1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
molecule tags Cell cycle, structural protein
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
3RYCB 4DRXA 1JFFB 5FNVA 5C8YB 4X20B 4YJ3A 1RQ7A 3C8LA 3RYHA 1SA0A 5LP6C 5EYPB 4O2AB 3ZIDA 4O4JB 2RHLA 2GVIA 2VAWA 5CB4B 5GONB 1W5BA 1RQ2A 3JAKB 4LNUA 4WBNA 2R6R1 3JAWB 4EB6B 5LYJA 4DXDA 1W581 5MN6A 4O4LB 3RYIB 5LA6A 5LOVA 4E6EA 5KMGB 2VXYA 3N2GB 3RB8A 4TV9A 4EI8A 4F6RA 4YJ2B 4O4IB 5IJ0A 3UT5A 5J2TA 1FSZA 4I55A 5MN5A 4M8IA 3E22B 4X1KA 4O4HA 3WGMA 1TUBA 2BTOA 5M7EA 2R751 4DRXB 5FNVB 3WGNA 4YJ3B 1FFXA 5EIBC 3RYHB 2Q1XA 4O2BA 1SA0B 2XKAA 3V3TA 5JVDB 5J2UA 4I50A 1TVKA 5IJ9A 5JVDA 2BTQA 4EI9A 3N2KA 4IIJA 4LNUB 4WBNB 4TV8A 4U39A 5LYJB 3WGLA 4ZI7A 5IYZA 5LOVB 5LA6B 4IHJA 3HKCB 4TV9B 3JALA 3HKEA 3HKCA 4U3JA 4F6RB 5IJ0B 4EI7A 3UT5B 5J2TB 3RYFA 4I55B 4X1KB 5JCOA 4O4HB 3CB2A 1W5AA 2RHJA 1TUBB 3HKDA 3ZBPA 3ZBQA 1FFXB 3JATA 4O2BB 4HNAA 3JASA 4TUYA 4I50B 1TVKB 5J2UB 5IJ9B 2XKBA 1RLUA 2BTQB 3N2KB 4IIJB 4TV8B 4ZI7B 3WGKA 5IYZB 3VPAA 3VO8A 5CA0A 4IHJB 4X1YA 4ZOLA 1W5FA 4U3JB 3JALB 3HKEB 4KWEA 5CA1A 4ZHQA 3RYFB 5JQGA 3JARA 5LXTA 3HKDB 5LP6A 5EZYA 4B46A 5ITZA 3HKBA 3M89A 3JATB 5BMVA 4FFBA 3RYCA 4HNAB 1OFUA 2RHHA 1JFFA 3JASB 4TUYB 4X20A 5C8YA 5JCOC 3VO9A 4XCQA 3VOAA 1Z5VA 5EYPA 3M8KA 3VOBA 4O2AA 1Z5WA 4O4JA 1W5EA 5CB4A 5GONA 3R4VA 3JAKA 5CA0B 4B45A 3JAWA 4X1YB 4EB6A 4ZOLB 4O4LA 3RYIA 5KMGA 5CA1B 4ZHQB 3N2GA 4I4TB 3JARB 5JQGB 5LXTB 2VAPA 5EIBD 4X1IB 4I4TA 5KX5B 5LP6B 4O4IA 5EZYB 4YJ2A 1W59A 2Q1YA 3WGJA 5MN4A 5JH7B 4X1IA 5ITZB 5KX5A 3HKBB 3E22A 2RHOA 5BMVB 5JH7A 2VAMA 4FFBB
chains in the Genus database with same CATH superfamily
3S40A 4NCXA 4GVLA 1SZQA 1QM5A 3SJBA 3KLPX 1D4AA 3RTAA 2GAOA 4ZDKA 1QCZA 3WJAA 5JYEA 4RY9A 5JCZA 3S44A 1H23A 2QP4A 3LO8A 1Z5ZA 3WLEA 5A06A 3SC6A 2GUZA 3X2FA 3PGA1 4N7JA 5G4KA 1GLGA 1TYEB 4WNYA 3CNOA 4EWLA 3WRYA 1FRFS 1PWEA 2JJ2D 1A5TA 2O0LA 1LLDA 3PYMA 5IM4F 2UYNA 4JP5A 4TROA 1K3TA 2FY8A 4HQKA 1WXXA 6REQA 3Q0IA 4FHFA 2F3QA 4K6FA 3DD5A 1Y8ZA 1YE8A 3KZVA 4G1UC 5JMOA 1ZH6A 5JJLA 1FMCA 3DMGA 5CFMA 4QGHA 5JWHA 1Y42X 4UTXA 5E6UA 3KHUA 1QHTA 4J7JA 4KVAA 5A3QA 1JAZA 4AU1A 1I9GA 2AFIB 4DWOA 4ZYXA 3UHAA 2AT1A 5A62A 5SICE 4CM3A 4HP8A 1T43A 2UZ1A 3FNIA 2CKDA 1OA0A 3BH6A 3CCUF 3GPCA 3N8IA 1J7HA 4NESA 1DTOA 4G07A 5B2FA 2DT4A 4HUJA 4ZCTA 5COQA 2ZT5A 3Q1KA 1W5TA 3HKDA 1ZO8A 4BBZA 2YXBA 1W42A 1RLUA 2C77A 2WLJA 3FKJA 3NV7A 1Q6YA 5KAMA 1I0HA 4PICA 2BKUA 5DH9A 4YT5A 1AKQA 1QZXA 2WSSA 5CBGA 1CS4C 4Y7DA 2IIVA 2OAGA 2H8KA 5E0OA 2YINC 4CEIB 1NZJA 4XASA 3VPGA 3KEMA 1DZIA 3RYIA 3EIFA 4L50A 1RLTA 4AMUA 2XD9A 4C0AC 1IVNA 1Z2CA 2ADMA 3KZOA 1KI1A 4LF8O 2XCTB 1XYVA 3QYFA 4R1TA 3L79A 2QG9A 4AKTA 3DOFA 3C6ZA 1R88A 1HKHA 1Y1LA 5H82A 5E4FA 3SVTA 5KQMA 1DBFA 1RAEA 5J5CA 5FNZA 2ZSAA 3BH7A 2VYVD 2I78A 4BVBA 4M36A 1L8OA 3KX2A 3OE7A 4F6CA 4COKA 5C5CA 1XMVA 3BK1A 1TW3A 4P4GA 4TZ6A 3UYLA 4RIIA 3I9NA 4UNNA 4EG4A 1ULZA 3RGGA 3LVRE 4M1TA 2C0CA 2VH2A 2B4RO 1C8BA 1VI2A 1PSWA 2YXHA 1B6SA 5EIEA 1EXMA 1WU8A 3P2EA 5A4IS 3PVZA 4I36A 5AW2A 2GYVA 1Z8HA 3AEQB 4US0R 3IKFA 3GDFA 1S8FA 1IDOA 4WFAV 2F17A 2NADA 3NT2A 1PBNA 4URFA 4N3GA 3CXCF 1UK7A 2UUAO 5A4FS 1FRZA 1KI3A 3RE3A 4N5HX 2IP2A 3EN0A 3NBKA 2WEKA 1QJCA 1HURA 4X6UA 1MZEA 1ZD5A 4PVDA 1C8KA 3NTLA 5IKEA 3UMYA 4KO8A 5BSUA 4R50A 3GT4A 3QOYA 4LHEA 2FZEA 1SVUA 4ZVMA 4DXHA 1P2SA 4W7SA 1PV2A 5DULA 3UWOA 3DTVA 2P4UA 3ZJZA 1UDBA 3WFIA 3VJLA 2P8SA 4UXHA 4WJZA 3PIIA 5IFKA 2I7XA 4QDZA 2DE0X 1DPGA 3KR2A 3ZO8A 2R8PA 3RUPA 3L8ZA 2VRBA 4V2UA 4PZ0A 4W63A 4EB0A 4QFMA 4LY3A 4EENA 2Y76A 3J80A 4ZHYB 3V4VB 3ANLA 4OYLA 1E5LA 3PXDA 1Z5WA 4ZAZA 3ETGA 3BA8A 2EATA 4ABYA 4LSGA 3JVIA 3EQ9A 4ZQFA 4AAYA 1I10A 4BATA 3U9LA 2HU5A 2I8CA 3Q3VA 3T3IA 3LFHA 3W8DA 2L17A 4P7KA 3NZEA 3HEAA 3I2HA 1V8DA 3CNLA 1N2JA 2HFEC 1SM4A 2AD1A 1N7GA 4Q4HA 3S2YA 3EWIA 2XV1A 1LH0A 3ROFA 4CT4B 4ECAA 4KV7A 1X92A 3LQQA 4RTNA 2N74A 4BVEA 2C4HA 4HEA6 3PV0A 1DC6A 2HIGA 1U28C 4TYMA 4N48A 2I1VB 2ZBEA 3HCCA 4QT4A 1LPBB 3LYHA 5JZBA 3QUQA 2JFUA 1V6AA 2CXPA 4EX6A 3STHA 3WZLA 3I6QA 4PNPA 4ZEXA 5CB6A 4G37A 2QSJA 2I33A 2B9ZA 1F0YA 3U44B 3ZVNA 1LSUA 3OUZA 2CCJA 1YRAA 1RIIA 4DEYA 4TVBA 4CW7A 4RQBA 2G36A 4OX9Y 1Z62A 1YL6A 1PVOA 1AD2A 2AYYA 2QX7A 3ZK7A 1J2JA 1O57A 2O0MA 3CCRV 1E4YA 3VYWA 1DIHA 2V9ZA 3ZDBA 4UNQA 3MJCA 3BCUA 2J4DA 2KM1A 2CL5A 1A2BA 1PNQA 2J59A 2NV2B 1QIMA 3T12A 4UBOA 2WIDA 1CQPA 4YDHB 3ZHSA 1RWNA 4P33A 5IYZF 2G09A 2CZQA 3HDHA 3LGAA 2P5OA 3EVAA 3ON5A 3QHPA 3QKIA 2QJFA 2XHEA 2ZVDA 1B00A 1RQXA 2PT5A 2C7OA 2PNFA 1TZMA 4FZVA 2NXEA 4XDGA 4LEIA 4H6XA 2NO7A 2XUPA 4MWSA 3ELWA 1M1XB 5L3DA 3RW0A 1JLLB 4KAAA 1VQOV 1IHOA 3TLJA 4LNAA 1SS3A 3KOUA 2LCIA 2BFFB 2EBOA 4WZAA 3WIVA 1WF3A 3BM5A 1TCBA 3CKMA 4O2LA 3C3AA 3SFZA 3VR6H 1LJ8A 1NDUA 3HGQA 4QJ5A 1ZD8A 2W4MA 1MA0A 1IY9A 1BVUA 2V54A 4DIUA 4HNGA 4E7PA 2NTYC 2V9YA 4YALA 4NMHA 1E32A 1S72F 4PV7A 4JASA 1T6BY 1NU1H 3T3GA 1USWA 4D9FA 2DKOA 2RARA 3TQIA 4HDRB 3VUFA 4ZHQA 2DU8A 4U7FA 4W5WA 1E8DA 5A4MS 3LOPA 4JYZA 5JXGA 4JC4A 3IA2A 1KHHA 1U3VA 1EM8A 2V7TA 1YIOA 3IMCA 4QGAA 4TTQA 3WBKA 3THXA 1Q7YH 1IEWA 5ITZB 3M4ZA 3HKBB 2QR4A 1UC8A 1CXZA 2DEUA 1NOIA 2XB9A 3Q7SA 3ZIDA 3GXBA 4C4AA 3MCQA 3R8FA 3LBIA 4UTVA 4E2FA 2JFNA 3TS1A 1SETA 1VG0B 4FSHA 4B83A 5ECGC 3Q7IA 3MTGA 4EI7A 2C9YA 3OZSA 1XZGA 1TLTA 3OMIB 4MVYA 2FEKA 3N5KA 5DW0A 1FW6A 3UXHA 4WFIA 3RSFA 5AKXA 2J5KA 1MTOA 3DAHA 2ZTVA 1U31A 2KPOA 3NM4A 5LJLA 2PUVA 3KKZA 1UKCA 2X3YA 4RIEA 4CYMA 3MTAA 3CBGA 4P5PA 2OBMA 5F76A 5JFGA 4OI4A 2QM8A 3W3AH 3OZRA 4ZARA 3VPBA 3DE5X 1FP7A 5JWOA 3SYCA 4EHBA 4G0QA 3W4JA 2DR0A 2FSSA 3L41A 4JA2A 3RUIA 4BIOA 2XI4A 3WISA 3HEBA 3JWEA 1JEDA 3T7TA 3QTYA 1U4NA 4LNUB 2ISQA 1N0VC 4UZEA 1RP7A 1JI3A 2EX3A 4J4BA 2F23A 4BB5A 1LRLA 3ZHZA 4C20A 4JUFA 3R9WA 2J4FA 4X54A 1GQFA 3RS8A 2AJCA 3RSHA 1KMIZ 2BTQB 2FYTA 5CLFA 3ILXA 2VKTA 1A8UA 1REQA 4IJQA 4H7KA 3ZKAA 2AJ8A 1MRZA 1GPBA 3ZY4A 5HFAA 1GTG1 1XEFA 1FNJA 3KLOA 4M8KA 4EJ6A 5AVTA 1DG3A 3HB5X 3C1UA 2B7BA 3ZN1A 3F0EA 4AROA 5C3UA 4RD6A 2WLTA 1AG9A 5BT9A 1NQWA 1GEGA 3WYBA 3LYBA 4TKVB 3UXEA 1MSWD 3B52X 3AHHA 4KPFC 3UXYA 3ACDA 5J9PC 3GAAA 3C3XA 2IXEA 1DI0A 2R751 1T2DA 3GZNA 5BNFA 3WRWA 1NAHA 3CD6V 4RL4A 3PJSK 2K5UA 4Y9UA 4G9EA 3TNYA 4BO1A 4U3JA 3P2JA 4L72A 3TOVA 4PONA 4HQ6A 2HEIA 4B4KA 1N2GA 3NOQA 3ODGA 4P82A 3X43A 5K5EA 2AE2A 1OXUA 1CB0A 3GW8A 4CG2A 2IEBA 1GLNA 3ZN2A 2Q49A 3FDIA 5H0IA 1E7KA 4HLDA 3BQNB 5IBPA 1XTUA 5LIPA 1F7YA 3TI9A 4ALLA 4OKNA 3EA4A 2PEZA 4IYRA 3H2IA 1Z5GA 5E9AA 2H65A 1W5SA 4QQ8A 1U9CA 5A4KA 4GR9A 3GN2A 5G02A 1Q92A 2PHNA 1B43A 5FYDA 3KSZO 4KACA 2QA4F 1GG8A 4DDWA 3VZBA 2PO7A 1UXHA 2AIRA 4V0SA 4G5QA 4WBNF 4G0UA 1N5MA 3CC7V 1LI4A 2WPDA 4RHXA 4XIGS 3GJ8A 4FS3A 5J4LA 3T1QA 5JVDA 4E5UA 5ALPA 2KYRA 2IHNA 1QXSA 2VQSA 3ZWBA 1GCIA 3M81A 3AR8A 6Q21A 1P0FA 3SMVA 5FBRB 4G84A 4L73A 1B4DA 5J4HA 2FK7A 3OMXA 1T0KB 2YJ4A 4A3SA 4K3UA 4KITB 1GLVA 4PGAA 1H4VB 1KQFA 4BQSA 1VLLA 4PBSA 1UBOS 4G5SA 2E21A 1V1RA 1QUEA 4OI2A 4S12A 4KGDA 3ZJTA 3UN1A 1P6XA 3U4GA 1J20A 3MRTA 3V4OA 1PT5A 5G4LA 4I4TA 2SICE 1ND6A 3J7AC 3TQCA 1SGWA 4OU4A 4EW2A 4C4ZA 3HDVA 4HMPA 5A7HA 1NVAA 1U2RA 4MW9A 4ENTA 3AILA 1Q7YW 3FTNA 2O8DA 4J49A 4X8OA 1D4FA 4MV6A 3NHUA 3IUMA 4LF5O 3KUXA 2BRUA 2EZ8A 5GAPK 3WYNA 3CCVV 4J1TC 2MR5A 1J95A 2ODEA 4KO2S 3QE2A 1K0UA 3O73A 1YC2A 1GTRA 1V4VA 3DUFB 4JC8A 4MVOA 1YCDA 5IUJC 1QJ4A 4LX8A 2FTKE 1C7FA 1CZOA 3FHCB 3SPCA 3CO0S 1O8CA 4Q34A 2HJHA 1RAGA 1AM4D 1NMXA 3TR6A 3LV8A 1Z0KA 3TCNA 4D9JA 2IE8A 2OAP1 2DH6A 3V4FA 3QVXA 3FYSA 1EVIA 3W2HA 4O08A 3EVTA 2C4WA 1UIMA 4EVRA 5LLTA 1HT0A 2YZNA 1X7XB 4KIFA 4FOOA 1VSTA 4ZVNA 2WE8A 3VMMA 5A2QA 3GJRA 2P5SA 1YMQA 2HQSC 5A0FA 4PA6A 3IQDB 3LOQA 3CHYA 4YP0A 4ZT2A 1GNQA 2W2XA 3HTXA 3H2KA 5IZCC 1Q50A 2AJDA 1VG8A 4MB2A 1JIUA 1KVUA 3MD9A 2AV6A 4BO4A 5AI9A 3VTAA 1RBYA 3T4ZA 1J0XO 1QVGU 2FWBA 3R7WB 2IV2X 1RRCA 2UUBB 3TGPA 4IXMA 3HJNA 4WXMA 3GJ5A 1PAUA 3GUCA 2VJPA 1VCHA 3FGZA 2WINI 3F3SA 4TMTA 5L3SA 1F6WA 3QVGA 5G0WA 2C5SA 4C0SA 1V8ZA 1UWLA 1JJFA 1WCIB 1XTSA 3K20A 2P9JA 4FGUA 2Z57A 2Q5FA 5GW7A 1P3JA 5GTIZ 3LHDA 4K2HA 3QLEA 2J31A 5G0TA 3NNNA 5JJCA 5CLGA 2CJFA 1XEAA 1PS8A 3QF7A 2TYSB 1X1SA 4I9WA 3MGBA 3U40A 4NTYA 5KZMB 1DG1G 3AI7A 4YQYA 3WK9A 1T2FA 3LAWA 3JAWB 2B37A 1QQ6A 3LC2O 5HZHA 3UVEA 1IX9A 1T0PA 3KLNA 1IY1A 4MKRA 4M1SA 1DSSG 4M9RA 2IPNA 2XQVA 5FADA 3OICA 5KTSA 1PUJA 4AFNA 2D1SA 3V4SA 1C30A 2XSZA 1YRQA 2P3OA 3S4YA 2DYSB 1OHHA 1YVPA 4KV9A 2H08A 2JCBA 1RDFA 3STVA 2Q4DA 4CKCA 4AJKA 3AG6A 1EHYA 3TCKA 2XF2A 1XV2A 4QPJA 5DX1A 2VTBA 2GNOA 2I9PA 4B34A 5AW1A 2Q2OA 4B3CA 1S76D 1N0IA 2Y8EA 2YYYA 2BAGA 4YP1A 1A2QA 1ZVMA 3IR5A 4OP3A 1U40A 4AJOA 4M7OA 3LPAA 1GTOA 1ZSPA 4LJ7A 2FQQA 5C31A 2ES4A 3O31A 3FNRA 5CTJA 1G9SA 4TTPA 1RBZA 1A9PA 1LI7A 1N32B 2PIAA 1MU0A 2ZE6A 4QQRA 5DCYA 4C0WA 1IY0A 2D0PB 3S70A 3AKDA 1IHPA 2CSLA 3VU9B 3SS8A 4BEWA 3SLKA 4F7WA 1N6LA 1MIOA 2VTKA 2X8JA 3S29A 1I6LA 2NPOA 1TAUA 3RLFA 3RNOA 1QP7A 4IIJB 2NV6A 2CVLA 3FKQA 1AK1A 5ALOA 3NBYC 1YQWA 3USZA 1OJ7A 4ZT6A 1KZYC 1AZTA 2JAQA 2XNDG 2VHZA 2A59A 1LNSA 4DT1B 5KQPA 1C3XA 2XIQA 4GWLA 1FUEA 4D81A 3IGFA 1VOTA 1JKJA 4IUBS 2XZLA 4WLNA 3ADPA 3GLFB 3TD9A 1X1RA 4PO9A 4YRAA 2ZR0A 4DV6B 2RGWA 1QKJA 1ZVQA 3HRIA 3ZNNA 3LP6A 5C4MA 2Y1KA 1QVVA 1VZ2A 3MPOA 3FWYA 3R74A 4BZZA 3AVUA 1V45E 3DYVA 4JAAA 2EZTA 4F6LA 5EC2C 4UVHA 2ZUTA 3GPLA 2Z58A 2RAFA 4ZO4A 3NM6B 3E8HA 3H1PA 2YASA 4HX9A 1PD0A 4QYMA 2JVKA 3BSWA 1PZHA 1YFKA 3FPHA 5JDCC 3AO0B 5IT0A 1KJ9A 4LOKA 1T15A 1V7CA 4KIJA 1Q0RA 4JGBA 3I32A 4IEEA 2I2WA 1RYBA 4ERHA 1XKTA 3BE8A 2GEJA 2WU0A 3T3OA 4L27A 1GRVA 3ZZMA 3VISA 1GGEA 5K0CA 3R9KA 2Y1DA 2W43A 4FILA 2OZLB 2FXIA 2GX6A 4J43A 3JPYA 2PEYA 3CUSA 1QIGA 1SIUA 4KIWA 1R5BA 3TZLA 1O96B 4AXXA 2Q27A 3R7LA 1RW4A 4FFNA 1PJ3A 4LRSB 3ZRXA 5C4IA 3L7NA 1V9LA 1Z0UA 3EUFA 1D1QA 2ZUFA 3TNLA 5FULA 5LUBA 4B1FA 5BNZA 1VMDA 2WYWA 1DDIA 1Y98A 1YU9A 1QTQA 4UCRA 4LYYA 5SV2A 1QYDA 2PIDA 2QWNB 2IQQA 4GGPA 5AXDA 4WCFB 2Y27A 4MVJH 4D7SA 3FSEA 3PENA 4EQ6A 1FE8A 2FLVA 4FLWA 1Y6QA 5HY2A 4BO5A 4HBGA 3TOXA 3HR8A 4G6ZA 1K06A 1AI6A 1H9BA 3N0RA 3NP7A 5E1AC 2VPWA 2QTRA 1UBLS 3LPLA 3KPUA 4BGVA 1Z5PA 4CIVA 3A7EA 3HYNA 3SWWA 4KXMA 4A73A 3N6XA 4OQQA 3GH1A 1DX4A 3FCXA 4M99A 3SYQA 4UBNA 5AM2A 1E6KA 1FNCA 3TB6A 3QNUA 4ZALA 3OEYA 4DREA 3E35A 2A86A 4W4LA 2XNDD 3DZCA 2B9VA 2ZDHA 5M34A 3H17A 1UC9A 3B5IA 1KBOA 5FHRA 2HK9A 4BRSA 3HCFA 2O06A 5A7GA 3L0PA 4NJMB 2RGNC 1TAEA 1TGVA 4RQFA 1G2QA 2QRUA 1DTSA 5DGTA 3T3PB 2NZ2A 4C08A 1KO8A 1SK9A 3D6FA 3G23A 4JAVA 2E5FA 2W11A 3O8OA 5C8YA 4B3MO 4IKEA 2QQGA 4GKVA 2F8TA 4IXDA 4WZBA 1QLJA 2DJVA 2QVXX 2ORWA 1Y48E 5I45A 2FP4A 2GJAA 2WV9A 4PZPA 1GPJA 3A1UA 4MARA 1ULTA 2ZSEA 3WOHA 1MEOA 1EUYA 1VE7A 1NF3A 1OIVA 4IJMA 4YYZA 2PTGA 5DBOA 5LZ7A 3JQRA 5I7VA 3HDYA 1KUQA 1CHDA 1N2EA 2KQUA 3CE9A 3FPKA 4YO7A 2E4VA 4WDRA 2GTSA 1F2TA 2DB3A 2CZCA 5EQFA 5K8UA 3W2EA 1KQGA 1SIBE 4GZMA 2PK3A 1Z5OA 3DLPX 4MHSA 2O1XA 3GB9A 1H9CA 3U9TA 3KFVA 2JD2A 2QKYA 3WB0A 2YH2A 3IUNA 1SXJB 3OM9A 2ZXWC 1ODEA 2QTWB 2Q5EA 2L6LA 3EDCA 4J42A 1XCPA 1L4KA 2K1SA 2DCUA 4UAGA 1J8DA 3KZIZ 2P40A 5CBPA 2J5QA 4I99A 3QBJA 4DV2B 4M8NE 2IDMA 3H87A 3VX3A 4MQ6A 1F0PA 5AVVA 5K0TA 1U6IA 2OCLA 1L6IA 1K27A 1ZUNB 1T4DA 2R44A 3ECSA 2PLNA 1YS2X 1AUVA 3AHCA 3GFBA 3U0VA 1AXRA 1ESMA 4PN3A 3DR3A 1VLHA 4LVCA 3D59A 3AGKA 4LSMA 4OQ4A 1MT0A 5JSUA 5HJ2A 3VU8A 3AONB 5TPZD 3CKKA 2WKQA 4MAFA 3DOHA 4Z0HO 1ISMA 2CV1A 4AT1A 3M49A 2Q0QA 4TS1A 2B0JA 1QCYA 4PRZA 1YJXA 1HDJA 1SVKA 3O1JC 4RY2A 1HF3A 4BPBA 3FCEA 1JQEA 3UFXB 1CR2A 4W7HA 1GM7A 3IV6A 4WIAA 4MTGA 4HNAB 2RMKA 1H22A 3CZRA 4RK4A 4XVCA 4B45A 1P2BA 1G6KA 2POCA 1KJ8A 3C8UA 3B2EE 3NAGA 2UUBO 3HFJA 3N8KA 4UAUA 3BS4A 2LKDA 2WJ4A 3TIVA 3SPIA 4MQEA 1WOMA 2AW9A 5DGDA 5DHFA 2XMBA 4L76A 3JQGA 2PUJA 3K9NA 1SHUX 1F23A 3JCZA 5B8FA 5PGMA 4N0MA 2BP7A 5AMXA 2H2DA 2RIPA 5K09A 5LIRA 4YJFA 2WF8A 3QKRB 3KTFA 2O07A 3L6OO 4CM4A 1QWSA 1KVRA 2JFVA 1DRJA 4OMUA 2AMLA 2BDTA 4MVJI 4TSKA 1JSCA 3RUAA 4FGSA 4EATA 4U9HS 2XVAA 5EZ6B 4FFRA 1ENZA 3PSHA 5DXFA 3HRHA 2H00A 2WJ3A 3PUJA 5A2GA 4F3NA 4FGJA 1QKIA 3UG6A 3IOMA 4BQRA 1UEXC 3FMFA 1K8AH 1AUQA 2FEPA 4I1PA 3H2JA 3HB4X 3S2ZA 4WLOA 2W8BA 1B06A 1TK3A 3OFNA 5J1SB 3PZBA 4XX0B 1E9EA 3L4EA 3TRIA 3C3PA 4V0KA 4A8HA 3BT7A 1R1BA 4YRNA 1YASA 3F1LA 1KK0A 3PFHA 2P9FA 2CNDA 2XX3A 1XRRA 3FFTA 5THXA 2ZD9A 1E1DA 1X42A 2CMHA 3WTBA 2OHJA 4J0JA 3BMCA 3THYA 2ZE5A 2UV8A 2FUG6 1O94C 4MO9A 4DA0A 3KYDA 1FDUA 3GEGA 5G40A 1FX0A 4KL8S 3K8YA 2F43B 4OQLA 2I3DA 2GJKA 2QEXV 1JHVA 4HWKA 1PNTA 1I80A 1UM9A 3AP1A 1Z5VA 4QU5A 2B2NA 3PTAA 3L1VA 1KY4A 4D4IA 1L0NH 3AVOA 1VC2A 4UTRA 3JR7A 2I29A 4R1QA 2AQIA 5BUCA 4JBLA 2W5UA 4WWHA 2EG5A 3OCJA 3QPDA 5IABA 5FUXA 3R41A 2CGOA 1HLFA 4Y1RB 4MUJA 2BFPA 3EODA 3QPVA 1OUMA 5K9ZA 3EUEA 5ALKA 1E2DA 4J0FA 3WADA 4IL6Z 3OX2A 1FNKA 1D0VA 4NTWA 2G72A 3K7EA 4DJAA 4JI8O 1ESDA 4TKMA 3EISA 2BKAA 1UZUA 2O8BB 4DCPA 1KFEB 4DV6O 2MYTA 3A9WA 4UUNA 5K8CA 1N9GA 3WIDA 2J87A 4JK3A 3BB1A 1F3LA 4I50B 4JOSA 2CXOA 4URHA 2C9DA 1NP6A 3Q2KA 4YJHA 3H5AA 1IZ3A 2H1VA 2REBA 3P0JA 1Y67A 1JR3A 5KVAA 1U2SA 1TT5B 1H1TA 4F2GA 1O5IA 3A0HZ 3CUUA 1DC8A 2F93B 1BQ4A 3I30X 3Q7QA 1CZUA 2UKDA 5D85A 4RKRA 5L3CA 3EIWA 4YXWG 5EE3A 3G49A 5BO5A 1P7YA 1WQ1R 2PYLA 1Q5PA 1KEUA 4ID9A 2R87A 5EMMA 1PUXA 1VCIA 1PLKA 2WHXA 3WNQA 4JNCA 1J97A 1OF1A 2HIHA 5M7EA 3REFA 3JQQA 2B1IA 1R0BA 1SXHA 2E75B 1WDLA 4MS4A 2C54A 2QI2A 1XA4A 5LKRA 2BLLA 1NIPA 1PDOA 4GBED 4GPD1 4TYPA 3A1CA 1PZMA 4NBLA 4NI5A 3QELA 3T7RA 1P4HA 3TQSA 2VHEA 3RJ5A 3OUTA 5BUSA 4Q93A 1EVLA 2JKVA 1RSOA 3QIVA 1OBCA 1DXOA 5CCEA 3GV0A 5KJCA 3C6BA 4AF7A 3BDVA 3VO2A 2DBYA 3CTPA 2HCFA 4FFPA 1NZDA 1KA9H 3RFXA 4MW5A 3P8ZA 5F33A 2Z1NA 3WSVA 1E3SA 3KPWA 4CL8A 2PYIA 2Z5FA 1FBNA 4KX5A 5HIJA 1MGOA 3LC0A 4MQ4A 4Z1MD 2BFDA 4LG1A 3PFFA 3C9TA 2Q29A 2YXEA 2TSYB 3F3YA 3I9FA 3U60B 1PK9A 4X9QA 1N2CA 4BECA 3KAQA 1XQ9A 4DE5A 1PYDA 3T1CA 1D2GA 4A1FA 3I2GA 5BSRA 5B1BC 3JYQA 2XB4A 3CUTA 3O84A 5I4BA 5CK5A 2HRZA 4BP8A 2VGMA 2Y1WA 4DADA 1OV6A 1HW7A 5JCOA 3THRA 3IJEB 3LX4A 1QRDA 2QMUA 5IHXA 5HY4A 1NULA 3IAFA 5CP8A 1PZEA 4G4JA 4HAOA 4R2WA 4B3JA 1AI7A 2WSBA 4MJLA 1G41A 1KI4A 1I6KA 4I1IA 1TEHA 2BEVA 2OBLA 3BX1A 3AG2B 1JG4A 2CEKA 2HMAA 3TUIC 5E4YA 2K7ZA 2AG1A 5LVAA 3GJZA 4PW0A 3QG5A 3Q5GA 3EFOB 1L8LA 1NZ6A 1T2UA 3GJYA 4L0DA 5G0UA 1JHPA 3THWA 1G20A 2B6HA 2P7TC 2GNAA 4XVRA 3LUKA 4IY1A 4JHXA 2W6IA 4CMHA 4HB2A 1K8AW 5ELXA 3MTEA 1V16B 4LYDA 1ZCJA 4IGAA 1W2HA 1PD1A 2I99A 2XNKA 2QVZX 5CW2A 3OX3A 4IVQA 1LF0A 4RC9A 2FXVA 4R16A 1UMBB 2XUQA 3HBLA 3VNVA 3MVEA 2ZM5A 1FP6A 1OFHA 5FBQB 3Q9SA 2OV1A 2KW5A 1HEYA 4YXWD 4C7XA 5TMPA 1U9JA 3QVVA 2HLDA 5CFNA 4I50F 3ND7A 3QPUA 3IVGA 1SCUB 1AP5A 4BCBA 4EKYA 2IHTA 1PJZA 1W36C 1SBYA 3RARA 1Y6ZA 3D2AA 1QR6A 3Q4HB 3BRWA 4GEGA 3HM2A 4FW8A 1M6EX 4BQOA 4JXZA 1HP8A 1HRDA 4FGZA 1NMEA 1LTHR 4FW9A 4GFDA 3G5UA 2VPXA 4GM1A 1NI8A 3Q5EA 1ZJWA 2VUHB 1BHBA 4R7ZA 3IEPA 1FXKA 5LKAA 1FLAA 1NM5A 2PSSA 4ZVLA 4ZAXA 1NV9A 4R7TA 3ZWAA 1SFRA 4MWZA 1PR2A 3H99A 1NXXA 1R6AA 4KI0A 4CTNA 2J3HA 4IRUB 1DVRA 1VDMA 5CM9C 1P4GA 2J0UB 3W5UA 1E8NA 3NUQA 1ZC3A 4CDGA 3CMEF 2YJ3A 3RIGA 3JCUZ 3LC1O 3OD5A 4X6XA 2MQEA 3EZ2A 1G4AE 5IX8A 4DV2O 1A4UA 4Q4LA 1ODIA 4G1CA 1I4OA 3HXTA 1YNSA 3D4BA 2EIKB 3CNNA 5EXEA 4DA7A 4IPTA 2OENG 4EVSA 1MNQA 4XIYA 3MSCA 1E92A 3PDJA 3M8KA 2D0OB 2AJLI 4L6AA 4M9QA 4X1YB 5HIKA 4O29A 4L2IB 4ZO6A 2IUFA 3RSOA 3LF1A 2ZRDA 3HBMA 1LWOA 1V5GA 2PMPA 1ABEA 4QVKA 2OBBA 5IT4A 2QE6A 2W00A 4UBIA 1X3LA 4FXPA 2YI8A 5AKKA 4L8YA 4XDKA 1FSZA 1JDBB 1SUFA 1T9ZA 5LGNA 5JY6A 2YWEA 2WIJA 4Q05A 4DNFA 3AUSA 1AF4A 2IH5A 3H5NA 4XCXA 1ID8A 1U1IA 4MGYR 4HD8A 3ZWCA 2EJTA 1OV4A 4MDHA 2Q62A 3BMOA 3JS5A 2WHPB 3X1XA 3OHSX 5A5FA 1YRWA 5L6LB 3X2EA 1H5QA 5B3JC 3NHJA 4I7EA 1ZIXA 3LUHA 1K5HA 3F5FA 4ND8B 1WETA 1AA9A 4YAFA 3KR9A 1Q6HA 2IW5A 4B7KA 3AJAA 5CLHA 1N2OA 4OJKA 4BFUA 5DM70 3E89A 3AJDA 3C7CB 1VJTA 3UJ9A 4HFJA 2BE9A 2F8SA 4NZNA 5KHHA 4HDKA 3PC7A 2ZSBA 2CL0X 2VXCA 3JAMM 2CTQA 3KUDA 2FPGB 2G7ZA 1DEXA 5LYJB 3CYPB 4JNKA 3IC7A 2FGJA 3ON1A 1P1KA 3QG1A 2XMCA 3AUYA 3RJTA 5DSXA 1P4JA 1CQZA 1SMKA 1W0JA 3RHFA 1X25A 5JTTA 5C80A 1HH4A 1KMQA 4CTKA 4ARZB 1BOFA 2CXRA 4KR0A 2A5FA 3DE3X 1E1CB 3JQEA 5EHQA 2O1SA 3SLGA 3OLCX 4MS1B 2QI9F 2RHTA 3RVQA 4E15A 3RF7A 4LOAA 1V3QE 1Y8RA 5LP6F 1JZTA 3S3TA 2R7KA 3WQQA 1F17A 4BB6A 2DBRA 5F23A 1AV7A 1WJZA 5DJ5A 1KMIY 1YHQF 3CXRA 4FNMA 5CGZA 1DBQA 4NU5A 3U11A 5FOQA 5ALVA 1WSDA 5ED0A 1JSXA 2ODTX 1M66A 2GCIA 3U13A 3E86A 1WUKS 1U9YA 3HBFA 1USVA 3AHDA 3UGKA 1W88B 5TPWB 2N9UA 4Q18A 4LFAO 3VR6D 1R16A 3ML1A 3LPNA 3ZGYA 2UU9O 4UCFA 4UEKA 4X64O 4DEVA 4ZWNA 2R68A 4UJ5A 4B73A 2HVJC 1L4FA 5DT2A 1P0MA 3K0EA 1T8SA 2P22C 4QXPA 1QC5B 3G2QA 3FROA 3BL5A 1YJNV 3LM8A 4LMPA 1GZ7A 2WT4A 3I01M 4RY8A 3K06A 2CMKA 3NC1C 1XDDA 1P9OA 2FR1A 4S35A 4ER6A 1J5XA 1ONSA 2MSEB 3O2JA 3KB2A 5AVWA 3NUGA 3QEKA 3FUCA 5DM1A 3W2GA 1Y6GA 2ISCA 1VIDA 4U6QA 1BMDA 4IO0A 1WHSA 5EZYB 1K4YA 4RPHA 3AVQA 3I3SR 1XEWX 1HR0B 2GXQA 2XA1A 4DLAA 3HO8A 1SG0A 1GU0A 3E2IA 3U7RA 4W99A 4BQPA 5IVPA 3SIWA 3SQXA 1K3FA 4U2CA 1ZVJA 2BMVA 4C87A 3LVQE 2XDYA 3ZDCA 2HQ1A 3EZXA 1WG8A 4BRZA 1CNEA 2CLOB 2B0CA 2X1LA 1GM5A 3MWJA 1HX7A 3NYWA 3GPIA 2BSQA 4JVSB 2WJGA 1YJ9V 2OO7A 4E14A 4C81A 1CRWG 4PQFA 1XD9A 3OKFA 3KHKA 5THKA 4RTRA 4A92A 1SOAA 1DV1A 4JT4A 3O2QB 1YBHA 3N0VA 1SEPA 2ZAMA 2HMTA 2AOTA 2CK3G 1YZHA 4TUYB 4RK7A 1QX3A 2CUTA 2JG3A 1NFQA 2XE6A 1KI6B 1OMOA 3EVGA 4BMYA 2DFLA 2ICAA 4CM8A 5CT5A 5U1PA 1ADJA 1BDHA 2OCCC 4BVGA 1H1LA 1V1MA 2R1TB 3W3AD 3A6LA 4OU5A 4NZZA 3CH4B 2EYQA 2OM6A 1DDOA 3UT0A 2YXDA 1XKLA 3IAAA 1UM8A 3C3JA 4RAOA 1UMKA 3URKA 4V24A 1X1TA 4R2IA 3CGGA 4QXOA 1E9VA 4GX1A 3A1WA 1VQLV 4ENVA 1E5QA 1C50A 3RDPA 1VE3A 4PZAA 3QY0A 2A2ZA 2HVYD 4MUHA 1X13A 5B37A 5ALWA 2FFBA 5CVVA 1YB1A 1Z3IX 4YWJA 4YGYA 4RTMA 3FMGA 1QRSA 3O8QB 2DTDA 3SE7A 1QG2A 2QLFA 4CG0A 1EWQA 3QLVC 1JG2A 5HP8A 3P45A 1DEAA 2IXAA 1SKMA 3C6KA 5KNDH 3OQ6A 4FDAA 3U1TA 5AW8A 1B93A 4ONEA 4NOKA 1MB3A 4Z7OB 4DG9A 1BX1A 3HWUA 3BMNB 3ZE2B 1ZSYA 4BRWA 1Y82A 3CRRA 4JVMA 2NO0A 1P1HA 421PA 4WERA 3IXQA 2UXDO 2PS1A 5JATA 4XLZA 2J3MA 1IN7A 1FK8A 2QL5A 2Y92A 4MUNA 5DLPA 4HDQB 1GV1A 3AL3A 4FHCA 5FORA 5K3SA 1Z0SA 4FU0A 3D7MA 2PKXA 1Z8NA 5B58T 1SCJA 2VN8A 4RGBA 2II6A 5KYWA 3SX0A 1FW8A 1X0VA 4K9RA 5AKYA 2AUMA 1M0SA 2BFAA 1KR5A 1P0CA 4I2VA 4J0KA 4AN4A 1UPXA 1ISJA 1RXYA 4EZBA 5IXJA 1HNNA 2I3GA 4YUYA 4BX9A 3K30A 1PN3A 1RTTA 2H4WA 1GA6A 4TVKA 4RMNA 4CS3A 2J9XB 3DMTC 3QFRA 3LY8A 1CB7A 3QHQA 3D3EA 3RIYA 5AVJA 1DBIA 3D0QA 3SYTA 3GFGA 3TO5A 4ZCRA 1Q91A 3L0CA 3ZWWA 4UFNA 4JEHA 3W1WA 5BUQA 2H2WA 2AKAB 3DS8A 1BDJA 4CHTA 2OUKA 4D3XA 3RSGA 4ZV9A 3E3NA 3OO0A 2WUWE 2RN9A 4JD5A 4RV4A 3WGTA 2JD0A 1V7PC 1ZJ6A 4DLBA 1VL2A 1NU8A 2GPTA 3SYPA 4JIGA 2CK3D 1LDEA 3EPLA 2HB6A 3IOBA 1AR5A 3GLTA 5C1OA 1IZZA 5IANA 2PXCA 2PJDA 4O33A 2HRBA 1JQKA 4R3UC 4PZEA 2ZJ7A 5F3WB 1GKYA 2A14A 5FA8A 4J8PA 3WLKX 3SKYA 5FOTA 1MC1A 4V3BA 5BWBA 4MPDA 3LKBA 1L6RA 1COZA 2GKSA 1JNXX 4RUEA 2OFXA 2ZAYA 1UPGA 2JCVA 4GKAA 1OTXA 5EPOA 5DNCA 5CLIA 5LZ9A 3A1FA 2G25A 5F77A 5BR8B 5BMVB 2J3EA 2J41A 1TMGE 1QLWA 1Z0IA 2R84A 1T1GA 3H1GA 4P83A 4YGXB 4I8IA 1MAWA 4YRZA 1AGYA 4DLKA 2XHBA 3WGNA 2O48X 4JVNA 3G6KA 1XTJA 3GLIB 5ALGA 4GXNA 3QEOA 4KWCA 3PEYA 5F35A 1E3DA 3DQZA 4PQGA 2WJYA 4W8OA 3U09A 2ZP1A 4PSCA 1I30A 2HS0A 5HIAA 2ON6A 1B0AA 4CLOB 3IUSA 2VK8A 1C3JA 3EGEA 3TLAA 3VYTC 4I4NA 1MEJA 1UBGA 1KYIA 4OOFA 4R41A 4KR2A 4BNYA 4CF3A 1J1ZA 1NQTA 4YFYA 2FZGA 3C6XA 3O21A 3ORFA 3NRBA 3ZE0B 1MRNA 2JAWA 1SVSA 4Y2GA 3K58A 1GAWA 5FNVA 3OPXA 4UU1A 5EJ2A 3PDWA 4ICIA 1X1AA 2W2LA 1U0OC 2REXB 3N53A 4Z6KA 5C1PA 4OCZA 1W30A 3WWPA 4O2RA 3HDJA 2KHZA 3BHJA 1QHFA 1MEEA 2FQ1A 1BROA 4HLCA 2LBTA 5JWPA 3ROEA 4FE7A 1VIYA 4F5EA 2DQ4A 5LPNA 3UM7A 4ZZ0A 3G2MA 4HZIA 3RKRA 4LC9A 1CHNA 2QD4A 4NECA 1Y8QB 3LCUA 3NYIA 1E1QA 1A88A 4D0LB 4TXNA 1QRAA 4X94A 3THSA 4OPAA 2F9ZC 3JD1A 4BVQA 2G1JA 3W04A 4LYAA 1TQ2A 3ILYA 1QD9A 2CHUA 1SBTA 2XF8A 4TRNA 1G38A 2IL1A 3NDIA 4DCNA 3AFMA 1C3OA 3MMPA 3ESBA 1T9AA 4D9EA 4XCQA 1T8WA 2HX0A 3I1JA 1YQQA 5C35A 4MHTA 2FMKA 3SICE 1TQ4A 4R1LA 4GL4A 4HAMA 4B6EA 2I3ZA 4NNJA 2ORYA 4TSFG 4JR1A 3BL6A 2Z1FA 3TQFA 4ZRMA 5BW8A 2V7BA 1S3GA 5ECYA 5HFJA 1JU9A 4OV6B 3ZH9B 1U0LA 3X2QB 1QDLB 4PD4F 1OI7A 2ZTMA 4EHDA 2GPBA 1KQOA 2W2KA 5ANRB 4FJ2A 2OG2A 4RX1A 4WLVA 2GKGA 1OLSA 3CW8X 2CSXA 3B3FA 2Y0DA 3TPCA 4ZP1A 4OD0A 1EFCA 2Z04A 2X5XA 1MP0A 1CN7A 1YVRA 2LP4Y 3WRXA 1JEQB 2I55A 4HC4A 2I65A 2XAJA 3IA7A 4II2A 4WRRA 2COEA 4UNPA 3TIFA 1UFKA 3FFWA 2QQEA 4NDNE 3H1HH 4CIDA 4BQEA 3DMFA 2ZBVA 5K4AA 3LRXA 1SELA 3W6UA 2EULA 5JW6A 1C9DB 3NKVA 2UXBB 4QXRA 3K9LA 2DHQA 2F1RA 5HSGA 3SMQA 1PL0A 3TZEA 2Z2JA 3GYQA 1Z6PA 2YW9A 4MYSA 4MVJG 3UV7A 2Q7EA 1VQMF 1J5PA 1ONNA 3D8BA 1THMA 2CB9A 2JGJA 3NPAA 1NYRA 2VDQB 1ZMXA 3UCEA 3JR3A 1IN1A 2QRJA 1S2MA 3HUEA 1KSHA 3CRZA 1JFRA 1L5OA 2NU7A 4RTQA 5CJ2A 3WWCA 1IQ0A 3GQVA 4MAAA 1U2ZA 2EJCA 3C7KA 3U48A 1M1NA 3WKCA 3CVVA 2PTHA 3BIFA 2QVBA 2Q3CA 2XKAA 2H9AA 1ULAA 3N0WA 4AD8A 1RWBA 4ERNA 3TR5A 4RA6B 1XZ8A 3C1OA 3QUCA 4PTYA 3N8GA 3SKVA 4JZ2A 1EBOA 2YJ5A 3HDQA 5TF4A 5IM4A 2JJ2A 4NSNA 2IJHA 3PXCX 1GTL1 1ODKA 3GN1A 1E94E 1JR2A 3FHLA 2Q9BA 2P9BA 3FI0A 1YIAA 1NNEA 1MV8A 4IILA 4I1VA 1TO1E 4BCDA 1NYLA 4UVIA 4HB0A 2CUGA 5A4DA 4TRJA 4EY8A 1OXSC 3FUVA 2VJCA 2X2EA 3KQUA 4HMOA 4PPGA 5F9HA 1A8HA 4BY9D 5GGYA 1A5AB 2XDWA 1DWPA 4Q00A 1UPBA 3ZGVA 4QXQA 1FFYA 3STLC 4CMEA 4FFKA 4ISCA 4NRDA 1DCKA 3R3JA 2Q9AA 2HA6A 3HY6A 3I0MA 2VHTA 4GMDA 4J7KA 4RDXA 3DXFA 5SZIA 1T13A 5D87A 1DS6A 1Z7YA 2XB2A 1CJSA 1AOXA 2OYQA 4B6PA 1IIRA 5A5DA 3N2KA 1SVOA 3DLBA 4XDLA 5KC9A 2A1TR 2C3PA 2YRFA 5EBLC 1YACA 4YN3A 2GT1A 3EH2A 3RHSA 2Y2UA 3AUKA 1ESCA 1X7YB 4AQ7A 5CCBA 3WXMB 3GC6A 1PWXA 2XLCA 5KOHB 1ONIA 4C4RA 3LDFA 4H7JA 5EGSA 2B20A 3ED5A 4DMMA 4KQ9A 5D51S 5ICFA 1NI3A 1V9CA 3E9NA 4K6OA 2OGSA 3VYUB 2WVGA 1Q3TA 1X7DA 4UCSA 2J5BA 5LBIA 2WTXA 3EZLA 1KJWA 1XQ6A 2QLJA 3K8QA 4C01A 4MINA 2FWRA 1MF7A 4MR9B 1E1RG 1SQBH 2JGIA 3MBIA 1BCSB 4QHYA 3EQ7A 4NJEB 4JPRA 2IITA 1AKRA 1UC4B 2BM9A 3E27A 5FTKA 3DSQA 4M21A 1NATA 1OWOA 3RS9A 2FUEA 3D81A 2NVUA 1DKOA 2FMIA 4O3FA 2RB4A 1WZEA 2VYVA 3W2FA 2VOJA 5EMNA 5IASA 2CBXA 4MVJD 1RWPA 1FQKA 1EK1A 1YR8A 4MVJF 1FQOA 1MAUA 1ZA2A 4CT0A 1MMFB 4FNOA 2KMLA 4B9EA 1JQLB 5KAIZ 3R6GA 4DLPA 2BOCC 3MYRA 4BFYA 1Q19A 2JIDA 4UCUA 4E4EA 1E7YA 4KN5A 3U5TA 1BQ3A 5K05A 4H15A 5LDHA 2P0AA 4EGFA 1R6NA 1OOEA 4EMSA 4NONA 4RK5A 3TRJA 3VC2A 3OT1B 4OQDA 3CURA 2FDRA 1H3EA 3I04M 1QH9A 2JCYA 2XAGA 1SU6A 4TQFA 4Q3LA 3WGMA 1FSSA 5JMPA 4RVSA 5JMTA 3K04A 1VXOA 3AB8A 2SHKA 4NX2A 2WTMA 1PNOA 4G86A 3S1AA 3TTUA 4PCLA 2VDKB 5C7OO 3SJBC 2P41A 5IT5A 3KKPA 2EZOA 5BVHA 1NW4A 1IY8A 2AUTA 1AQJA 1JHAA 3GIDA 1QMGA 3SYOA 2Q2WA 5FPRA 1NMQA 1LSOA 1S3SA 4MZXA 3LT5A 4EGQA 3D7NA 4MCAA 1K8QA 3CT6A 4O02B 3QVJA 4YS6A 4E2LA 1ZW6A 2FEXA 3WRYC 2FPXA 5DYNA 5HGJA 1KU6A 2GXSA 2CAZC 3SBXA 4N3CA 3C15C 4MUAA 1XKQA 2QXTA 3NHFA 1K2VN 3M6FA 4TSRA 5A05A 5FWAA 1VLVA 3ESCA 4YDRA 3RU3A 1X1QA 4O63O 1MBZA 1G8FA 3EB9A 4GI3A 1IHUA 3N7TA 1M83A 4UVEA 2XMSA 2V7VA 3N74A 2RK6A 2JGUA 4LJSA 2YJGA 2BSXA 4LE0A 4JODA 3UCFA 3JQ9A 4HWGA 2QUAA 1PFUA 1Z34A 4F2HA 1L4LA 2Y69C 2AZ2A 3TAHA 4KFRA 4P0PB 4LY9A 1E1RD 3L40A 1QQ5A 2GYUA 5ESXA 5I9MA 1AJPA 2FN4A 4ZEOA 4BLPA 5CNIA 1W4BA 2GEFA 5FLXA 2LWIA 4L9WA 4AUMA 3OTWA 4RK6A 2H5IA 2FMTA 4RZUA 3EVCA 2GFHA 5B1HA 1GA1A 2O8EA 3LNCA 5F7JA 2NVOA 3MUFA 1G3UA 2GZAA 4ZQIA 3OBBA 5J4YA 2FW7A 2WD7B 3SQNA 3RS2A 3F9CA 4W7IA 3GP8A 3M33A 4LVUA 3HN2A 3UMMA 2YVAA 4L5IA 2OHFA 4Z1OA 3R1IA 2WLSA 2Q5JA 4LZPA 4DCCA 5IYZA 1P3DA 4OA5A 1NVUQ 3ABQB 4RPLA 2HA7A 2H8GA 5CR9A 3DAFA 3HNRA 1CK2A 4YJKA 4CKEB 2Q3HA 4MRMB 1FFBA 3BB3A 1MCZA 1GVHA 1DZ3A 1IDN1 3JX9A 1IN8A 4MV7A 2EARA 4CR7A 1XVLA 3IUBA 4OGQB 3VTZA 1GZ0A 3ME5A 3H2GA 1TQ8A 4BP9A 3HS3A 1NT2B 2Q3DA 1GKIA 3BDIA 2OK8A 2GS9A 1E98A 2Q5IA 1LRKA 3ZQKA 3G9TA 3TI7A 4D6TH 4H2DA 3PC3A 4FE4A 3HN6A 2FDXA 1THTA 4JUAA 4X95A 3V7UA 2CJYA 4LF7B 1C7IA 5LA6B 4F84A 1I3KA 1LK7A 1H3FA 5EK0A 1W4ZA 1JFVA 4H18A 2NMUA 4FOPA 5DBEX 3U3KA 3KZXA 4C6SA 1I7NA 3ITKA 1KFJB 4RV9A 4P3NA 1BVYF 4GCZA 4TYNA 3PC6A 2FG6C 2BEUA 2QR2A 1RWXA 2YVLA 3ZMVA 3HJWC 2CTWA 1IM8A 4KN8A 1FU4A 1VF7A 1HDOA 4PINA 4PZCA 1WVMA 1WXIA 3IT3A 2G1AA 5EIBD 3TZCA 3E9DA 1RBMA 3IH5A 3C45A 1EGHA 1K3UB 4MUBA 3FYHA 1K7FB 1BZYA 2BFMA 1UDAA 2H7CA 3OJXA 3HXMA 2A9OA 4MROA 2DXIA 2UXBO 4CQLB 4MR8B 2FVXA 2WIFA 3QHAA 3E1GA 4XI9A 3RSCA 4AKEA 1V5WA 3Q8MA 4Z99A 2C5EA 4IIJF 5LU9A 4A23A 3EGOA 1OA1A 1WSAA 1M1UA 3ENKA 1YUNA 1VMKA 3MG9A 1JL3A 4D9GA 4INAA 4NU0A 2GM4A 4FD3A 4DF3A 5EJFA 3K14A 2GBFA 2P4KA 1MA3A 3IJ5A 5BSHA 3EDRA 3QVLA 2GZSA 3KXPA 4HOYA 3L75H 3UHPA 4DQ0A 4G0PA 5LQKA 2C7QA 1CPYA 5JIBA 4S3MA 3KYCB 1UJBA 5B12A 4PLGA 1KQSU 4UEWA 1XFAA 2POQX 2ZB3A 3HMQA 1U2DA 1R6UA 3U44A 4FYJA 2W2PA 4RE6A 3CMAV 4BTVA 5TRTA 1SXIA 4QKQA 4D8YA 2BI7A 3MHPA 1IXSB 1GZ6A 1IH8A 2R4UA 3NHZA 2D5BA 3LUFA 3AEXA 4MWTA 1PFQA 5AJVB 4IIUA 4QZVA 2VSNA 1ORTA 2QT9A 1BHQ1 1GGHA 1V54C 1S8AA 2QKSA 1LCIA 2XBUA 4LDNA 1GZ5A 3KCXA 4DA8A 2C2YA 1EX7A 5JCXA 2CHVA 4N5DA 4HAUA 2BHNA 4OI1A 4HFNA 3ZG6A 5CH3A 4L51A 4LQLA 1N0NA 3TYXA 2FEOA 5LYYA 4GUNA 2INGX 1EGQA 2ODNA 4XGRA 1YQUA 4JR0A 3K5WA 1ZUD1 2J9FA 4BWYA 1JJIA 2EZPA 3WGJA 2V1DA 4UV9A 4D3ZA 1L4EA 1RP1A 3AR2A 3VO1A 2ATVA 3DW1X 4X8LA 4LGCA 3I5MA 3K53A 5AVKA 1XZAA 5B55A 5K6TA 4QIWF 2QYOA 3JD0A 3V9PA 2QK4A 2PI5A 4E7OA 1LQUA 2MYPA 1Y89A 3BXHA 4TMWA 4AP5A 1ZC4A 2C7GA 2WWXA 3T3NA 2SCUB 3V1MA 2ET6A 1MX5A 1JIIA 3IBYA 2CMFA 1NA5A 2IOQA 1BJRE 4YQZA 4XDZA 3MINB 2PYDA 5B1SA 4W5RA 4EB3A 4EVIA 1DRVA 4CT5A 4LRXA 4I9GA 3LXXA 2P1DA 5ESRA 2B2CA 3B1WA 1BRTA 4HDMB 2A5YB 1G291 3R6LA 1R8QA 3CZAA 2VXBA 3K0BA 5COAA 4ZTUB 2PKWA 2R1VA 5JLAA 2K6GA 3A36A 1A9XB 3CS5A 2JFQA 3R5FA 4KW7A 4WBNA 1QH0A 1OBFO 4TYYA 3WIBA 2JCGA 4M0MA 4N03A 2PZGA 3M4JA 3RVKA 4UD2A 4H44B 2JZOA 2NYUA 4BXOA 2P77A 5IZ4A 3F7OA 3A05A 1ATZA 4Q24A 2NV0A 2V74B 1CJUC 1P2DA 3ORYA 2QUHA 1XTPA 1OC2A 4ZQEA 3H1JH 3K12A 1E9FA 1OCOC 3ICQB 2AX3A 1ZI6A 5AKHA 5EP1A 2F8MA 3ORHA 4WCDA 4CF6A 1OBVA 2C4VA 5F7XA 4CR8A 3MRSA 4IEIA 3PCXA 4A0SA 4LYEA 5F51A 4AF6A 3CGWA 3WC4A 2TMKA 4UHJA 5K20A 3HLTA 5BQPA 4OA8A 1OSNA 2PZBA 1YE5A 2PGAA 3HA3A 1CUIA 1ZP6A 3FDZB 2ZVZA 3NW9A 3TLEA 4BO9A 5FI1B 2QMYA 1U0SY 1TFRA 4JF3A 1DAIA 2LZ0A 5COBA 4UQOA 3KIZA 4ZZ2A 2QMZA 4YIPA 3HA7A 3MUNA 3T1OA 1ULHA 1V71A 4JL6A 4EGJA 2WM3A 4PQEA 4YY3B 4ZRDA 2ZCEA 3CPHA 1JV2B 4CM1A 1ZX3A 2OOSA 4XYMA 2J0QA 1YTUA 4GC5A 4YJ3B 1CU1A 1IBCA 2X19A 5AOBA 3ZU6A 4TN1A 3M6IA 3AOEA 4DN6A 3ZRWA 4CDMA 2CXQA 2NAPA 2YWFA 2PGDA 4QG3A 2A58A 1SXJD 1C2YA 1N32O 2WUVA 4TL8A 3D1JA 4MVRA 721PA 4OEHA 3P96A 3K9FC 4R84A 1AO0A 4R1PA 4X89A 3ONVA 5BY2A 3RRMA 3V4ZA 3I1YA 3WK7A 4CCYB 1IOVA 1WPBA 3QITA 3GRUA 4LW8A 2DAPA 4P0QB 1X9HA 2IYNA 4AI8A 4FK5C 1T1SA 1B04A 2LXNA 2F43G 2PZEA 1ZGBA 4LOLA 4A26A 1YJQA 3MBOA 2J48A 4OHMA 1XVAA 2EP7A 2Q28A 3MQ2A 4FLYA 1SK8A 1KZ9A 2ZE8A 4ZZIA 1HDYA 3AF5A 3ZD6A 2J07A 2A5DA 2IJIA 1GO3F 4HNQA 4PR3A 3R6WA 3KQQA 1M9NA 3LGXA 1S1CA 1D2HA 2A92A 3QWIA 1B8PA 4OXYA 3FJOA 3R40A 2HH9A 2V5UA 5BR4A 2HU7A 4PSKA 1GDTA 2QS9A 4JJEA 4F2DA 1U8TA 5GIPC 3BFPA 3O9ZA 3L73H 4HR7A 2C9ZA 2FOXA 5MHTA 2I6TA 3X1MA 3RC3A 4G9BA 3OEEG 1E7SA 3VI3B 1TYBE 2PX4A 5LNK6 1KSJA 2YXZA 3L1JA 4JX8A 3H8JA 1TF5A 3QFFA 3F9IA 2W6QA 2RCYA 4F11A 3BA6A 3NRJA 2UYOA 3NORA 1LW6E 1Q7RA 3QF4A 2Z6QA 4QTTB 1GVNB 1CLEA 3AMVA 1NQOA 4BVAA 1YITV 4LMBA 1AKMA 4I0XA 3HB1A 4DILA 1WXQA 3QUSA 2HU2A 4RGYA 2Y66A 1CJMA 1PR1A 1RI1A 1WUIS 3A9SA 4ZVVA 5L3EA 1GAQA 4X84A 4RU1A 1JXMA 1GXSB 3PGJA 1IY2A 1Q1GA 5TR9A 3MCVA 4JLAA 4P4LA 1OW3B 1X7ZA 2JHCA 2WJIA 1KY2A 5FL7G 3GRAA 1QFSA 4BU0A 1MO6A 4HDNB 3EG9A 4OKIA 3E83A 3GEHA 2ZIXB 1ISGA 4GL2A 3UUEA 1H0SA 2QY9A 3LCRA 1GDHA 3RT7A 3NJRA 2YKGA 1Z47A 3SHOA 4PE5B 4HGQA 3GDHA 2HEGA 3R9XA 4MUYA 2ZI7A 1HZZA 1UBEA 1G64A 2MSKA 2JK5C 1W96A 2WOJA 4MYRA 2JFGA 4J03A 1T3GA 2FJPA 3W7SA 1DBRA 4EHJA 4WLUA 5SYMA 1I14A 3GP3A 3WB2A 4KCGA 5TQ0B 1M7GA 1QIKA 1NXQA 3L6EA 3ZLVA 4MI3A 4FFMA 5A9SA 2NUPA 3BDAA 2O2CA 2X0IA 3S28A 1P3Y1 4GC9A 4EG5A 3FHTA 1MAHA 5MN5A 4XSGA 2QW0X 4UCTA 5K45A 2H7XA 4N21A 3RABA 3OWHA 1V47A 1GPWB 4BMSA 3AY6A 2CXTA 3A7DA 3LPCA 3K0AB 4FHZA 4G8CA 4YJ3F 4R83A 5JQWA 1DIOB 2OWOA 3ISTA 4I5EA 2JGLA 4S1OA 3DUFA 5KU1A 4MI1A 3ZDYB 2VWPA 2RCNA 1YRYE 5E7IA 1YT5A 4CEHA 3UCXA 1H5NA 2WKWA 4Z9XA 1NOKA 2BRUC 3DLHA 4H59A 1A98A 1IMOA 2OBFA 2O50A 2RG1A 4IT5A 3GJTA 2JLXA 1W4AA 4MIYA 1QVFU 2XOKG 1C9YA 2YV5A 1WB9A 1NI4B 3E05A 3U6BA 1ORDA 1E6EA 2J6BA 3DLCA 3D1LA 1TCUA 3RJZA 2FNAA 1PT9A 1XZIA 3IKMB 4WDQA 2ZUSA 4PIVA 5CJJA 2J09A 3QX9A 1JG6A 1Z33A 2Q3FA 2DKFA 3GLUA 4Z0TA 5CB4B 3HDGA 1DARA 4BC1A 3N2GB 1DOHA 4OSOA 3F8TA 3OEED 5JXHA 3H13A 2ZI4A 1W4RA 3QU5A 1H2NA 2EERA 5KQLA 3MHSC 3EW9A 3EIQA 2Y67A 3RRJA 2DHRA 1V11B 1I3LA 1VPVA 1Q0QA 3QXCA 1NE7A 1UJ5A 3LQRA 4QTZA 2E1PA 1W2WB 1QGED 3ZE7A 4BGEA 2FE1A 4WEQA 4DV0B 1RJEA 3E3OA 2ILMA 1BKYA 2OLKA 3JARA 3C5EA 1Z08A 1L5RA 3LK6A 3MELA 5KOJB 5FOWA 2BV3A 1NKVA 4RO2A 3V8QA 4QYXA 4A4DA 2EP5A 4CIYA 1JB9A 1M2GA 1G21B 1CK4A 1EP2B 5FL7D 5LSAA 3TEJA 3QYJA 5B6JA 3BE6A 2E5LB 2W2OA 4FZ3A 4AP6A 5KWEA 4JWTA 2DZDA 3G9UA 2HY7A 5KPJA 3AF1A 3ERCA 1Z3CA 1XRGA 2I22A 4P86A 3D5QA 1RHJA 4PPNA 3CLUD 3JYLA 2G28A 5FIUA 1JECA 1JWLA 3OZAA 4WACA 5IJ9A 4BTEA 3OX1A 2JGNA 3PPYA 4BX3A 4YWHA 2R62A 5F78A 2C8JA 3ZMTA 2UYGA 3SYNA 1S5LZ 3RRBA 1XVIA 2J0EA 3HB3B 1KO1A 1ZNQO 3OQIB 2RHJA 1E3QA 5BN3B 3D5TA 4RMHA 4CMIA 1G5QA 1JX9A 3CF2A 1C1XA 2HN9A 3PIRA 1Q0SA 3SIPA 4DQVA 4G4WA 3I5AA 2VGNA 1SU4A 4BLSA 1W76A 2AK3A 5I9BA 3QU2A 4PLCA 3JQ8B 2C4UA 3WMGA 4IIDA 4OB8A 3ZGNA 2QAJA 4QUHA 1ZK1A 4QPJC 3DSRA 4CS4A 2PMDA 3FMIA 4EKEA 4R8CA 3M83A 2CLFB 3IQHX 1PJ4A 3KJKA 1ZJJA 5DYIA 4HNHA 1X9GA 5C8VA 5BYBA 4OXIA 4IIHA 2GLTA 3UKMA 3FZNA 3UWMA 3HAXD 1SQ0A 2HYIC 5EXTA 3TLGA 3BTUA 3FVRA 4DYLA 4M1OA 2XNDA 1T5EA 4YP9A 4X93A 5LMNB 1W1WA 4FNAA 4ZTBA 2XOKD 1M2OA 1NUTA 3V7QA 2QTTA 3H1LH 3EZNA 3FFXA 3D3KA 5EZQA 3AUAA 1RM1B 2C83A 5EWJA 4DABA 3P3NA 5ERXA 3LYAA 1XA0A 1KK3A 4EA8A 3FOWA 1OFUA 3V34A 3GLFA 4I3FA 5KNDD 2ZWIA 2GBIA 1J0EA 1M6WA 2VJLA 4DLRA 3PNOA 2IYLD 3H2BA 3ITEA 5KB3A 4HEA1 3JQFA 1KEZA 4FUQA 1TTHA 3I73A 4L8VA 1QCCA 4F9EA 5IK2D 3ZCSA 1MB4A 1RI4A 2MMGA 1QV7A 2JBHA 1MO5A 4PAGA 5GPBA 1L5KA 2F1HA 2OBXA 4B2LA 1T0IA 3GBSA 2GHIA 4POOA 4EIWA 2YJTD 3ABKB 1K7XB 1ZL8A 3WHKA 1RLMA 2ANCA 2B4YA 1M56C 2LD4A 3DPIA 4Q3OA 3WG7B 2IFTA 4YY3O 2O05A 4OXNA 1HMPA 1BYUA 1GFIA 5BV0A 4R2MA 1SKVA 5B36A 3AQ4A 2OZLA 3JZIA 4NZPA 4E09A 1RFYA 4AWBA 1PTKA 3FFMA 3T0FA 3VBCA 4ES6A 2AYZA 3LT2A 2NQ8A 4Q1DA 3ZMUA 5FUYA 3Q10A 3PQ7A 1ZZEA 4DS3A 4EA9A 1P33A 1QO7A 2I6QA 2VT6A 1VB5A 1EZVH 5E6RB 4BGUA 2XTNA 2R1UA 1XOUA 3B1FA 1TECE 1P5FA 1OT3A 1XWIA 1LDNA 3C24A 1QMPA 1P9WA 4PG6A 1WUTA 3ASVA 4WCFA 2V4DA 3DEZA 2C7PA 1RWQA 2GAFA 4MDFA 4N65A 5TPZA 5KUKA 5KEIA 4H6WA 3FDJA 4L9SA 4BNHA 3M3HA 5TEVA 1E2UA 3OBYA 1D09A 2OTLV 4TLLB 3D4PA 3CX6A 3QVOA 4A7PA 1FMFA 3KYBA 2AB0A 2FE4A 1HA3A 2BF7A 2MSWA 5IXYA 3GDGA 3CLKA 1RPZA 1JAIA 4NPCA 3I3FA 1R6BX 1KEEA 4NYJR 3JATB 3K32A 3OZTA 3KHTA 3ZUPA 4EG3A 1XFDA 1QWOA 5HEKA 4OFXA 2B25A 4MIOA 1A27A 3NYRA 1R37A 4J7CA 1WY7A 3LPMA 1EHCA 2VBIA 5CLJA 2HCBA 2YVKA 4QECA 2GDSA 3AKCA 3SNKA 2CXUA 4YMTA 4QHSA 2H4YA 4AUNA 4NHEA 5HP7A 5DTIA 2FWJA 3RAFC 2DYRB 4UUOA 4BDSA 4PSDA 2JIPA 4X61A 3WJQA 4MX8A 1GAXA 2XMQA 2CWJA 4ZI3A 3EOAI 1Z6GA 3ZNOA 3GL9A 3BCCH 2ZJ0A 1VP7A 2ZSHA 3G6EF 1M34B 3W0LB 1N0JA 4YMWA 3KAKA 4Q3AA 3GJ4A 1A1VA 4F46A 4ABMA 2NNUA 4BV3A 5KHGA 3GLGB 4GLXA 1UFOA 1R00A 4Z49A 4G0WA 5LZ8A 3DH0A 3L7QA 1QVGF 3AI1A 2I8LA 2WE7A 1JHZA 4PY2A 3HMKA 1MOZA 1V0JA 2BEKA 2HBQA 3AIIA 5D3MA 4MVCA 4ZDWA 1YOBA 5JRDS 2AN1A 3R0JA 2LJ2A 2I3AA 1ZL2A 4N0QA 2TRSB 3P9ZA 1WLSA 1NAIA 5CT8A 3EY4A 1MO2A 3JRNA 1NX9A 4TX1A 5F2NA 4I1OA 1MNAA 3B7PA 1GUZA 1R7RA 4KTTE 3WDLA 5K0FA 3DPUA 3T52A 5DLEA 2PKYX 4JAVC 4JOCA 4KQKA 4EJSB 5JJEB 5JAOA 1MABB 3A4LA 4IGFA 4QTYA 4E1AA 3NIFB 3GLHE 3PAFA 1RI3A 5DK4A 2IGTA 2ZRPA 5LYJF 1TCAA 3IP5A 4RKFA 4D45A 4H4CA 2WT9A 3Q9LA 4LISA 3JVHA 1V6CA 3MFQA 3O5AA 3BB4A 1ML4A 3DF7A 3CEAA 1ROPA 3DBRA 2O0HA 4GPEA 1ZK0A 4A8JA 4OSEA 1MABG 4LDQA 3FYIB 3ZQUA 3WL4A 1K1EA 4ZYLA 1P1CA 1L7PA 1LK0A 3IQZA 2EILB 4EO4A 4KFSA 4NYIR 1UL1X 5F98A 4AMBA 2ZIOA 4H7FA 3LI2A 4Q19A 2QY6A 2D1QA 3GWGA 3C14C 1CJBA 3K5MA 5C4GB 1KETA 2ZRHA 2P67A 1UINA 3KQOA 1N1MA 1Z7EA 2V7EA 2JEOA 1IAVA 1ICIA 5E7MA 4LVNA 3ZZTA 2V98A 4NKRA 1PGQA 4G1EB 1B41A 4GZLA 6NULA 2GARA 2NU6A 3ASOB 1X38A 1YB2A 2VDMB 1X9IA 5THQA 4KRYA 4UOZA 3NBMA 2IODA 1AZSC 1OLOA 4A10A 1G60A 4BE4A 3D31A 3VM6A 1WEKA 2Z0MA 1P8JA 3C6YA 1XC7A 2Y9MB 3ADBA 2Q0SA 2E48A 1OAOA 2Q7OE 5B7NA 3OQPA 1KAEA 4Q4JA 4WXPA 5EGNA 2HWKA 4UBLA 4XD2A 3V97A 4RHEA 4QL3A 2PH3A 2HPVA 4M6WB 3JQBA 1Q8IA 5IDWA 1QB8A 4L28A 2KSDA 5EZYF 1Y4ZA 1S6YA 1CR0A 4LDZA 3C87A 4JZGA 3HUDA 4RKYA 1SZJG 3OC6A 1EUCA 3QM1A 2RHGB 3B6IA 4BFXA 1JLKA 3T9FA 3G82C 4W5QA 2RJNA 5LGTA 5KMGB 2FPPB 1L4NA 2DVMA 4DV1B 1XZLA 1RQGA 1BVHA 3AT1A 2WJ6A 3DMHA 4J1QA 4KAFA 2DFTA 3ER9A 1NW6A 4Y2YA 1I5RA 2VF8A 1Q16A 4WAUA 1CUJA 5L7TA 2RSLA 4A6DA 3KOZA 1P7CA 4J07A 5CA3A 4MQFB 4RD2A 2RJOA 2Y4TA 1WZNA 4YCNA 3V2HA 5U4QA 1T5DX 3P2OA 5BW5A 5JPIA 2E5LO 2YFKA 1ZVKA 5JNTA 1VQ5V 4TUYF 2P5UA 5LZ2A 1W87A 2ZINA 1VKJA 5FUWA 4C06A 5BURA 4X9XA 1Q77A 3DAYA 3USCS 4ETWA 4B6OA 2BDEA 3G1TA 3SZGA 5AW7A 3IP3A 1QHHB 2HX1A 2LGQA 4QBKA 4Z1MA 3IT1A 5HJ7A 3EGXB 3W7BA 2PE5A 1L4YA 4LCEA 2J3JA 2GXAA 3ELUA 4XE5A 5AESA 2CBGA 2CKMA 2PCLA 4XX0A 3K79A 2PLRA 1U90A 3WJ7A 4CGZA 2R47A 2GEUA 1IWBB 1K33A 4ZAYA 4PZLA 3J7AR 3MQWA 1CE8B 1NY5A 5B64A 4XQCA 1RCUA 3TNDA 4UU8A 3L4JA 1VYTA 1WLYA 1ZCFA 2FB5A 2VSFA 1TADA 1B7GO 3D54D 4GAEA 5F5LA 2W8BC 1A0OA 1SD1A 3AI2A 4XA8A 5ETJA 1NJ6A 3HU2A 4WESB 2JANA 4IYHA 1NUUA 2LVBA 4YCDA 3I7TA 3TW8A 3IQIX 3BFKA 1LKZA 4ZZ3A 3SX2A 1DTEA 1T3TA 2P79A 3G9QA 5DIZA 2AI2A 5DNDA 2QN3A 4ZGGA 1TZCA 4JLUA 3OX4A 3I55F 1JG7A 4BQQA 4OQPA 3PK0A 1IC6A 3DW3X 4GH5A 5LMNO 4BO6A 3CN7A 2TECE 1VQ4V 1WZIA 4LJ4A 1SRYA 1BU5A 4DBLE 1TEVA 3PQ4A 4NBUA 4HH0A 3BEOA 1GCGA 3ND6A 4RIGA 1ONOA 1TK2A 1KB9F 2BZSA 2JIRA 3TLKA 4PHTA 4BN5A 4Y1RA 3QENA 4JN6B 3CJQA 4JQYA 1BHO1 4HH4A 3GEBA 4UUMA 3C1AA 1GYRA 1H2WA 4GM4A 1IV4A 4XZ3A 4K6HA 3DZKA 4MUGA 3QX3A 2O14A 2QM7A 4YXWA 4TL7A 2Q0XA 621PA 2HEPA 4UMVA 1GZSA 1B3RA 3SOZA 4Q20A 1EFVB 4WFEA 1PCXA 3CCQV 2YS6A 3Q40A 3UQZA 1VHQA 2RGUA 1BWQA 4MMZB 2PZKA 1O6GA 3L02A 4ZMSA 3TRHA 2M9MA 5B7GA 4OBXA 1WA8A 2IOYA 1R0WA 1PEDA 5KPDA 2UZHA 3BICA 4GT1A 2FSVA 5CD9A 1MA1A 2CYCA 5IC4A 4DDHA 2GFIA 1O8BA 3DV0B 3TECE 2FW6A 2FSGA 2JIMA 4M0EA 5LMUB 5AKEA 1TX4B 1KC1A 4D42A 3P5BA 1T1RA 4ZAFA 3S06A 4RIFA 4GMFA 4UVBA 3V1TC 1I6WA 2I54A 1NSFA 3MAAC 1K9SA 2XZTA 5A6SA 1WMAA 1B26A 2BMFA 1DJMA 1J9EA 1NJIW 4P3KA 4HVCA 3B5JA 1KBZA 5IWCA 4EM6A 4KU4A 2M32A 3A6JA 1GK9A 3NHLA 4BNIA 4NU6A 4QOIA 4EFBA 1MO4A 1ABFA 2N48A 2QWXA 5KCZA 5DRTA 2EW2A 4B0PA 4G67A 1JF8A 5M29A 2H7YA 3EMKA 2L42A 5BMVF 2JZCA 2IZ7A 2JEZA 1P1BA 3FMOB 1DINA 2W2TA 3ZXUB 4YXFA 1ZJ5A 4EY7A 3ICCA 4W9NA 2B7CA 1HDZA 3ZK8A 2VJYA 1VMGA 4XBFA 1U99A 3BHIA 1GR0A 1NUQA 3KOWA 2IYFA 4DHWA 1OCCB 1ZSVA 4C2UA 1EYZA 1C4XA 4RLSA 4RQOA 1KAOA 2I71A 4HDOB 1DC3A 1JGTA 1QGDA 2GO1A 1VCOA 2ZNIA 2VRCD 1AUXA 3D0OA 3UMFA 1X0XA 2IX9A 1HR0O 1EPUA 5F1PA 5JXJA 2XADA 1WN7A 1HE3A 2C3MA 5C46F 2YN2A 2AXEA 2NP7A 3NWOA 3FCUB 1CS0B 3OT4A 2GN0A 2OFWA 1C4WA 4L87A 4OOEA 1B6QA 1M74A 3ZZNA 4GMGA 5JCOC 1OLUB 3CW2A 1RLIA 3T5GA 2G4VA 2BFEB 2RCVA 4DGSA 4EGCB 3AIMA 1UQTA 2ZKOA 5CX1A 4H37A 2XQFA 1F4VA 1YHZA 4YRFA 1XMJA 1EJBA 1ORWA 2XCQA 3LDCA 3KETA 1KGDA 2YSUB 3LP8A 3FOEC 4A9AA 4KPYA 2LR0A 2F9LA 1XCMA 1GT6A 3FXAA 4PWYA 1GO1A 4NY1A 2G5PA 1Q14A 4TSFD 2PX2A 4EP1A 2ZUBA 1P7WA 3H5TA 1XNRB 1A5BB 3LWRC 3SR2C 1QZ3A 1US8B 2BEWA 3QO8A 3IYLW 1NVKA 3MDOA 1YZTA 3CUEF 5BQFA 4FI3C 2OCDA 4BNTA 4HPJB 4MK4A 3NJ4A 4L5JA 5DB4A 1Z2NX 5HUJA 4MGZR 5JAZA 5LP6A 2HA2A 1SC5B 4C4TA 3R7BA 3K4PA 1OX4A 2VA8A 1SQGA 1KAHA 3WGGA 3IP6A 3H9JA 5JQGB 3L6RA 3CO5A 1PGOA 3IDOA 1HYBA 1YDMA 1VA5A 3SGIA 1TAHA 1V8OA 2LTAA 4YUXA 2QWOB 1NR5A 3VR6A 1KJIA 1OFTA 4LXTA 5CH8A 4KREA 1J00A 2GILA 2UVPA 1XTQA 1FXKC 1A2KC 1NM5C 1XU7A 5DGXA 1U2PA 1LC0A 4RK0A 1IPFA 4FLZA 2FFQA 3P9QA 4M7PA 1MZPA 4K6CA 3T5CA 4NCBA 3RK4A 4RKQA 3ZBQA 1ZD4A 3ER6A 4B6FA 1FP4B 4A16A 1H69A 1MDFA 1X80B 3BXPA 2IUTA 2XMDA 4JJ6A 3NK6A 2AFVA 4ESHA 3KFXA 2DSNA 2JLZA 1FL9A 2WD9A 5JT1A 4H3SA 2G1KA 1S2LA 5HK9A 4TTRA 2G9QA 1ZOSA 3N86A 3S0YA 3MGCA 3MIZA 3W2IA 1ECFA 4Q9HA 3OZXA 1TM1E 2D00A 4CV0A 2D4HA 4WK2B 4BKPA 3GBVA 4AYTA 2WLNA 5F73A 2P30A 3BTVA 1QQCA 4FB4A 2HKIA 2IYUA 4I5FA 3L0ZA 4KO1S 3FNFA 1YUMA 4RPGA 4LI3X 3V8VA 4PYLA 1QHEA 3U3MA 1SC3A 4ZC8A 2FH5B 4B75A 3KR1A 3LMEA 3L7AA 2GJSA 3HJTA 1P80A 4ZOAA 2GM9A 1E64A 1QHYA 3BGWA 2AFIA 4MIEA 4RE5A 4YCCA 4DV1O 3CKLA 2GBLA 4WSOA 5A4JA 1KWKA 3NR2A 1IJFA 4MMYB 3JYPA 2ATKC 1VP3A 3QBEA 4R05A 3PPVA 4C29A 4U1RA 4YRDA 1OXVA 1AJEA 2YBDA 4NS4A 3PXXA 4QUJA 3W3AA 1RR6A 4WOBA 3QU9A 1BA3A 5D1NA 2Y1LA 5F52A 3WBFA 1WB4A 5AVMA 5CHEA 5EKDA 5BR8O 3I1FA 1PWHA 1G16A 4ZREA 1SKBA 1PI3A 3M9WA 4PO8A 5K1PA 2QKCA 4C4PA 2EJBA 7YASA 1SG9A 1U02A 4HKTA 4DLXA 3L9DA 3CX8A 2WABA 1FLVA 3F74A 4CEIA 1L7AA 1UWCA 1UXOA 4NEGA 1CUHA 3GYGA 2R7LA 4MS1A 2XGSA 3O4RA 1YZYA 1B6GA 3WAGA 3FWZA 3E18A 4CDRA 1HFWA 3T0IA 1UBTS 3HVUA 1JILA 1XRSB 1TJYA 1THGA 2X2PA 4O6VA 2GV9A 1CVLA 2Y9PB 2ATEA 3T38A 1J8FA 3UBMA 2JZNA 1DBWA 5EKUA 1QE0A 1NXOA 3DZBA 1D1PA 2PWYA 4L8FA 3ZU2A 3T9AA 5H5NA 2GCPA 1GGFA 1UFIA 1G4UR 4QUAA 3IP7A 5FQOA 3ZN0A 3ZWXA 3U7IA 1B16A 3VKFA 2IG8A 3B6EA 1Y74B 4RWEA 3LOUA 3C7DB 2TMYA 3H2HA 5JNUA 3K5PA 3N2EA 3ZV5A 1GQ2A 4OH7A 3QWFA 3AR6A 4U9IS 3DFIA 4YAKA 3KQSA 5C37A 3VSBA 1DUIA 3OF2A 4D9MA 3NLLA 3IMEA 3G3EA 1ZW1A 3AEQA 3SEQA 4NS1A 3BAZA 3KWMA 4UOQA 4INPA 4B46A 5DTEA 1H4SA 1E69A 1KEVA 4C3OB 2XTMA 3TUZC 2ZANA 5CXUA 3B85A 2Q6LA 5FEUA 2NPFA 4QNNA 5F5NA 2R6GA 3UGTA 3U10A 5A0VA 3D6TB 4G1FA 3OPNA 1Z22A 1AB6A 3DEIA 5H9CA 1KO5A 5G0SA 3JAKB 3MHTA 5F5XA 2QRLA 2QLMA 1BIFA 4JI3B 2GPAA 5JU6A 4GX0A 5JAUA 1BJTA 4EABA 3TJZA 4RD0A 2OCBA 2ZXFA 3GK3A 2C96A 3TRKA 2CK3A 1KFBB 2VK1A 2IYOA 5LQSA 1B0UA 2CCKA 4QRDA 2C5LA 1NUSA 4CS2A 1OASA 1EB8A 5E38A 2MDTA 3PHHA 2WIGA 4NCIA 2O5EA 1DKUA 4BBAA 4DJFC 4YLEA 4RS3A 3OKAA 3UA3A 4ZVTA 3B8EA 5LMUO 1GN3A 5JZSA 2WYVA 1RYNA 1FCJA 2JH9A 1WAZA 1IXYA 1G7RA 3UG7A 3Q2OA 3IPCA 3Q3JB 2YHAA 5LXTB 4RYDA 1U7XA 3ZVLA 3O7WA 1MXFA 4CE6A 2X0EA 4D4MA 1AU9A 1J9ZA 4ZVRA 3MZ0A 4O2AB 1CCWA 3V2IA 5HYVA 3EUWA 2ZBFA 1UBNA 1VECA 1XVUA 3WAJA 1G19A 3LWNA 1UEIA 2FGYA 4A2WA 1LC3A 3S99A 3K6RA 2ATCA 3NAQA 5DHUA 2SKCA 2JJQA 3RI3A 4LDPA 4OHWA 1U81A 2FJ0A 2DUWA 2J9RA 4M1ZA 3E9EA 2G9RA 2C2BA 3FVTA 3QTLA 3VQVA 2A9QA 3UAVA 1G66A 3NDJA 1K2WA 3P0IA 4WA7A 1JBEA 5HE9A 2D2VA 3QPWA 4ZAWA 4E08A 5B53A 1XP8A 4FHGA 2ZS9A 1PT6A 2H9YA 2OO5A 3K1AB 5CUQA 5FPKA 5AW6A 4J4TA 4RIHA 2ZPUA 4IDAA 5EHXA 2FUG1 2V03A 2X22A 1PGJA 3F5SA 1O77A 1DBPA 4EPTA 4ARCA 3IDQA 2GSMB 4IUYA 2BKEA 2YUTA 1PR5A 2W4IA 1A32A 2AR0A 3WGLA 1NU6A 2ZWPA 4PG7A 1Z4PX 1Q0PA 1LDYA 2KLBA 4OQZA 3G0IA 3TG2A 2DQKA 2WTAA 2JB9A 1VJCA 1OREA 1UIRA 1TOAA 3DULA 3QLTA 3BG5A 3QWAA 5IEJA 3U37A 3V5NA 4V2IA 3KUKA 1P8AA 1JLLA 2FVYA 5L7YA 5IARA 1F51A 2R6HA 2BFFA 1HZJA 4YMIA 1G8KA 3DE6X 5JROA 2ZUEA 5JDIA 4PHFA 2QGFA 1QR9A 3KEGA 2W6PA 1E96A 2RB9A 3P0ZA 3BORA 3TJMA 4MICA 1E9CA 4HNRA 1XREA 4QM6A 4D7AA 5JSZB 3GCZA 5GJWC 1U6JA 3P0HA 5LA6F 2OPHA 3GFSA 1U8UA 4FFDA 2ZWOA 4HXEB 4CR6A 3EC2A 4NARA 2YNMD 3KL2A 2ZIZA 3OMWA 2QL7A 4HDRA 1NXSA 2OV8A 5J2TB 3I3OA 2VG8A 4G0NA 4LWSB 1PYGA 3EEFA 3AVYA 4KVFA 1XZKA 3O3CA 2IU3A 1P7VA 3D2CA 3QUTA 3DDCA 5BN1A 2PANA 1Q2XA 1IN4A 1TMKA 1ZDMA 4MS2A 2DUUA 3L9WA 1VQ8F 1XEQA 1HK7A 1ZLYA 5ITZA 3HKBA 1LV8A 5E7QA 1GPYA 4AZSA 2IS4A 5KYUB 3BWCA 1TO6A 2WT8A 1VQNV 2WJAA 2APJA 3AX6A 4BAZA 5KTOA 5DHQA 4JMPA 3G0BA 1EG7A 1HT2E 1KECA 2PMBA 3MILA 3F4LA 2V3WA 5EYPB 1STOA 3JQ7B 4XOIA 4IWNA 1R0XA 4WY2A 4HEQA 4UB8Z 2W71A 4E1VA 4N0EA 5M5BA 1PJ8A 1XUOA 4U5QA 2FZVA 4UHFA 2DPMA 3EZ9A 4F9GA 4LBZA 4M9SA 5CCXA 3FNEA 3EAGA 3KSUA 5ALTA 2P62A 1TM3E 1HETA 4JJIA 1K8XB 1QPBA 4NYMR 3S03A 1SPXA 4B2YA 4PXAA 2GB4A 2FSIA 3CCLF 3K0SA 3RJMA 2KS6A 1ENPA 3WDKA 2ZR3A 2ZJ2A 1AH2A 2O5CA 2F9FA 2C9BA 1JJ7A 2NW6A 3IDSA 4I1RA 3IPYA 3KD3A 1U7DA 2GM5A 5FPHA 2V6GA 4LWQA 2BBWA 1E7RA 2RB5A 3T7JA 3S7ZA 3FLBA 1DJNA 2O2HA 4LNUA 4Z4GA 3IMPA 1Y3HA 1XD2B 2BM8A 1MT3A 1OGIA 4X62B 4BFZA 5HF9A 2HS4A 5AM4A 3B60A 3O8NA 3PLAE 1M76A 2HP8A 3DTTA 3A3PA 4ALJA 1YIJF 2VCHA 2NT4A 1G4HA 2BTQA 3G80A 3PD0A 1SZTA 3R24A 1U3UA 4TQAA 1JQBA 1MENA 3B48A 1MJFA 3ICVA 3HCBA 4W9MC 2CW4A 4B62A 4B84A 1S4MA 4IDQA 1F2UB 1NN3A 5I51A 3HYTA 2HA5A 1SBQA 1Z7BA 3J81N 4BKQA 1WL8A 1R3KC 4JX9A 1JVMA 1NHGA 2YVQA 4FP9A 4XYBA 4IDBA 2EJWA 4IXNA 1NG9A 3QI2A 2O3RA 1Y6FA 4DCTA 5I9SA 3QPCA 1QR8A 1K5QA 4TKVA 4EAAA 1EZJA 4HFRA