDA 3V2GA 4FBLA 2E0IA 1T5TA 3PCXA 1RLOA 2Q99A 5JNTA 4X90A 4C0BA 2H07A 3HBFA 1F8FA 4FCTA 5CN0A 1TZCA 5IF9A 1SKBA 3QPCA 5IKPA 3EGEA 3TMYA 4C0AC 5ARBA 4K3UA 5ENZA 3QLVA 3EH1A 3EXHC 5L3CA 3NDPA 4GRIA 2XYVA 1U7HA 1FYFA 4LIPD 3V1YA 4DIMA 4PXYA 4WEQA 2ZXFA 5DEIA 1R0YA 4K86A 3QEJA 4HDRA 3A1TA 1YRAA 4U2EA 1Q7CA 2X5NA 4ZOEA 3PL1A 4AZTA 3ELCA 3CRMA 2R8OA 4FXPA 1E18A 4NCNA 4EMSA 2VK2A 3LNTA 1SCUB 3MBMA 4MWBA 5MDHA 4O2BF 4ZAWA 1XT6A 3QZUA 1KTVA 3E2PA 3PC8C 1RABA 3S27A 1MJFA 1RIFA 4IOMA 3DDZX 3CF4A 3ORQA 3CO5A 3FTDA 4H0NA 3RKSA 2R8RA 3Q8HA 1YJXA 4DKJA 4UZEA 4D6PA 2QJWA 4H4DA 2R5NA 3RBXA 4YRDA 1L5LA 1JQKA 2VH2A 2HJRA 4I66A 2PRJA 1XAGA 1Q82W 2EJTA 1YZGA 3WLFA 3PFIA 3ZMUA 4ZVKA 5GAPK 1W4BA 4G07A 1V2HE 2Q3LA 3U3MA 5F2OA 4TV9A 5KOHB 3DYIA 2X1LA 1QU7A 2R5WA 1U6KA 1VQ9V 2VRWA 4XSGA 2NGRA 1EAMA 1GR1A 4CNQA 1N2CA 2G1UA 1QDLB 1SKUA 1H48A 1ZH2A 2O3UA 3TRJA 4CF3A 3S40A 1K88A 3I12A 4KL1A 5H9CA 3ZTYA 2IIQA 4WXRA 3VR2D 4ND7A 3ET4A 4ZI5A 4TYPA 3RG8A 2CXOA 4CIYA 3DZCA 5BRNA 5CCXA 5BVHB 3PQ7A 4BUCA 1CC1S 2F9ZC 1DEXA 2KM1A 3HDYA 4DXAA 1K8AH 2PMKA 4YJ3B 2EJ7A 4NAHA 1FZQA 4JC4A 1ODJA 1Y3AA 1Z13A 3VO9A 3HUEA 4YMWA 2P9ZA 3K6RA 3W6UA 4G0QA 3GQBB 5K1XA 4P34A 3OY2A 2V9CA 1OT5A 2IP2A 3W5VA 2JRLA 4C4WC 4TYYA 2RMKB 1RHMA 5LCXA 2HVYD 4AXXA 1Z8FA 3BHNA 3QLVC 2QG9A 3E9CA 2NMUA 4KQ6A 4X97A 5DMXA 4DUYO 4GI1A 3KQQA 2O8DB 4MQMA 1UJ6A 1XQ9A 2DFPA 3KJFA 3S5JA 1RWOA 1YRWA 4YP0A 3PEUA 2CNWA 5FBVB 4FN4A 1VZ2A 1H2RS 1BQEA 4YJHB 1X2BA 5DXJA 1N8TA 3DFZA 3SK0A 1URPA 5AVOA 1C4XA 5MN6A 1Y1KE 3L18A 2XMCA 5GAJA 1R3KC 1YUBA 3CXRA 4NEQA 4J1NA 5L3SA 3DQQA 5K3BA 2V03A 3TQQA 3ZRWB 2DHCA 1PX0A 3D36C 1X14A 5EC1C 1KWGA 1GPYA 1TM5E 3H11B 2BISA 5IDVA 3CLTD 5LB4A 4HQOA 1MB3A 4BOYA 1JTEA 3SC3A 3AB7A 5JSZA 3ZWNA 1JB9A 1RE1A 1CDDA 1TQDA 1Y67A 3LKDA 1MF7A 1W36D 4NFHA 3EIEA 4EM6A 4NBWA 5B4TA 1MZPA 3K0AB 1NMUB 3VZBA 4C0SA 1SU8A 2LBPA 2DMXA 2B92A 3THWA 5DBOA 3GRFA 3O2JA 2B78A 1YRYE 2F1MA 4U1RA 1LBSA 1AT1A 4LFCB 3V8EA 3TE7A 5BW5A 3JQ9A 2HWXA 1SXIA 1WV1A 3EEYA 3LQ2A 2G28A 2VLBA 3ABQB 1QQ6A 1R1DA 4BW9A 1TM7E 3GBSA 1K68A 3QMWA 1UJMA 3PBKA 1JDUA 2VK8A 5BVHA 5TMPA 5CIWA 3KKMA 3PGMA 4BVFA 4GOJA 3L7NA 1QG2A 3ML0A 5ALXA 4B17A 3IMGA 3ESRA 1LUAA 5J1SB 4C6RA 1B23P 1P0FA 4BQQA 3ZGXA 4BLRA 5CM2Z 3FDZB 2A58A 4UDNA 3AGPA 2C97A 3KK0A 1NBOA 2OORA 3TD3A 5HOEA 2OQIA 4EJ2A 1J8QA 2ZSEA 1NURA 1PW5A 5T7BA 4B1FA 3GELA 3JQ6A 3LCVB 3TL6A 2MR6A 5AM0A 3ZY5A 2O5CA 1LW7A 3ZVMA 2Q3EA 1NQUA 4YV1A 4AAYA 1S0UA 3DFMA 3DZKA 2Q7XA 1SAYA 3SYLA 4CLRB 1K9SA 4L74A 2KMLA 1Z0ZA 2Q5HA 1L4GA 1FBTA 4D3YA 3C7TA 3L41A 1UFVA 1LWOA 4BB0A 1IK6A 1JQJC 3UXMA 3ZHOA 1JA1A 5ALRA 1GPJA 5T57A 1KY2A 1E3MA 1DAMA 4LJRA 4FEYA 1UPUA 3PB3A 1SOUA 1N9GB 1JDSA 2W8BA 2AH5A 2C31A 4QWWA 4M46A 5FAKA 5FCDA 3W7AA 4U9IS 1ZOPA 1K6MA 2RHDA 2Y76A 1G1AA 1YZNA 3BM5A 2DKOA 4I7EA 3EGXA 3HHEA 4M8KA 1KSHA 2X8JB 3MCZA 3DM9B 2CNDA 4ZRNA 1FNDA 2VDUE 1UPBA 1BGVA 1Y6RA 5J47A 1AGPA 4EGFA 2NP7A 1XP8A 3DAGA 5NULA 2XKAA 2G04A 3O7WA 3KB1A 1IAQA 1JXMA 3AKYA 3HO6A 2PZEA 3ZY3A 4EENA 3CNEA 1EWRA 2R6AA 4IKOA 4UKDA 1W41A 3U4HA 4F12A 3AI2A 4YWHA 4DV1O 4EELA 3FTQA 1BMFG 2MDTA 3S70A 1UPTA 2YHUA 1TA8A 1DLBA 2AQ8A 1VQ9F 3IURA 3R5KA 4Q9IA 1GO1A 4G81A 2FZ5A 3ZU5A 5JOQA 3ZY4A 1G17A 3NCTA 2CZQA 4IBOA 4HEA6 3NVKE 4ETMA 4EHDA 4CH3A 1D0IA 5JTTA 1DCKA 2C4UA 2XAJA 3IS3A 3A05A 1BW9A 1U7OA 3LL4A 1X70A 1CLEA 3NBMA 1FRFS 3VUFA 1DRUA 3ZE1B 4YBRA 4KZPA 5M04A 4DCGA 4RK0A 3WKCA 1UXGA 2PSDA 2YQ4A 1DIHA 4YDHB 2P5TB 1WR8A 4CTKA 5FT9A 3UM7A 2QN6A 1QTQA 2P4HX 2NZJA 4X6LA 5K0LA 4AKHA 2VJNA 5L3VA 4NU0A 3ZDDA 4ZYVA 5ITSA 2Q9CA 4MPRA 2WJPA 2AWNA 4QQRA 4F8EA 3H87A 2P06A 5JNVA 3GBVA 3ZW7A 2WE7A 1GNLA 2W4IA 1D2EA 3TCKA 4MOWA 3DSQA 3QNEA 3NDBB 4HUQA 4O08A 1VP9A 1VPTA 3QVMA 2NG1A 3AF5A 1KPHA 3V8BA 2DUNA 4KE8A 4YRQA 4HN9A 1T43A 4OA8A 5K7SA 1N6NA 3QG5A 4FFSA 2PWAA 2BDEA 1U3PA 1FFGA 3OFVA 4UM9B 9LDBA 4KH1A 4XEUA 4DW8A 3NAQA 1RHKA 3KZNA 3IJRA 3N0VA 3RFFA 2AMLA 4UVGA 1VJTA 4WOBA 1CS0B 1DKLA 4QWMA 2JZCA 3VPDA 1KE2A 2JA2A 4MUYA 5EERA 1PN3A 3T7KA 4H3HB 3TGLA 3ZMSA 1K4YA 4WOKA 1HFJA 1F23A 3K94A 4FNMA 3G7UA 3LE8A 3NR7A 1JHZA 5IAGA 1DUIA 1PR0A 4NBLA 4GVPA 2FPXA 3CLRC 4L27A 3NNNA 4UEJA 1JKMA 4E6PA 4EQZA 1G3MA 3BB1A 4U3FH 4DDVA 1E7MA 2AOUA 2PRZA 4EA7A 3PAFA 5P8WA 5CAEB 4YACA 1W42A 3FNHA 2YDYA 2PS1A 4EKGA 4BUJA 2W6OA 2R4UA 3PE4A 2GGSA 4I6JA 5L45A 3Q7SA 3TOVA 4KXUA 5HUHA 2O7SA 2C83A 4C2UA 4U9HS 5EJ8A 2CJPA 2XUIA 3QUQA 3QFSA 4J4BA 2WJ4A 4Q5IA 4B8WA 4IH9A 1H8HD 1TC1A 3KT8A 2P22C 4PF1A 3KCQA 5EJ2A 3VKFA 1FB5A 4RK6A 1ZU4A 2J6CA 1KEPA 4OGKA 3VR6D 2HNAA 3H8WA 5FLXM 3JD4A 1KQNA 2E4ZA 3WL3A 5CFMA 3T7CA 4KNVA 3AJAA 1JW9B 3ODGA 4DIKA 2QYSA 5M2QA 2XOXA 3Q3IA 5JECA 4GYCB 3ZE2B 1U6IA 3GP8A 4X8AA 1ZN8A 3F0GA 3IC9A 2C77A 3JQ8A 3QX9A 2ERXA 2Q2OA 1DCTA 4ZOLF 2VJBA 1KVQA 1SEVA 2ZIGA 3B8EA 1Y42X 3VJKA 3M81A 2V9ZA 2BEVA 4HQ6A 4B46A 5TRTA 1NONA 1L9XA 3EVAA 1BYUA 4BXOB 1ZXLA 3OQ6A 3DW1X 1ECPA 3I39X 1T8SA 2A6PA 3I04A 1W44A 1FYJA 2R00C 3W34A 3PNQA 1X1DA 2BR5A 4IF4A 2HT1A 2Z6UA 2RHCA 4NXMO 3TL3A 1C8BA 3IUBA 3K12A 4PNEA 1RWXA 2ID4A 5CB4F 5MN5A 3MWYW 2BAGA 4R7GA 3BD8A 1BHAA 2HRRA 2EULA 4I1UA 1TX4B 3VPSA 3BZBA 3E4DA 1SY7A 3TLZA 2JAWA 4DARA 5ERXA 3F7OA 4GPIB 4GPD1 3GRUA 2I4MA 4WF9V 4QGBA 2PZMA 1V54C 4UMVA 3HYCA 4CF7A 4HAVA 2M6LA 1L7PA 3ABUA 1L1EA 2QD3A 4HLUC 3A1NA 4B75A 5LQSA 4S2UA 2GZ3A 4BVKA 2ATKC 3C43A 3DT6A 1C9EA 3BFVA 3SX4A 3NK7A 1NIJA 5U4QA 2C2OA 1LPOA 4RL6A 5FNVB 3OQJA 3LJKA 3BWEA 1NQ5A 4D92A 1KQPA 1NV9A 5HPYB 1K6XA 4KN9S 5DN6D 2QKCA 4MGYR 2RH5A 2W0FC 3IMKA 4RFSB 4M7PA 1HQYE 2QAGA 4W8GA 1XNRO 4OQNA 1FFXB 5FWAA 2Y1GA 3Q9NA 4QD3A 1V9CA 2CJXA 3SHQA 1FYWA 5F3RA 1PD3A 4H37A 1OXMA 5EE0A 4ECEA 3JQAD 4JZKA 1JAZA 3MJCA 3HI6A 1MB9A 5JAZA 3K5HA 3OO0A 2XEDA 4TMTA 2YWJA 3I5UA 4YP6A 1WNFA 1VJCA 1GADO 4TS1A 4F2PA 2O23A 3WOHA 5JSFA 4YCNA 4S0XA 5FV7A 3DBHB 4H08A 2J7PA 2ZSBA 3HMQA 2JAQA 1Z06A 5JLAA 3VI3B 4NJEB 4CS2A 3FR8A 4YUYA 2I87A 1JG2A 5CA1A 4BYMA 4PU0A 1XL1A 1M10A 3AFNA 3R7BA 1A5AB 3KT3A 5AIBA 5BR4A 1XCGB 4C76A 4WNAB 4X24A 5JPIA 1SA0B 1WBDA 1ODTC 4Z0PA 4YEDA 2VL7A 1N6IA 2QW0X 3S2UA 1E7SA 1NX9A 1T9DA 2JH9A 4FPPA 4N0PA 2ZI9A 3GA5A 4JVNA 3L8MA 3JALA 1DRKA 4RIHA 4RBNA 3ZIAG 3ZC3A 2O57A 3H01A 4DV6O 1JYSA 4NG4A 3WRXA 1BKYA 3U7RA 4HDQB 4QA9A 3DBVO 3BCHA 5CVDA 2L0XA 3BREA 2VWHA 2CFOA 2YMLA 3AHHA 3DC7A 1GVHA 5AVJA 3U19A 3PICA 3Q9SA 1RYMA 4I6GA 3OWHA 5LA6F 3ABTA 2GUGA 2RFLA 1QC5B 3E7WA 4WD3A 4AP9A 5AOVA 1GN4A 3UA4A 4XGRA 1VQLV 4FMDF 4WZAA 3ZD8A 2FNAA 1UFRA 3UQ8A 2X1VA 4BKMA 3RTGA 2WTMA 3L8HA 1XU4A 2F43A 4F97A 4WCVA 4DR6O 3NVAA 2ASEA 1TUEA 1C1DB 1M1YB 3WP1B 3LF2A 4M60A 4C29A 4Y30A 1J1UA 4EJ0A 1WD7A 1GQQA 1L5HA 4EHLA 1E0DA 2HPAA 2RHOA 3UJNA 1Y5MA 3S7TA 1S1CA 2E48A 1TTPB 4GZLA 2Z5LA 5FWDA 4BO3A 3TYXA 1V25A 3H5LA 4ALJA 1Q0LA 1RWPA 4MVXA 4PQRA 1OAOA 2FSSA 4A0FA 4B33A 1OWMA 1GV1A 4ZAYA 4PPQA 3T3IA 1VYTA 5F7ZA 3BTVA 6GPBA 1Y6GA 1JTVA 2PQ0A 1YTLA 4IIBA 4CMJA 1PM9A 1IZ9A 2Z1FA 3L92A 2ZBFA 4ZHQB 1MT0A 2ALJA 3NWPA 3E9ZA 2H6LA 3K57A 2W6QA 2FSIA 3IEIA 2PUVA 2HS0A 1JBEA 5AP9A 2P0YA 4AIIA 3ADDA 5AK4A 1QYWA 1Q5PA 4XIJA 4O4IF 1H23A 3DCIA 3OFNA 2ZUUA 5EUQB 1JJ2F 2JIBA 3TD4A 2O7VA 4Y67A 1ENVA 3L8YA 1ZIOA 3O4VA 2XNKA 1I32A 3S3TA 1VMAA 5I8PA 3BG5A 1P7ZA 2XAAA 5I5GA 2XBLA 1YC2A 1ZQ1A 2GEDA 2XNJA 3W5CA 1GTSA 4OGGA 4OXQA 3PPYA 3SYRA 4MW9A 5BSEA 3O47A 5JD5A 1WJZA 3AG1C 5K4HA 2DW4A 1VSTA 2B3TA 5AVXA 4OEHA 2QK4A 4R1PA 4HWRA 4NVRA 3AVQA 2XUOA 4FKMA 5EY5B 1QC5A 3LRTA 1JT2A 1OZHA 1XOUA 2EATA 5BV8A 1RPTA 1GPLA 4CS3A 3EBPA 4YJ2F 4JF3A 3WQQA 1DE0A 1LSOA 5G3YA 2OV6A 3NBUA 3RG2A 2QKAA 5IYZF 1VB5A 1HDOA 3UM9A 2X6RA 2PH1A 5CW2A 1YXMA 4EI2A 4DF3A 2VK4A 3KEMA 2A0FA 4ZO7A 2Q69A 4M76B 1OD6A 2Y4OA 4PSCA 4JUCA 5A0FA 3WSVA 1U2DA 1VE6A 5HXAA 3B1WA 5AKYA 5AUPB 3NC4A 4KP7A 4Q1AA 2F3PA 4B2PA 2ZI4A 3UA3A 2IIVA 1FXKA 1G59A 3SR3A 2CNWD 3GT4A 1T36A 2OXEA 4PA9A 3DGFC 1XPJA 3OFJA 4N8EA 4RTNA 4YJFB 1YNSA 1XZNA 1R5NA 2J3EA 3S3XA 3R6TA 3OX3A 1J8MF 3DZHA 5IVDA 2XCSB 5KNBA 2IY9A 4MUEA 5AVSA 2HJGA 2HMUA 2PWZA 1UUFA 4ID3A 4LTNA 2WRZA 2D5IA 1F0PA 3KQHA 2O0LA 3CMEV 2WHQA 4ERHA 4JAVA 2IWHA 5CX4A 3ZLJA 1UR5A 2K9PA 4IXWA 1FTSA 2JH8A 1VE5A 3D7LA 1YVPA 1PEKE 2BFCB 1EFCA 1OJ7A 1EM6A 3KZVA 4DDHA 3RUIA 1GU1A 1K4MA 5FJJA 1HQKA 3PRYA 2GEFA 3AM4A 5CK4A 1RP7A 2W6ID 2XVXA 3IB3A 1IIRA 3IJ4A 2H4FA 1IUPA 3VV3A 4BVEA 4RNCA 1POXA 3BAAA 4UHHA 2J4FA 5EWJA 3FLAA 3RROA 1I7DA 1UZNA 4YDQA 4A8JA 4YBZA 2QKSA 1E0SA 3L1HA 3UF0A 1WB5A 3N2IA 5JWPA 1JE0A 3WLTA 3AT1A 5LLDA 2FMFA 1PT9A 1C9YA 2H3EA 3SBDA 4G5GA 3OZFA 3PJSK 2WPDG 1P2SA 5FJIA 1JFSA 4DA8A 2V4ZA 1QORA 5LQAA 1NVFA 2FW8A 5MHTA 3PFFA 1EN4A 3AG7A 5AW8A 2OCHA 1XNGA 1Y5RA 2V7QA 1Q2XA 3HXOA 2AUTA 4COOA 1ZD9A 1XHEA 4X7PA 3X1DA 2AVDA 2XMGA 4DSZA 4EY8A 4G3XA 1DFIA 4WFQA 1NW9B 1H1LA 1AZTA 5LUBA 2BFBB 2VBIA 4G0MA 5EBLC 5TJHA 5DM70 1GD1O 3KE9A 3RGWS 5HJ5A 3H1LH 4LGMA 4WXMA 2A5GA 2NYRA 1U2DC 3LSQA 3ZOPA 2NUPA 3BFXA 2JGDA 2JFVA 1RRCA 2I03A 4D4LA 1FXKC 1DBRA 2J5QA 2Z5VA 2JNBA 3UATA 1TF7A 1SQPH 1U5CA 3OETA 2KJQA 1GAJA 4JSYA 1JQLB 2VR1A 1ZJYA 2C07A 3ZV7A 4TMYA 3D1LA 3QVXA 4XX0B 2J9ZB 1E3QA 1UMCA 1SELA 3ZW9A 4NCIA 2HF2A 1RAAA 4M0CA 2ZUWA 2R8PA 5GMOA 2OUIA 1W9MA 4C43A 1MIOA 5KTYA 2X19A 4EPYA 1NVPB 3O1IC 4GR4A 2EGGA 3MM4A 1MEEA 2BEWB 1TXGA 3IPLA 3GJ0A 3ELDA 3GUVA 4UCOA 1YMQA 1YZHA 1Y89A 1XRJA 3AUUA 3DE5X 1W19A 4WFFA 4MUBA 2PHZA 1V96A 2WJJA 4JOSA 3ZU3A 3NV7A 3MQFA 4YA6A 2XW6A 5BN1A 1L7RA 4BDSA 1JA8A 1SG0A 3CLRD 4CU5A 3MQ2A 1Z75A 1F2TA 3ONDA 4TWJA 1GCGA 4G56A 2OXIA 2IYXA 1IY0A 2HHCA 2OO3A 2YRFA 4M36A 3KEOA 1UEJA 1YB4A 1G7RA 3L1UA 1E2UA 4CHGA 4HB4A 2QSYA 2F8MA 1FS0G 1ZCFA 4G25A 4HRYA 3KUCA 2IAFA 2QX9A 1KO8A 3ABRB 3KJZA 5I8WA 3MW8A 3M4YA 3LDAA 3EZYA 2ICAA 4WZ6A 5KQSA 3VTFA 2BZ1A 1WB4A 4IG9A 4PAQA 3H6GA 3OR7C 5CXXA 5JD6A 4B3SB 4QT0A 1I8TA 2EKPA 3KOOA 3AEZA 4YRJA 1KOFA 2C61A 2G1PA 2CBXA 5EIOA 1IPAA 3MFQA 4PSAA 4NV0A 5J5VA 2V9YA 3CLTC 2QMQA 1R4MB 3UC9A 1N4CA 2B2CA 3GRRA 5TE9A 2O6LA 3HU2A 2FG6C 1ZJZA 3HJHA 1CXZA 4EPRA 3DBOB 4URXR 5IH7A 1W36C 2I29A 3CKLA 3INRA 1X19A 3D4BA 1GFIA 4E5NA 3NK6A 1E9EA 3UOGA 4D9MA 1JHMA 4P22A 4ZI3A 3KEQA 1NIPA 3GCWA 5L4SA 3L7JA 1FK8A 4E2LA 4XZ3A 1PT5A 3M6WA 3IEXA 4NHEA 3T34A 3PKIA 1T6YA 4ABTA 1FUYB 4EPVA 3QU4A 1Z36A 1ZNWA 5DBHX 1IBSA 4C2TA 3BL6A 4HPWA 4PRKA 3GWOA 2X9QA 1ORDA 1G8MA 3EBLA 5IYDO 2BEWA 4GYYA 1RBYA 3FTPA 1IPHA 1KMIY 3JAWA 1A4UA 2ES4A 5EEHA 3OP4A 1RQ2A 5E6SB 1SZPA 3ANYB 1RC0A 2FQ1A 3P0RA 3IIKA 1FNJA 4P3KA 3U5ZB 5KDOA 1UBGA 1WIWA 2PGOA 1ZOLA 1L5MA 3STWA 3IKMB 4JEHA 1YIJV 1YS4A 5T4BA 4D82A 1PZXA 4PAWA 5DCYA 1XHLA 2B99A 3DFUA 4YRIA 1IN7A 4XIGS 1GKFA 3ZPXA 5EG5A 1SZXA 5JJEB 5KYXA 4G41A 4AJJA 3DEKA 4GLJA 3V2HA 3I6YA 2F90A 4J1SA 2UUPA 4J7KA 4HX2A 1XL0A 1UJBA 2BBTA 1IN4A 3ZXYA 4JQZA 1ENPA 2IJHA 4B35A 1VI2A 1QHGA 4TTIA 4QDZA 4JOQA 4CCYA 4OMFG 4LY0A 3P7MA 4MJ3A 1AZWA 4O4JB 4KUMA 2ZKOA 1NW4A 3BF7A 1JEYA 4DADA 2FFRA 2CAZC 3OU7A 4XCXA 3D3KA 4QG3A 4DFDA 3USZA 3LW8A 1OLSA 2B7CA 3I55V 3W3AH 2G07A 4CLOA 4GSLA 1IEWA 1ST3A 4M1TA 2Q1TA 3ZV5A 1V2GA 1OKKD 3R5TA 1N33O 4DMGA 3TIGA 2GWHA 3ED1A 1JR4A 5DULA 2YV1A 3LSUA 3DPIA 3UWKA 1U97A 1SBQA 2VP3A 2ZDGA 2EBWA 4KXQA 2YXLA 4JI3O 1W4CA 3I1YA 2YRXA 4P0QB 3D0QA 1A1VA 1K9VF 3B2QA 1CR2A 5EBWC 3LUAA 2NPFA 5C1DA 4X62B 4HFMA 1D2RA 5CJJA 1OBCA 4U2GA 4OREX 3AEKB 4IOJA 3NH6A 1M2OB 3HB7A 1Q1BA 1SU7A 4IVQA 1VECA 5TC4A 4BQRA 2YXPX 2OHFA 1Q6IA 1AHNA 4LJAA 3BB4A 4E30A 5KTKA 2Q46A 2YNMA 4V0MA 4OA5A 3ZQ4A 3LF1A 2P35A 2PNFA 1F8GA 1L0BA 4N3GA 4UUOA 1XRMA 1YS1X 3I42A 1PJQA 3EG5A 4NVPA 3ZWQA 4C03A 2IW3A 1W4AA 5FUVA 4DWJA 2PT5A 3ULKA 1UK8A 4KO2S 2A3QA 1SHJA 4JX8A 3JAKB 4J9VA 5TMDA 1Q7EA 2C5BA 4PRLA 3W5HA 4IVNA 2IF0A 1Z68A 4BS9A 1I6LA 1IY9A 2HDWA 2WR8A 3ZK9A 1I5EA 3VMMA 1NXPA 1KJ9A 4FW9A 3KZ1E 3WGNA 4BZPA 3A37A 5JXIA 2JLZA 1Z29A 5J5CA 3K9AA 3FGOA 3CPWF 1A76A 2CH7A 2ZRIA 2YQ5A 2JI6A 2DMRA 2SICE 4ZAVA 4F1JA 2FJ0A 1TC2A 2WWTA 5CJ2A 3B6IA 1IDSA 2W42A 3G5AA 4ERXA 2HRYA 4D1YA 3X2QB 2BMWA 1MHPA 4BKUA 5A4JA 1YL6A 5ADUS 3EIWA 1HFEL 3TIXB 1TU4A 4XX1A 4YJGA 3ZHVA 4EYOA 4Z9AA 1JT9A 2MQEA 4B9AA 1QGED 4GQIA 4DQDA 4JASB 3P26A 3H13A 2ECKA 2LZ0A 3JATB 1K8AW 1AHIA 1TYBE 2UUAB 4WA7A 3VOSA 1E4YA 4IRUB 3ZHSA 4ACBA 4AX8A 2JI8A 1UPCA 4AWAA 1N0HA 3QMVA 4RA9A 3HP7A 3HDJA 3BZWA 4IPTA 4G84A 5D00A 1QS0B 3SYMA 3EHEA 2W43A 2R6CA 1GYPA 1FXSA 3FWNA 4WLUA 1JX9A 3CV3A 1ZM4A 1M2OA 1UMBA 5ES3A 2LVBA 1KYOF 2BT4A 1G0OA 3VKVA 5DGDA 1U0JA 4C5BA 3U5TA 2PRYA 3UOWA 2ZU0C 3ZYCA 4ZU6X 1NVKA 2ROQA 4LBEC 2A5FA 4POOA 4HNUA 4RHUA 2YRWA 4R2MA 3TCXB 1I7FA 3TEMA 1QK4A 1H2BA 4P54A 3NPAA 1FL9A 3QOYA 1EQ2A 3ZUGA 1KMIZ 2A30A 5FPOA 2Z5UA 4AS1A 4FYWA 1T9GR 3ETJA 2HNKA 3WK5A 3WIUA 5KVAA 1M34A 1L7NA 3T9DA 3S0WA 4BWAA 3GJ3A 2CNKA 2K4MA 3QPDA 2LQTA 5IN4A 4LF7O 1MXFA 2KBFA 3PE6A 4K88A 4KVFA 5HP8A 1WSWA 2D3OW 2PU5A 4I9GA 4D0GA 3EF0A 3Q2KA 1G8KA 5D6OA 2OO7A 1UFQA 2ZRCA 4N54A 3GR6A 4CMKA 4PYJA 2AKEA 4LF8B 5ALSA 4H6WA 3VAZA 3ASYA 1Z47A 2BFMA 2Q28A 2H1FA 3M0EA 2C4MA 2OK7A 4DTCA 4ASUG 4LXUA 3VYSB 4A9AA 1Z0IA 3IDAA 4PONA 1YIJF 3NHYA 3FIUA 3IB6A 1NLFA 4ZT3A 4I8DA 4G5FA 4EJSC 4EG5A 2QX4A 5A6VA 3ZWPA 3X1YA 1ZD4A 1D5WA 4YCAA 4ZYUA 2B7LA 1GIAA 3O4GA 1TM4E 2II6A 1UDAA 1BE0A 3OCCA 4NX2A 3PC3A 3A2NA 1CRZA 5ADVA 1D7AA 4LW8A 1X8KA 4OXNA 1FOEB 3HVKA 1GRVA 1NF9A 5GIPC 4HKTA 3L70H 4X89A 4C21A 1B6SA 4OHUA 2GFHA 3MMSA 3ZE6A 1XBTA 1PTJA 1E98A 3MINA 2ZYHA 3ANNA 3W05A 1KH2A 3VNVA 2Y67A 3JQRA 4WEOA 2QVCA 1T9GS 1YJAA 3E7DA 3KKEA 4HT3B 3QUTA 4D80A 2PJUA 1D0VA 1X1QA 3LT2A 2HR3A 4WADA 3Q1KA 5CMLA 1OPXA 5FNZA 2ET6A 1SVIA 3DE1X 3N87A 4NMLA 3CEHA 4J49A 4FNAA 2XECA 3BICA 2RH9B 5FORA 3CS3A 3HM2A 3NEYA 4IW3B 2IZOA 4I9FA 2WTAA 1YUMA 4CM3A 2ZPAA 3K05A 2C7VA 4L8GA 2RHLA 5CEFA 1T2EA 2HK6A 3FPIA 3TM5A 1ZL8A 2FEAA 1C5KA 4INOA 3H1JH 2WOOA 5KVVA 2HIMA 3QTLA 4X95A 5EMHA 5KAPA 1RCTE 5ALIA 1OXXK 2X9NA 3A2FA 1CY8A 1BDIA 3PHHA 1M2EA 3WYCA 1O9BA 4Z51A 2P6YA 1ABFA 3N0XA 4IJ6A 2AR0A 4CL8A 3BWXA 1PGNA 3A4YA 5BN3B 4KLZA 3GJQA 5SZIA 4JI1B 1FNMA 1NZJA 4MCHA 2J0QA 4DWOA 2QA4V 4YY3O 3IUMA 2OSVA 4WFIA 2X86A 1KKLA 1XDWA 1OLOA 1LFDB 4OQEA 5CXSA 4ZO4A 1AJEA 3L8EA 1BJKA 3QU7A 5CBKA 2VZ8A 3UYKA 4FWBA 3MTEA 2P0AA 2O9JA 1B4DA 1DDIA 3MJVA 1W88A 4C7BA 3D7RA 2LD4A 3PE3A 3D8HA 3GN2A 1D5AA 5EWLB 3NJRA 3A9TA 5CFRA 2BGWA 2X23A 2EIJB 4DW1A 2ONZA 3KFXA 4H44B 2YDXA 3Q7PA 1TTTA 4I14A 3KQLA 2W0XA 1Y8CA 2BEUA 2MYTA 4J8PA 5CUQA 1JQ5A 3BTOA 2NNUA 4AN4A 2EZOA 2XADA 4DCMA 2UZ0A 2OAP1 4DR4B 4R2LA 3DAOA 1BD3A 1QIIA 1CB7A 4K9PA 1RU3A 4OHCA 3MJFA 4R9UC 3HQ4O 1Q0QA 1I51A 1MVNA 4TN5A 2VNKA 2IYNA 2AC2A 2F1OA 4DV4O 4LK2A 4AO6A 3UV6A 4HPJB 4JB2A 2O8NA 4XQGA 3NHZA 5ITWA 4EBFA 1R9GA 3HS3A 3IUYA 4E2ZA 1GM8A 2LUOA 3D7KA 3DD5A 3FYIB 5G2OA 2IJGX 3WG7B 5KNBD 3RC3A 2CK3G 4BFUA 2PXAA 1NMEA 1T13A 4J03A 4A91A 3EEOA 1US8B 3GMTA 3MHPA 4KOEC 3TEJA 3PKZA 3WG9A 1R27A 3L1KA 2HTEA 3FJYA 5FIUA 3S7ZA 3AB8A 1JG1A 1O8BA 5J4YA 1C3XA 5BSRA 1RXVA 1JMYA 1CULC 2OLKA 4JROA 4XWOA 5KAMA 1SD5A 2PEYA 3HLTA 3VXKA 4WGGA 2R9RB 4KN8A 2H8EA 1Z8NA 3HRIA 4KQIA 2Y1KA 3TQHA 3LBHA 3HBNA 1FP2A 5HFNA 4PN7A 3ONVA 5BR1A 2OZVA 4L0QA 2UVPB 1QH0A 4K0KB 5BWLA 1U3UA 4ZDWA 1BHQ1 2JRCA 4M0KA 2CWJA 1E1LA 3NHBA 4BLQA 2I54A 5LNK6 3BJMA 3R9XB 1CP9A 4BO5A 1NPYA 2UUBB 3WZ2A 4TKZA 5EKUA 3DEIA 3LWBA 4G4IA 1WY7A 4BNUA 2PGXA 4QECA 4UE6A 4ZI7B 5DPMA 4EA6A 4Z7JA 2Z04A 3B36A 2ZRDA 1KDYA 4LJ6A 1SCUA 4N8DA 1TTHA 2X7HA 3B3GA 1AF7A 3OFKA 1ACJA 1M1XB 2JK0A 3VR4H 4QGHA 2WZBA 2CVOA 2V7QD 1EK1A 3UMBA 2V7TA 1W73A 4MR8B 1K7SN 3FPHA 3IBYA 4KG7A 4KN5A 4JLUA 2Q5FA 2VAMA 3I9NA 1PNLA 2X2PA 2O2YA 3IP9A 2WNHA 4HEJA 2ZXWC 2NT3A 2VH1A 3IR5A 1YJQA 3A27A 4NH4A 1VOTA 1DTSA 2AG8A 3D6NB 5IK2A 4G1EB 3UBTA 5B12A 4ENVA 4KVZA 4ID9A 3ZBHA 1M8JA 5KOHA 1BDHA 1OZGA 4BW0B 1VMGA 2P6OA 1YR8A 4FFRA 4UPVA 4ZIRB 2QSAA 4YLYA 3VTIC 3DMTA 3JYLA 2ANBA 1MJHA 3AHFA 2ADPA 1HR0O 2AFIB 2QRMA 2HRQA 4P4GA 2UYQA 1YB6A 1KIFA 1C4WA 2JLCA 4DUZB 4D43A 3CXUA 3OIVA 2EIKB 3SIPA 1J97A 3OR6C 1USIA 4MSWC 3B77A 2P78A 1JDVA 3G88A 1VBNA 1KEZA 2IUTA 4MQUA 4RS4A 3O03A 1QLEB 3IE1A 4FTWA 4HNHA 5AI0A 2ILMA 3DV9A 2LIVA 3ZCPA 2H4YA 1JMVA 2B4TO 3VV2A 3SWWA 1NVVR 4D6TH 3K58A 2MINB 5FBKA 4IOLA 4YJ3A 4GGOA 1IPFA 1Y0BA 2X8WA 3LG2A 4RSHA 5BY2A 3QKSB 4YYZA 2GVZC 4L02A 4S1WA 4V03A 4CCSA 4S1OA 4GE3A 3X1JA 1E2BA 1F8UA 5CLJA 3NIBA 2FEKA 3TZEA 2POCA 1MLDA 1GA4A 3GQBA 1EDZA 2JEZA 3F3KA 2DPGA 4NS4A 2RMKA 2ZJ2A 2I7DA 3Q15C 1EWYA 1VDZA 4O4LF 2Y1WA 2BJVA 4PCUA 1M9NA 4JB8A 3BL5A 3EGDB 1T8UA 2C82A 4J9UE 2MMCA 4OFZA 2O8DA 2ZIXB 1AI6A 5IXJA 3OKPA 5CJPA 1U5BB 4NKRA 2VPIA 1N2JA 2OZKA 4G89A 3V3KA 5D86A 4GWGA 3ZQ6A 1ZN2A 1QBGA 3L0ZA 4NF2A 4YJHA 4N7MA 2OHJA 5EC8A 3ZOKA 3FFQA 4RHCA 2OP1A 5DCLA 1ZJWA 3J81M 4C3UA 3GEMA 1R5JA 3O6VA 5KCZA 1DSSG 2JKYA 4D5GA 3V1KA 1Q50A 2Z5GA 2FEWB 1R10A 2Z1UA 2P2LA 3SEQA 2R1UA 3ZRWA 1UT8A 2YIAA 3T0FA 1Z12A 5FL3A 5KHLB 3RJTA 3OEWA 5C1IA 2VUUA 3H11A 4E32A 3ELUA 4IXTA 1YIOA 1DS6A 2VDMB 4QXRA 3FYTA 3N2KB 4L9SA 5HG0A 1S2LA 3LXUX 4WZBB 4RQBA 9MHTA 4RJIA 1OWOA 4FM9A 4ND4A 1G1XB 4TZTA 1DIRA 5HYVA 1BH6A 3N8NA 5I9NA 5K8CA 2WYOA 5KSWB 3K0AA 4XDYA 2YWGA 2P2GA 2GK4A 1GKKA 1ZH0A 1KJJA 2WLNA 1HGXA 3CD6V 4LF5B 3EVFA 4CKBB 2C5EA 3QLUA 2BPOA 4D0RA 3K5PA 5DV9A 1UOOA 1W57A 3EPPA 4O4HB 4MSUA 2RQ6A 2IW1A 2FPMA 4LE1A 4RQEA 3I72A 2WJWA 3NG1A 1WXGA 3AM5A 4PHZA 4H7DA 1N2SA 3JQ9C 2FX5A 3L0SA 1TEVA 2JFUA 2WHPB 4OKIA 2GLZA 3I4CA 4BNIA 2R3SA 1B0PA 4IL5A 5JAUA 3TE6A 3FKJA 1ADJA 3T4ZA 4AKEA 1JQDA 1PJ2A 3B1VA 5CT6A 2ZZNA 1M8GA 4JP2A 1RZUA 4NTXA 4EHAA 3MPUA 5T5QA 3FDZA 4A8HA 2QJFA 2IHJA 5GONB 3WIDA 3KEFA 4PLTA 2R25B 2NU9B 1GQSA 1C9MA 3MUFA 1OZAA 1QJ4A 3BQ9A 4M1ZA 1RNLA 5BURA 4W6QA 1PI3A 1FXVA 3R7AA 3OLCX 4EB8A 1AO0A 2HA2A 1U5BA 2I7TA 1TQ6A 2OORC 4BRSA 2LDBA 2I76A 2CDNA 4CLRA 2E2WA 4WN9B 3I5DA 3FPEA 4B81A 1ZH4A 1R0LA 3FD5A 4MVRA 1T5OA 5EK0A 1DWQA 3TRHA 1HFWA 3KKKA 2G83A 3ZD7A 4D3FA 4YECA 1O58A 4OIMA 2AFIE 2JJYA 4TZKA 1CCWA 4MB2A 3CUTA 2JLWA 1N9GA 2ZRGA 4D5EA 2Q8PA 1OWLA 1G3RA 3N2KA 2ZTLA 5HY4A 4ZJPA 5J4KA 4J42A 1CUFA 1EJ0A 4P84A 3QYFA 3RO7A 2HKOA 3OT7A 5KWIA 5F23A 1IBMO 2W8BC 4KYVA 2X8JA 3HNRA 4YVFA 2J6HA 4PZ0A 2G6BA 3G8DA 4C8EA 3O38A 4AUEA 1KSFX 3ZRVA 5FOTA 1YR7A 4OQMA 1XDUA 3HY3A 1X59A 2P9GA 1VL1A 1GSIA 3ZHXA 2P3OA 1ACLA 2XTMA 5JVDB 1CIPA 1FFSA 2WZDA 4DILA 2E55A 1XHXA 4QPKA 1LBQA 3LTNC 3NDJA 1E79G 1FBNA 3KX2A 1BU5A 1FS4A 1E9FA 3CC4V 3AP1A 1PGOA 1IJFA 2YNMD 2X5XA 4JVMA 3BXEA 2VPYA 1EBUA 2ZTUA 4HJRA 3A9WA 1LDYA 3LUTB 1QPBA 2VPZA 1UINA 3PPVA 1C7ZA 4B3RO 4RS3A 1IE3A 3CB4A 5DYNA 5JADA 5GONA 3TEFA 4CNBA 3VZSA 4QPPA 4L3OA 1VQ8V 4WLFA 4NFLA 4HNRA 4LF9O 1FDRA 3D6FA 2JI9A 1PZGA 4NK4A 2B94A 5HZHA 3R5SA 1NRIA 1AGRA 2ZIEA 1IX9A 2LBXA 4RJTA 3TJMA 3IOYA 3CZ9A 5EXXA 4F3YA 1JEQB 1QIFA 2OVFA 2PSFA 4WZBE 3H2KA 2AJTA 4RA6B 3N3AC 4HTAA 4OHMA 1E4VA 3OUZA 3QELB 1ONSA 5KNLA 2A8YA 2Z1TA 3CPEA 4NYIR 4DV2B 1E2DA 1THGA 1ZNQO 2X8LA 1GPBA 1FFDA 2I71A 5F5XA 2QLLA 3WFIA 4HNQA 1ILWA 4HBGA 1E89A 3V8NA 1WPRA 2DQ4A 1ZI6A 3BCRA 4C6HA 2QAJA 1JI0A 2VJDA 3O9VA 3D0RA 2HJHA 3IELA 5ELXA 1NU8A 1BQ3A 3BC1A 2XB2A 3W04A 1A9TA 1Q6HA 4ZN6A 3KCNA 2Q1SA 5EMMA 2ZE6A 4BKPA 5TF4A 1FLAA 4QLOA 1NL3A 1FVHA 4O2RA 3TXAA 1SHTX 2FSHA 3HDTA 5AJYA 4JX9A 1ZUD1 5TGTA 4KPEC 2QUBA 1YCIA 1CQJB 1RKXA 3KC2A 2KLHA 5C5EA 3ASNB 4Q03A 1CS0A 2A94A 3DV2A 4BN4A 2CUKA 1DRWA 5IY5C 1ZM2A 1PBTA 2PUBA 1FQWA 4Q24A 3QIVA 1CLUA 2JJ1A 2GRUA 4EY5A 1BMTA 3OHMA 4TTRA 2E37A 2XCQA 1R0SA 3BTSA 1IUNA 3NKFA 2H18A 4HN2A 5IW8A 2ZS7A 2NP6A 3PZRA 2ZM6B 1Y6QA 5AD1A 4LRSB 3P0EA 3S68A 5ECWA 3D8UA 3Q3CA 3TO5A 3R23A 1DELA 1SC9A 5KPJA 1LFAA 1X7OA 3B70A 3DNFA 5ALWA 2H52A 4CG2A 5LYJF 2NVUB 5CAEA 4IMPA 1VQNV 4UHBA 2HREA 3BIOA 3ZV3A 1LZLA 3KB2A 3SP1A 2WV7A 3ZQJA 1LF5A 1WMBA 3QWHA 4BMOB 1X86B 4PRZA 3ZY2A 5EUMA 2HTFA 3ASOC 3RASA 2XCLA 3U9LA 3H2HA 2G67A 3L8CA 3WGQA 4OH1A 1UBHS 5ICGA 3ETDA 4M83A 1IK4A 3QYJA 2H11A 1J33A 5FQOA 4QPNA 3LUJA 4B2YA 4MW8A 2ODWA 2IYSA 2JLSA 1ZMOA 2PXHA 3KT0A 2D7DA 4KXRA 2A9KA 4QU0A 5JFOA 4M1MA 3IOBA 3TZBA 2GN9A 5IDWA 4PPYA 1KQ3A 2HPHA 4KTVE 2BIFA 1ARZA 3AIIA 4A26A 1JQ3A 1GZ3A 2UUCB 4CFYA 4Y2HA 3C3KA 1LTHR 2VAXA 4D9IA 4U39A 1Z6XA 2CVPA 2XEXA 1FFCA 3DBIA 2BRUA 3W6NA 4B3GA 4YIHA 3UG6A 2PT7A 5JUWA 4BXOA 4FOLA 3B6KA 1D1SA 3UJBA 2YBDA 1X8XA 4PM4A 3BILA 2NAFA 3OTIA 5EE1A 3CE9A 2XMSA 3N05A 2M7WA 2XSZA 3EB9A 3K53A 1G2PA 2JK5C 2FZKA 4AT1A 4ZQCB 3OAAA 2XTNA 4L4XA 5TQJA 3R0IA 2LPMA 3OLXA 3STTA 1ABBA 4KLCA 1K06A 1MTOA 1BXGB 1X6VA 3LUCA 3ZX5A 3T7AA 1CV2A 3Q3GE 4F91B 4ZD6A 4CCAA 1U90A 3DXYA 3Q5DA