1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
molecule tags Cell cycle, structural protein
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
4IHJB 4O4JA 2RHHA 4O4LA 5JCOC 1TVKA 5ITZB 4EI8A 4DRXB 1W5BA 3JAWB 5MN4A 4O4IA 1W581 5EZYB 4WBNB 5IYZA 2XKAA 3HKDA 1Z5VA 5LA6A 5JH7A 5JCOA 5J2TB 4EI9A 4IIJA 1JFFB 4LNUB 4TV8A 4U3JA 4E6EA 2VAWA 5ITZA 5CB4B 4ZOLB 2R6R1 4DXDA 3JAWA 2GVIA 4X1IA 4O4IB 5EZYA 3UT5A 5IYZB 5EYPA 3HKDB 5JVDA 5LA6B 4FFBB 4O4HA 2VXYA 4IIJB 3VOBA 4LNUA 3RYIB 4TV8B 5KX5A 4U3JB 4TV9B 4EB6B 5LP6B 4O2BB 1TUBB 4X1KA 5CB4A 4ZOLA 3E22A 4X1IB 3JALA 3WGJA 3N2KA 3UT5B 3RYFA 5KMGA 5LP6C 4M8IA 5EYPB 3M89A 4FFBA 5JVDB 4YJ2A 4O4HB 5IJ0A 1OFUA 3RYHA 3HKCA 1RQ7A 1W5FA 3HKBB 3RYIA 4X1YA 3VO8A 2RHLA 4F6RA 4EB6A 4TV9A 5KX5B 4ZHQB 4O2BA 1TUBA 5LP6A 3WGNA 1RLUA 4X1KB 5FNVB 4I55A 2Q1XA 3E22B 3JAKB 1RQ2A 2R751 3JALB 3JASA 3N2KB 3RYFB 5KMGB 5EIBC 5GONB 3JARB 5C8YA 5MN6A 4YJ2B 4O2AB 3N2GB 5JQGB 5IJ0B 4ZI7A 3VPAA 1Z5WA 3CB2A 5CA0A 3JATA 3RYHB 3ZBQA 3HKCB 3HKBA 5LOVB 1FFXA 4X1YB 4X20A 4F6RB 4ZHQA 4XCQA 5FNVA 3HKEA 4YJ3B 3WGKA 4TUYB 3JAKA 4I55B 2Q1YA 3RB8A 3RYCB 3JASB 5LXTB 5GONA 5IJ9B 3JARA 5C8YB 5MN5A 3N2GA 4O2AA 5EIBD 5JQGA 1FSZA 2XKBA 4ZI7B 5CA0B 3JATB 3VOAA 5LOVA 3V3TA 1FFXB 4X20B 5LYJB 4YJ3A 3ZIDA 3HKEB 2BTQA 4TUYA 5CA1A 5BMVA 3RYCA 1SA0B 2RHOA 5LXTA 2VAMA 3VO9A 5IJ9A 4B45A 5J2UB 5M7EA 4I50A 4I4TA 2VAPA 3R4VA 3C8LA 5LYJA 3WGLA 3M8KA 2BTQB 5CA1B 3WGMA 1SA0A 4HNAA 5BMVB 3ZBPA 4EI7A 5J2UA 4IHJA 4I4TB 4I50B 4O4JB 4U39A 4O4LB 4B46A 1TVKB 4DRXA 4KWEA 4WBNA 5JH7B 5J2TA 1W5AA 2BTOA 1JFFA 1W59A 1W5EA 2RHJA 4HNAB
chains in the Genus database with same CATH superfamily
2P75A 3IJ4A 5BR8O 1UOQA 3HUDA 1Z5VA 4L16A 1A1SA 2H52A 5EJ7A 2AIFA 3TNDA 1G8HA 4B6PA 3BXFA 1XV5A 3ZRVA 5CM2Z 4B6JA 1DBFA 3EXAA 3N3BC 8ATCA 2C4MA 4FNAA 4R7ZA 4GPTA 2AFIA 1TTHA 4Q02A 2YY7A 3AONB 4MNTA 3SLKA 2DUJA 1B6RA 4EUEA 4CLRA 2JC3A 3EQZA 1BMFG 3DL2A 4EF6A 4IG4A 2M7WA 3MBIA 1ZYUA 2ETNA 4PY2A 5BW6B 3I9LA 3QYPA 1JEDA 4OLBA 3AI7A 2HDHA 4X88A 1G4UR 4D6PA 1M75A 3HSSA 4A2WA 3EBOA 4G3XA 3U40A 5L4LA 1MQ9A 4BNZA 3C41J 2GFHA 4LV5B 3TAUA 3RIYA 4FI3C 3BD7A 5BNFA 1GU1A 4LFAO 2V0NA 3A3NA 1UJMA 1MA1A 3FCSB 3FNRA 2X2OA 1QDEA 3U37A 2QENA 1KYTA 3KPJA 2WTNA 2QRJA 3I30X 2D0PB 2BONA 2ZYRA 3LCMA 5EVJA 5SICE 4F60A 3IPCA 1VG9B 5AVVA 1Z4LA 3TM5A 5H16A 3FDZA 5KINB 3AJEA 2PQMA 3L9XA 1PTJA 4O8CA 3VSBA 2X4GA 3RO7A 2QRHA 2Y0DA 5EHGA 1SWVA 3CC7F 3UG7A 2RIPA 4OJNA 3V5NA 1RYNA 2D8MA 1F2TA 3PQCA 3T3IA 1O5TA 3VHXB 4MUEA 4E94A 5FF9A 4NFYA 4BIMA 3JAMM 5DOZA 4KUEA 1HT1E 2Q4RA 4I3HA 3AHIA 3HDQA 5EMMA 1SPBS 4JJ7A 1PJ2A 3T94A 4NV0A 1DKNA 3X0DA 3IQHX 4TKMA 4BIOA 1GKLA 3B9BA 2VA9A 4TT3D 1ODCA 1J2UA 2HADA 3QYFA 4FEAA 3WMFA 2YVLA 1X7YA 4UQLA 3OU7A 3ZCPA 4AZVA 1A2KC 2A33A 4J11A 1ML4A 3JZFA 1JX9A 3W77A 3BTUA 2WVJA 5BSHA 1CF9A 5FNZA 4MDEA 2YVAA 3KQMA 1AKWA 3I6QA 2ODNA 2QI9F 4XSHA 3AF3A 1NW5A 1CC1S 2CH7B 3TOCA 3H9VA 2E4VA 4C8GA 5G1OA 4NPHA 4CQLA 3VHXA 3L1VA 5LXTB 1EK0A 4MYDA 2XRFA 1CE8B 1JIQA 1G4AE 1YK0A 2ZETA 3UWMA 1N32O 2C82A 5ALNA 3QWAA 1EZ4A 4ROTA 4FE3A 4AJ4A 3H4IA 1QVRA 4PONA 3I55V 4DCNA 3ZJVA 2XUZA 4ND2A 1G1MA 2QSJA 3G82C 4UCRA 2UYJA 3GFVA 2ZI3A 3KZOA 4PWZA 4DEXA 1Z17A 3X1YA 4OFXA 2C2YA 1NM5A 1WB9A 3ELCA 2VAXA 4AJIA 1E5TA 3PNBA 2B4QA 2HAEA 4GRIA 3AO0B 3UV3A 2VKTA 4F38A 3SYLA 4C8EA 1KF0A 3KYIB 2CH7A 2OHGA 4X5OA 1HTTA 1DXHA 3GYBA 1SUAA 4KNWA 1XRGA 2ZJ0A 3SIRA 5KPDA 4R2HA 2WQZA 5KHHA 2ZE5A 2IYLD 2QRNA 1H2RS 1CE8A 4IWXA 4ZALA 1V3VA 4I4NA 1QVAA 5DJ5A 2W6IG 3V8VA 3VU0A 1RPTA 1KTVA 3G4SV 5T3UA 2JAHA 3KZKA 2ZCUA 3GPLA 3VNQA 4CKWB 2QSUA 1KI3A 4XX1A 5D51S 2ZVZA 3OC0A 4AU1A 1KH1A 5BR1A 3C6QA 3EVBA 4MVJH 2IXDA 2FMKA 5L3CA 3ZWKA 4EELA 1T1EA 3QPDA 5BRAA 2AEFA 1M6VA 3R6LA 2ZB7A 2WIJA 2QYSA 1NKDA 1EG7A 3T4XA 4BNYA 3LXRA 3BHIA 4JEUA 1YL6A 4X63A 5JS7A 1Q77A 2APJA 3V2IA 1VSVA 2J5QA 3B3AA 5DNYB 1PQ4A 4MEBA 3PBKA 4EX6A 1E5QA 3ABQB 2GWRA 4Q3OA 3DKRA 2JJMA 1N34O 3WMEA 3OURA 4HB3A 1FYVA 2QV7A 1XO1A 2W58A 1N8TA 4CKWA 1AKUA 3IEXA 3K6SB 3H8WA 2ZPTX 1XDDA 3MLEA 3CUEF 2QT0A 1SIUA 1RWOA 2D54A 5UKDA 3E23A 3BA1A 1NBIA 4ZYWA 4BO3A 1XCJA 5KDLA 3MSCA 3CVVA 2C8JA 1A7UA 1VBMA 1NF3A 3LZDA 2A3QA 5IM5A 2AG5A 2GHIA 2PSSA 3AI1A 1KEWA 4FYMA 2W0SA 1A5ZA 3LJKA 4GOND 5BY1A 3THOA 3OOHA 1KZ9A 3LMKA 2HP3A 1A50B 5FOVA 3WLNA 3GYQA 3LPCA 1JGTA 4OGLA 4PNZA 2YIBD 4EPRA 5ENVA 1JUDA 3VM6A 1JOYA 1LLCA 1U0NA 4JI1B 3U44B 1CUXA 5BMVF 1XAIA 4PA9A 3FOWA 3K6SA 2GCEA 1Z8FA 2KSDA 4DL9A 1K5PA 3MA0A 1JHXA 5FWAA 1ZVKA 3O75A 3HU2A 3B1VA 3UG6A 3U56A 2E21A 1JI3A 2OYRA 1GZ7A 1SXHA 4M7RA 3T7AA 1FXKC 3CCRV 5ALXA 4G2KA 3D8CA 5J4VA 3JVUA 1GFSA 1VL1A 1Y7PA 3FOCA 3U16A 3MFQA 5BV0A 5IKPA 4O4LA 1IN4A 4IINA 1LV7A 5A2QA 5KNBD 2OSBA 1S2GA 4XCXA 2HV8A 5HFJA 3A1WA 2DKOA 5TARA 4PA3A 3AG1B 1TMYA 1UR5A 1A3CA 4F1KA 2X6TA 3I04M 2GTAA 4WY8A 1FDRA 2XIJA 2DYSB 3UUFA 4BC1A 4G4SO 1EA5A 3QY0A 1R0XA 1KGDA 3DO6A 1TUBA 3U44A 3T9CA 1QIJA 1RPRA 2W7TA 4QXOA 3FPJA 1Q50A 1XTRA 4A10A 4AQYO 3FPCA 5KQSA 5DKFA 3U5ZB 4IGFA 1DLIA 2CE4A 3OAAD 3ZDEA 2LBWA 5IT0A 1E1NA 2LBXA 1K3UB 4RE6A 1LBIA 4WZ6A 1AJQA 3PNPA 2BHSA 5L7YA 3VPGA 3ICEA 4J1SA 5C5CA 3BF7A 1UPTA 3E3LA 4YV0A 2DH6A 4UU1A 3H1LH 2O3QA 1AM4D 4XH9B 1SUCA 5CIQA 1JJ7A 4UCXA 3G3EA 5JCOA 1FTSA 3ASNB 1NBHA 2FXVA 4CN9A 2C2WA 3UQYS 3EY4A 2J5BA 2WJIA 3BPZA 4NCNA 3DD5A 3PD7A 2OHOA 4WNIA 1KZGB 1NBMA 3GBVA 3UJ8A 3FWNA 1II8B 3KOUA 3MTIA 1WS6A 2QR3A 3MJFA 1U9YA 3Q7QA 3T99A 1KAEA 1P39A 5DT2A 4ZEMA 1TW3A 3R7FA 3L4EA 4D4GA 4I7EA 4L85A 4BLOA 3HNRA 4NB5A 4PCAA 3UV7A 5K1ZA 4YIHA 5AKEA 3AFGA 1T1GA 3JQEA 2QP3A 4E5PA 1PFWA 1RWVA 5H9CA 3GJSA 1EEHA 1NZFA 3TMKA 1WMFA 1PVVA 2D3TA 2SKEA 3TI9A 4EI9A 2ZRJA 4CHTA 1ZD2P 5CTAA 4AF8A 5IH7A 1JDBB 2NO0A 1RMTA 5AK0A 3T7EA 1RWXA 8LDHA 1CERA 1RC8A 4A0HA 4ZQEA 4EMBA 1GGVA 3V8MA 2N1MA 4MAFA 5IF9A 3K72B 4BKMA 3AU9A 1II8A 1PK8A 3UBMA 4Z3DA 1C0IA 2VPWA 3LOUA 4AYWA 4PC1A 1P4GA 3CG4A 4DSTA 4M1ZA 4XQGA 5G0SA 4O25A 4U8GA 5JPDA 5J5VA 3FPSA 3NEAA 1MEOA 3U9SA 5B12A 1W3EX 3E7XA 3A6PC 2CCJA 4QLBA 1W46A 5KSPA 1VBNA 4OGQB 1KK0A 5F1KA 4K8XA 4GYWA 4HLUA 1YE8A 4J4HA 4R31A 4GVPA 5JDIA 2QMYA 5IJAA 3OZTA 4J0EA 2Y9PB 2Y0EA 3GXOA 2QVZX 5GJWC 3HYCA 4Y1RB 5F21A 1TO1E 1IYZA 3ZLUA 1OXTA 1G8FA 2I4IA 2GCIA 4JR1A 3LX5A 5IXYA 1ODJA 5JDCA 3LQ2A 2OORA 1TIBA 4KH1A 1Y82A 1VIDA 1JVSA 1M5IA 2FZ4A 4WXPA 1YK1A 2F9FA 4PZAA 2VPPA 2PZGA 1HV8A 4KPYA 1RBZA 1VQLV 4Y18A 3TTTA 1VHWA 4C4YA 4U3JB 2WA4A 1MHTA 2PY5A 3S3XA 3FCXA 1VE3A 1QLEC 1VLMA 2I4RA 4NWOB 2W4MA 2CKMA 3JSLA 2B92A 1YGPA 5I7FA 1B00A 4E3ZA 3TEMA 3RRBA 1BCRA 4M6WB 2OBLA 2C3YA 1WXHA 1EHCA 4N39A 3NASA 5I4CA 3CVJA 3FSGD 4OBWA 3IHKA 2ZIUB 4ED9A 2C54A 4ASUD 1JFTA 4UUBA 3C1UA 3WFZA 4G85A 1K92A 2RKBA 2NN3C 1PG5A 3WIDA 2VPYA 1U5BA 2QVYX 2VTDA 3F6BX 2GUZB 1Q7YW 1X7PA 3FCYA 2VDVE 4BIZA 1QTRA 3U5TA 1I3KA 4DM3A 3ORFA 1X70A 2JA1A 4UD6A 1ZVMA 5P21A 1ZD4A 3E9QA 1CF4A 5GIPC 4U3JA 5LHHA 4RSMA 1ILWA 4OK6A 3UGJA 1PJZA 3E8MA 4IUYA 2Q2VA 4ZGWA 4WUVA 4ZMSA 1BJRE 1OSNA 1ADCA 3H16A 2POQX 3NOOA 2P6YA 1Z0KA 1KWGA 4B81A 2ZUBA 2X4LA 2Y6VA 2GTSA 5AJVB 4US0R 2VJKA 3M6AA 1A2QA 2FHPA 1I7NA 4I9FA 3B52X 4CDMA 3JR3A 1VQOV 1FSZA 2AW9A 3TG2A 3ENNA 1L7AA 5H9VA 5E95A 4BX0A 4A03A 2G0NA 4R1MA 4PICA 2EDAA 4NWIA 4IV8A 2GUZA 4A7PA 3GW8A 3QYJA 1SHUX 4ZYUA 1UBHS 4YMWA 3KHNA 2MWMA 2R62A 4CCYA 4IMJB 1O6CA 2E6KA 5C8XA 3KQKA 5K0JA 5B1HA 5ALVA 4O59O 3G0IA 2VJPA 5IYBO 4AYXA 1XKTA 1Y1TA 1UDXA 3LWQC 4RY8A 2Y2UA 3UH0A 5EI5A 3IQWA 2AR0A 3HMQA 5DI9A 2M6LA 2J48A 4E07A 3AG3B 2BKVA 4W9MC 2MYPA 2XUQA 2W0FC 2AN3A 1I94O 3R23A 2AIRA 3GGJA 3AVVA 3S2ZA 4YI5A 4OOEA 4IUBS 4LBVA 4Z9AA 3TZCA 4EHKA 1BCSB 3TW8B 1GZ3A 2QD5A 2FF5A 1IBKB 5LIPA 5ALPA 5K3SA 2W2OA 2JFUA 3I8OA 1EX9A 4QOSA 3UW3A 1C0EA 4QTXA 1EFVB 3FGNA 3SZLA 3T80A 3D7KA 2G28A 3EZFA 4KVFA 4MTLA 5F23A 5FA8A 5BN5B 5FFMA 3GJQA 2LGWA 5FBWB 3FCEA 3VZDA 4DK0A 4GMKA 3MQWA 3F6SA 1WX1A 4CYMA 2PXCA 5JXJA 3EQ7A 4RHTA 1S0UA 3MJSA 1Z5PA 3WMXA 1WPGA 3AJDA 2WYWA 3ASNC 4ARVA 4D97A 3ZHZA 2DUNA 4PSKA 4CE6A 2AD1A 3TW8A 2O54A 1ZN7A 1EJBA 2DHQA 2Y76A 4H3KB 2OMEA 2PSDA 2PMFA 2QJWA 4PZCA 4FWTA 5EKXA 2AEEA 3UWKA 2MSKA 1H5NA 1USGA 5IC6A 1E2DA 1VQMF 2GCNA 1QIHA 4YN3A 2BYTA 3CKMA 3OI7A 3BQ9A 1M2HA 3Q3GE 3KJJA 1PNQA 3BWMA 3ZZ0A 2O7QA 3NHYA 3SYPA 3UJPA 3SR2C 4HLUC 5EHQA 4YREA 4BGIA 4WN9A 2PV0A 3OA2A 1BQEA 1WB8A 5U4QA 2QNBA 4WZAB 4E7PA 2ZANA 5DM70 8GPBA 2P6NA 4UFPA 3G6BA 4QYMA 3VHLB 1JDBC 2QW1A 3R0PA 3TNYA 2JFPA 3IEWA 5FWYA 2C78A 5G3ZA 3MHSC 1SBHA 4QOGA 3NALA 3GCDA 3OPVA 2DOSA 3QQ5A 1AMNA 1K6MA 5CYPA 3L0PA 2EIMC 3MCTA 2Q3DA 4BN5A 2QR2A 3BL5A 2UYOA 3W6ZA 5BQPA 1HE4A 3FB6C 1BYUA 1H0RA 2YWRA 1V8ZA 1MH1A 4CF3A 3GJZA 2YXNA 3BWDD 3VNRA 3DZBA 2XJ4A 3CIOA 4N0EA 4AULA 2WA3A 1VG0B 1L5ZA 3VO2A 4C7XA 4DXHA 1H42A 4MJXA 2ONJA 1XEWX 1EVKA 2ZODA 4P81A 3KOXA 3MTDA 3NHMA 1W36B 1JIVA 2H85A 4ZOLF 4PWYA 4WZAA 4ZO9A 3BCHA 3HVRA 1UKEA 2CLDX 4UU0A 3AB3A 3AF1A 1Z6QA 2ZBVA 3EAQA 3VX4A 4DEVA 3H0CA 4MVUA 3H5VA 1FP4B 5SZHB 1Y1KE 3PDCA 1DGSA 4UHDA 3OIVA 3EA0A 2YJTD 2VQSA 3JQAA 3LSQA 2H1VA 4FB5A 3I6MA 1LV8A 5HP4A 3PVZA 3VPBA 1WRBA 3JXEA 4LXQA 4BQPA 2OY0A 4INAA 1SUPA 2DJ5A 2EGUA 3PWZA 4NP6A 3FOFC 3PDWA 4LMAA 4CMGA 4E70A 2CXUA 1EFTA 1VQ9V 3KD3A 2ALJA 4QQ8A 1W40A 3K8QA 2ODTX 1QQAA 4MVJG 1YIOA 4HDKB 1AGXA 1QAQA 3Q7TA 2C5FA 3UT6A 1JA8A 1FNNA 2OBFA 4ADSG 4DYHA 2UKDA 1YR6A 3WSVA 3MD9A 2JJ2D 1XZJA 3ZY6A 1GRQA 4YMVA 4ZQFA 3LRPA 2P0AA 3GROA 4WLEA 4R54A 2VSNA 1ZK0A 4URHA 5F7XA 4Q3CA 2ECOA 1HOXA 1R9GA 3VU1A 1IXZA 2OFPA 4LJAA 4MA4A 1KI2A 1JDPA 2WWTA 3Q11A 2WJYA 4JLJA 1OE0A 3JWEA 3HL4A 5AKIA 4O2LA 4IMRA 4UNNA 4Q12A 1ZJWA 1IULA 4P22A 3KOZA 1QGYA 3KVNA 3WGNA 3MJVA 4HGQA 4IEFB 1J42A 4LCJA 3AUFA 4HDKA 1EG2A 1SHZA 2IE0A 3OKFA 5L3EA 4QFBA 5FNVA 1E1CA 1PYOA 3IS3A 1GN9A 4QOFA 3PGVA 1IBLB 1ZESA 2RHOA 3FCCA 4XFJA 2VSFA 1VSBA 2FUNB 3SVLA 1XZDA 1D9ZA 3O4RA 4ZXFA 1PS0A 5EXEA 2JFQA 1YMUA 1XCPA 3I28A 4BDTA 2JNWA 2RAFA 4JGGA 5JYCA 2WIBA 5LZ7A 3PKIA 3DWEX 4X00A 4CM8A 1SB9A 1P0CA 5JD4A 1C0KA 3TW6A 4Z4HA 2V1XA 3MWGA 4QXPA 4A6XA 3ZRSA 4DCCA 1DQRA 2P3QA 2E4YA 4OXKA 3UV6A 3ND6A 2Q3JA 2FMXA 1TCBA 3AG3C 3N70A 4GL4A 4IDNA 2WWIA 1IBSA 2AHRA 5I9IA 3PC3A 1UC4B 2J3DA 3FUCA 4JQSA 2IK8A 4RHAA 2IYTA 4J7ZA 1XL1A 4C5CA 3KQYA 4MINA 2IY8A 1P7ZA 4HWSA 5E0KB 1JHRA 1N7HA 5IS2A 3KQTA 2H6LA 1Z4IA 3TI7A 1HLFA 3BE4A 3GDWA 3RBXA 3E9RA 5E0OA 5IBPA 3PGLA 2HEPA 3MZ0A 1YEWA 4MPTA 5JG7A 3AHHA 1KJ8A 1FUIA 5IBCA 5AVJA 4EL0A 4QRIA 1NSYA 4CIWA 1W59A 2Q0OC 4F4LA 1MAVA 1XJQA 3QLTA 3ETNA 1ZAKA 1O0BA 3ROPA 5KHIA 3HSYA 2BMJA 4CQNA 1X38A 1GA4A 4HSEA 3OP1A 1UP4A 3OY7A 5CLIA 2PGXA 1PX2A 3LPMA 1LX6A 5JI2E 1PJCA 5F3WB 1QK4A 4DR3O 4JKOA 3S2YA 2IX9A 3ROXA 1YCDA 2AK3A 2D59A 2IYOA 4BRWA 1DG3A 2I7DA 4F4DA 1WOYA 3HU1A 2YQZA 4RE5A 4A8JB 2WSMA 2BR5A 5DBHX 4ZIRA 1T9ZA 4BRZA 2JW5A 4BJ6A 3TL6A 4D5GA 2GZAA 2C42A 2OV1A 5GGYA 4HQRA 4C3UA 5DECA 4DLXA 1C1YA 1XP5A 1S5LZ 4JC8A 1TA0A 1JV2B 4CMIA 4EW1A 5T67A 1J8VA 1Y34E 4RKEA 5JE8A 3B1XA 2EW8A 4JEIA 3I9V6 1DCFA 1F14A 2V5UA 1SUDA 3FRJA 3IDSA 2VKQA 5BQXA 2XZTA 5G1PA 3PNOA 1V1RB 2F95B 3JQFA 4TN5A 5LP6F 1M66A 2DHCA 4FKBA 2JJ1D 5MGNA 3IB6A 4BBZA 1CR1A 3TQIA 4G4JA 5TT0A 1A8PA 4R3NA 3DEIA 1ZXLA 3C8HA 5JQGF 3ZHQA 2X15A 2YV1A 3CH4B 4YK7A 2GR9A 2G1PA 1OGJA 1NVVR 2HA0A 4Z4IA 4BBJA 4H3VA 4DSZA 2V8BA 3KBOA 2WT4A 2VT3A 2VYVA 1OCRB 2IEAA 3GLQA 2PNFA 1GSIA 4OBEA 5DTRA 1G21E 4AUKA 1JLLB 3O7WA 3I76A 3DLHA 1AGPA 1XVAA 5DX0A 1IC6A 4N76A 5FBLB 1X8LA 4YC7A 5GTIZ 1KK1A 1SOMA 1UJ6A 3ETQA 2NO6A 4K87A 4ZT4A 1DL5A 2PT7A 4OJYA 2WF7A 1NFRA 2XE6A 2EATA 5GM1A 3RU3A 1U0JA 4R71A 3BD6A 4Q4CA 1UJ4A 3ESDA 3F5FA 4ER7A 4F3TA 1E1MA 1U0RA 2ZTMA 5DXFA 3TG8A 2IP2A 3ESAA 3FAVA 3ON1A 4B31A 5F33A 3TEFA 2QA5A 2P9ZA 5CB4B 1B23P 3AFMA 4TXJA 1U94A 2PPVA 3MT7A 1PD0A 3MAJA 4EEKA 1SQ6A 4JROA 2W2KB 4YY3O 2ZBQA 3HNOA 1WKCA 1JLLA 1P62B 3R8CA 4TV9A 3MBOA 4B4WA 2ZOVA 1NRJB 4LFBO 2QUBA 5KTKA 2QDXA 1ACMA 3DW1X 4L9AA 4WRRA 3ZJTA 3GFSA 1TW2A 3EH1A 4KI0A 1UPXA 2G1KA 2OTLF 1Q6IA 5DM1A 2IH4A 3I01A 4Q9JA 4JAUA 5GQSA 3FVWA 4QYXA 1HL7A 4QULA 3L06A 2WMNB 1X7HA 4UE2A 3VI4B 2VNJA 2Q6AA 3ZMUA 3WFVA 5ALEA 3CEPB 1AILA 2ES4A 3ZW8A 1DWQA 1N0VC 4MQUA 4IIUA 1ESDA 2W2KA 4XJXA 1DBIA 4DWOA 2HRZA 4UBJA 3Q8LA 3VR3A 3F67A 1HFWA 4J1TC 2C7GA 5HFNA 4DR3B 4ZCIA 3SYAA 3IP6A 2HXSA 3B38A 5JAQA 4IJKA 1PQWA 5JMPA 3BX1A 5IUJC 2Z9DA 1SURA 3EZ9A 3E84A 1VL0A 5IVPA 2J33A 3TSCA 4Q5IA 4C4RA 2GRAA 3QO7A 1H6BA 3N2LA 3SDSA 1F51A 3T9FA 4OH7A 1VF6C 1I6KA 5JISA 3D6VA 2YQ4A 4F5ZA 2O8FB 2JI6A 4LHYA 1RMQA 3R74A 2PSJA 4LHWA 3L41A 3MYRA 5L3VA 2Y1DA 2GPAA 4LOKA 1PBNA 5KBYA 4B7KA 1E3IA 4LI0A 1KYZA 3R8FA 2E9SA 1JJAA 4BV9A 1GILA 1MOQA 1JT9A 2R84A 4BX8A 2Z8XA 4GKAA 1M90W 4S35A 4R9NA 3HCNA 4DWWA 4AY6A 4MIKA 3GJRA 5LQCA 4LIPD 3NFYA 2LCAA 3I6IA 1Y7IA 4F97A 1WZIA 1SU8A 4D56A 2YY5A 1EWTA 4E14A 4WKCA 1WY7A 4EX7A 5DNEA 1PEDA 4Y2XA 4F21A 3R0QA 3MCUA 4CLXA 2AV6A 1NNLA 5I9NA 2QVLA 2H0RA 2P6PA 2FEPA 5A5FA 2WSSD 4LP8A 1LGYA 5EWLB 2PGAA 4C0WA 3EZ6A 1BT8A 4KWTA 5CTJA 3ZHUA 1A2BA 4ESHA 3S5JA 1QIDA 4XQCA 3WLPA 3RIEA 1ZOIA 2VYFA 1G4YB 3ETDA 3PENA 1O0CA 2V97A 2WV7A 3IE2A 3RC2A 3IUPA 3OX2A 1LS1A 1RJDA 2WFLA 3LHDA 3TIGA 3WKDA 2FMLA 4JASA 4X3OA 1DMSA 4KDFA 4HZ3A 2JIZG 1IJKA 2XWBF 4C0XA 1XF1A 4OHYA 1QCZA 2ZCJA 4RORA 3HVHA 1Z5ZA 1VIMA 4UNQA 4MQMA 3WTBA 1TUIA 4G2NA 3P4XA 3P26A 3RK1A 4N54A 1RI1A 4N5LA 3BK1A 2K2QB 1JEYA 4BBAA 5ARDA 4A8JC 1XTVA 5EWLA 4P33A 4EZEA 1UF9A 4RK7A 4IOJA 3GJTA 4PZ0A 4YNBA 4PYQA 2BLNA 3LW7A 4DCSA 4KMOA 3THRA 1FMFA 3CMEF 2Z01A 3SHWA 3KSDO 2IYAA 3HB5X 3C2QA 4PHCA 3R09A 3IP8A 4IFTA 4GPIB 5FEUA 4Y1GA 4E51A 1VLHA 1YA6A 2PAFA 1U4SA 3VR4D 4OFBA 1FFWA 5ESWA 3ZN0A 1U0GA 4BV2A 1QP4A 2XVAA 1C3OA 2H08A 1A32A 4W82A 4IZ6A 4DBLE 1O96B 3CUKA 1FP1D 2UZAA 4PPYA 2Z5LA 3W9SA 4XUCA 3QMPA 1XZKA 2PBZA 5FQOA 5CW2A 1I3MA 5KYXB 3OCYA 1OCRC 4YO7A 3OJOA 4OV6B 2BH9A 3SXUB 3IDOA 2GVZC 2KS6A 3IAS1 2C9ZA 1P0MA 4FKMA 1ESEA 3QTBA 4TLAA 4WNYA 4KHPO 1BEEA 2FPPB 4J6FA 4RNCA 2O4CA 2VPXA 3VKWA 1FFCA 3K2EA 1N8RW 3TO5A 3UAWA 4COKA 1E3MA 1DIGA 4I5EA 4NPCA 3MCVA 3CJRA 2KTUA 3QLUA 2H0AA 1LD3A 2WTMA 1JF8A 1PF7E 3NAMA 4ND5A 1RWMA 1O96A 4FM9A 1SQGA 1XZCA 3SIUA 4RACA 2QTNA 1WPXA 1DCTA 3FOAA 2DHEA 5KYXA 2M1XA 1XHEA 3PR1A 3RGBA 3SXUA 5FI1B 4P4SA 3DH0A 3L7OA 1XZLA 3MS7A 1BDHA 4YRCA 2CNWD 4J6EA 2YS8A 1UBEA 4Z8YA 2Z9BA 1GY8A 2EV9A 2I76A 1FVXA 5FBKA 2XI4A 1ZPDA 1Z74A 3K73O 2QRMA 5JZBA 1ZNWA 3LUFA 1DEAA 3L93A 4GDFA 3LX6A 1P1BA 1KDVA 2NU7A 3L0SA 1GZ6A 2GSMB 2XMBA 5JMTA 3DG9A 1BX0A 4B45A 2A5DA 3ZV5A 1JQKA 4K1XA 3VAAA 3FH0A 1MN6A 5AKGA 4ZO4A 1T4BA 2H06A 3P9CA 1USVA 3AL3A 2NPOA 4H59A 4KVAA 4D7TA 2QTVB 2DU8A 3WKEA 3NVKE 1VC2A 1XQVA 3DW3X 2QG6A 2DYKA 4ZWNA 3AM1A 3H05A 3SQMA 3KVVA 3SJBA 3HEBA 1Y66A 3AVWA 4BZPA 4U9HS 5DW0A 1C7IA 4Z9XA 2ZBFA 4B2YA 1T8SA 2VHTA 4U7TB 2Q0XA 1E4YA 1QC5B 1DE0A 5J40A 2RI6A 1UJBA 3CCVF 1RS0A 1Q7YH 2E5FA 2R6FA 1CB7A 4INJA 4C2AA 3S81A 1R3DA 1AUPA 1NONA 4X8MA 3E61A 5JO9A 3ZTYA 1M6EX 3QITA 3FPHA 4F4IA 4Q9KA 1R1DA 2QTVA 4H35A 1GQQA 5DN6A 2JD2A 1A4UA 3CRQA 2EX4A 1IXKA 4HB2A 2OO3A 2Q6OA 3ZWCA 5DYYA 1G66A 5FUXA 1LBTA 4ZDJA 4ZTZB 2D5BA 3TLBA 4ITRC 3ANSA 4N8EA 2IXTA 3RW0A 1TYDE 1VLVA 1IY0A 1QC5A 3CR7A 4CLRB 2JAPA 1X14A 3OMIB 3KX2A 3NPAA 1OJHA 4P36A 3PXBA 3S27A 2WPDG 5JTUA 1VJGA 5AJHA 4KQ6A 1R6UA 3R0JA 2NLJC 3T3HA 2JK0A 2XWQA 2H4WA 4PX9A 1OHHA 4DR6O 4D3SA 2VHYA 1XAJA 3QNMA 2EBUA 3SKVA 2REQA 1UWVA 2NZJA 3VR0A 2LR0A 1CCWA 4PYJA 2W6ID 4W7SA 1H5UA 2QKSA 2ZYHA 3PRJA 4BEVA 4KODA 3FG9A 3LK7A 3L79A 4Z5XA 7MDHA 1MZPA 3DLBA 2AZXA 4M9UA 1FLNA 1W34A 5EQTA 1KPIA 3LVFO 1TGYA 4RSHA 2PJUA 4HMQA 1G9SA 3PXEA 1AUQA 1Z15A 3C6KA 1U0HC 2FOXA 1UWCA 1R8JA 3VCZA 1DF5A 1WHTB 3DO5A 3ZCCA 5LDGA 2PY6A 1YOBA 3MUEA 3FDZB 5BYJA 1N2IA 2E7ZA 4O8ZA 3HHEA 2PKWA 4ZVVA 2F43G 4D4JA 1WJZA 3CRZA 4LCUC 1UOPA 4H60A 1I24A 4PBSA 4CEJB 2AA3A 2AMVA 5JASA 1F2TB 3ER6A 4Y2TA 3PLAE 1N6KA 3HCEA 2VP3A 1DO8A 4R84A 4LC9A 3OCZA 3Q8MA 3L46A 4LAFA 4CL2A 1AGNA 4BTVA 4NYJR 4P38A 3LT0A 4XIJA 3GMDA 4K8OA 1MOPA 2Z8ZA 2ODQA 3DLIA 2F1IA 3GIDA 3AWDA 1KO7A 1Y6JA 4C7KA 2WDPA 2X1VA 1X7YB 1U3FA 2WHPB 3OKAA 2XAGA 4MP6A 4AS3A 1OJ7A 4ZTUB 1QUEA 1WHTA 1JHMA 1SC1A 2ZWMA 2ERCA 4XIIA 2YOHA 3N0XA 2CL0X 1NV9A 1G17A 1JG2A 3IOYA 4QPZA 2ZULA 1FA9A 4D5EA 3W8FA 3R3YA 1XWWA 5EGSA 4CEJA 3EVZA 5CAEA 4CQLB 2V0CA 3U3RA 4RKQA 3W05A 1RXYA 1NVXQ 4X8LA 3HK2A 3AV3A 2CMFA 4KQKA 2OCCB 5FPKA 2C2BA 4YHHB 5CFRA 2FMHA 4DLLA 3RKRA 3AKEA 4Q1DA 5IYDO 2QM3A 4L75A 3E5MA 2XBUA 1MTOA 1MENA 1KQSU 1ONBA 3WLEA 1EPUA 2WHPA 4JLVA 5LMNO 4LGCA 3UICA 4JQCA 1P0IA 2VJYA 5LQMA 1DQYA 3QVKA 3A05A 1JKJB 2XZDA 2J9XB 4A15A 1OU4A 4EDFA 3OTWA 3L5OA 1KIFA 3BXZA 3AUKA 1FFEA 1JJ2F 3B8EA 4XUGB 4MV1A 1U90A 2BRUA 2J6BA 4IX9A 3SSOA 1U31A 2Y1KA 4G4GA 1I1HA 3V1NA 3MF4A 2O52A 3H04A 4RTLA 1K6JA 1Z47A 1L7NA 2E18A 1Z6TA 1P9WA 1ZJ5A 1KIMA 2LD4A 4ID9A 3QW4B 2ZBDA 3QHQA 2L69A 3LKBA 4ZQIA 5IT9A 3NNSA 1VYUA 5TR9A 3ELYA 2Z8YM 5EWMA 3F0FA 1MIHA 4EG6A 4MTFA 3F46A 3ABKB 2P2YA 4HLQB 1JZTA 1ZY2A 1OCZB 2WQ6A 4P7GA 3UXEA 3BMNB 4N5HX 1WMEA 2ATEA 5FBZA 1P80A 3QWIA 2FZWA 5BR8B 3WJAA 4W5OA 3P4EA 1JKJA 1VCMA 5I8PA 3G85A 5BRJA 1DJLA 1AB5A 5BO5A 3GMSA 1LNZA 1M6VB 3RWMB 1MABG 2EINB 4ES6A 3OQVA 5C8ZA 3L0YA 2OKCA 2C04A 2BLLA 3L72H 1S6YA 1NVBA 4ENRA 3KPVA 5LD2B 1A69A 4F8EA 3KTDA 2WMOB 3LC1O 3ONWA 4BS9A 2F8LA 4LY0A 5K01A 5FWDA 4AMUA 3TNFA 3E86A 2FEMA 3G7SA 4OAPA 2HYDA 3WGJA 1PLKA 1CJTC 2K1SA 2HOQA 2AOXA 4KR3A 1BE0A 4N3GA 3ABLB 4H0FA 2IOFK 2Q1XA 4Y9TA 5HCIA 3NBFA 3OO0A 3WYNA 2O8EA 3U3DA 5JNSA 4XD2A 1RPZA 3DOJA 2X6CA 5FJJA 2XQFA 4WKGA 2WA2A 4GW3A 2EFCB 3QX7A 3BMNA 3ZJ5A 1Q20A 5EJGA 1YV9A 1NVPD 2OXFA 2UXCO 1YXBA 1RKUA 4PSAA 4DADA 2CTPA 1YULA 3TPFA 5EZYF 4ZYVA 1Z6GA 2JJQA 1ORIA 2A4KA 4LFAB 4MWCA 1NKTA 4QO8A 4E0BA 1W75A 4OIMA 2J9FB 3DOCA 2OYSA 2QTSA 4EEQA 4KFMA 2E6UX 4M1TA 1Y4MA 3MDSA 1S89A 1HR0O 1CIJA 1I0IA 2VHWA 1JSXA 1PTKA 3OQOA 4XB2A 2BFMA 2P5UA 1YBHA 3QMWA 3JZIA 3THYB 1MRNA 3W5UA 3JQ7B 1ZIYA 1T9GS 1D07A 3LBYA 4NR0A 4QBTA 1TIKA 3K9FC 2O2ZA 3U7GA 1PVDA 5JXWA 4WLFA 3E3NA 2ZTSA 1U0OC 2C8KA 3OCCA 3QBEA 4JELA 2FPKA 2Q3MA 2HQSA 5GINC 3FM9A 4HBGA 1XVIA 1RM0A 1T2VA 3N6XA 3ODGA 5JS2A 1YR8A 4ND6A 3GHZA 1SVUA 4JA0A 4BLRA 5ESXA 1VP7A 1G9XA 1EDEA 1JEEA 2J9FA 5BT8A 4R1TA 3PEVA 3ZY3A 1QH1B 2XMSA 3KLMX 4O4LB 1HTBA 3CRRA 3BFPA 3L7KA 2GK4A 3ZWYA 4F7WA 5LMNB 1TVKA 3QKWA 1K33A 3DGFC 3THYA 1IK4A 3UGTA 3WYDA 3S2GA 3JQ7A 3RT7A 1KEEA 3EIOA 1SVOA 2WABA 2HMYB 5GONF 5BW8A 3GF4A 1KRWA 1FNBA 4P80A 3CSSA 3GD7A 1LTQA 1BKYA 1XP8A 2EHJA 3W7SA 1TUBB 2BM1A 1CJVC 3TM4A 1YDEA 4XGIA 2JH8A 1IXYA 1XALA 1P7GA 1PTJC 1N32B 4JLUA 4K46A 1ECGA 5L3BA 5KNCA 4M7PA 1GXSA 3ZDYB 5DNAA 2K7ZA 1Q90D 4R1QA 4QDKA 4RTOA 4TUYA 1QH1A 2V6BA 2P6MA 2WJ3A 4ETMA 5K0ZA 1DC7A 2EKQA 1LPOA 4IXMA 3L8FA 3R7SA 2VDQB 4AY2A 1IEVA 1Z8HA 2DSNA 3BJRA 3WLQA 1GTG1 1WTCA 2B1JA 5ALRA 1CUEA 4HRAA 1NXPA 1SERA 4RZXA 3A1EA 3P9XA 1V48A 1JG4A 3F8SA 1YBMA 3CPWU 4CLEA 2V0GA 1QKIA 2VQFO 3ES9A 4RHCA 5F5NA 1W4CA 2WWWA 4I9UA 1GVNB 3HFGA 1H2WA 3RUCA 2CSXA 1UK6A 2GILA 3HKCB 3OZCA 2WTUA 2D0IA 4GLFA 4H0NA 4D3DA 2X0DA 1NJ8A 3LUAA 2OCCC 4LDZA 5LBUA 3V4SA 3ZIDA 4ZODA 1V16A 3IP3A 1UDAA 3SIXA 2XCOA 2UXCB 1BVHA 5TLSA 1DG9A 1YZNA 5EG5A 1KO1A 2X1LA 3F97A 1R0RE 2IVFA 3CX8A 3P71T 2A1IA 3V9PA 3SM9A 4MTCA 1MPXA 1XAGA 3BJMA 5CIWA 4TTPA 4F2HA 4NENA 4AQ7A 1NM5C 3WG7B 4IDBA 4MDYA 5HS6A 5AUPB 4EJ6A 3SFTA 4Y3UA 3TMYA 3VH4A 2X2PA 3IMFA 2R6AA 3VZPA 4ECEA 2VWPA 4MICA 3P94A 1Y80A 3ZX6A 1Z0IA 2R7MA 1N34B 1RJEA 3HKCA 3QVLA 1BO6A 1NQVA 4BCCA 1WP9A 2DCUA 3DE1X 4FHFA 3H2ZA 1WO8A 3NT5A 2GGSA 1XQYA 1XG5A 4JITA 2PZBA 1QO0D 4DK1A 3DM5A 4W5NA 1W29A 4AJNA 5JXIA 4AXXA 1D2CA 5IH3A 1U3DA 4XPZA 4H4DA 3L4SO 2H2WA 4G9BA 1OCZC 4H1TA 2HVKC 3H8SA 1NBAA 3R3XA 2Q68A 1BHBA 4Z1MD 2I8LA 3WR5A 4G0UA 1JCHA 2A92A 1WDMA 4TM8A 1EUDB 4Y0VA 4FPXA 3ZHVA 5C53B 4YMSA 5FUWA 4HEJA 1E59A 3UF0A 1EK1A 4Q7EA 2EINC 1CQJA 5KVAA 3AK3A 3BMXA 3H5WA 1GGHA 1LR1A 1E1QG 1WP7A 4MP8A 1N6RA 1SKMA 1NVKA 1L5WA 1DRKA 3NIFB 3ELBA 4MW1A 2YN2A 3I39X 2PU7A 2FKNA 3JS5A 2ID8A 4EA7A 3A32A 4CLDA 3U4GA 5JUWA 1K8RA 5TNXA 1BCRB 4NULA 4FMDF 3TTWA 1OR8A 2R60A 1UEIA 4R01A 4BU1A 3QO5A 5C1OA 1Q1QA 4QFCA 5EJFA 4E1AA 2Q2OA 3AB7A 4ZHYB 4Z6KA 1L0NH 3O9MA 4D43A 3C15C 1P0QA 3ENKA 2PLFA 4RIGA 4CH3A 3P2EA 1U5BB 3LY5A 3W7VA 4OATA 5KWSA 2WLKA 1QRTA 1EUDA 5F98A 1F48A 3PJGA 4FC7A 4HVAA 4KO4S 3MMPA 3R5TA 5DGIA 4FUTA 1PYGA 1NIPA 1LY1A 1S72F 1OLXB 4J7UA 4BWVA 4R1OA 4IHJB 3BB4A 4AY5A 1P9OA 2R1UA 2XODA 3CYPB 1NLZA 2UXNA 4FX2A 3S0JA 3BD8A 2AWOA 1S8OA 1K27A 1ZGBA 4NBSA 1LH0A 2EJVA 3D2CA 4B7XA 3U62A 4AQYB 2GZ2A 4O1HA 3FYHA 4YRZA 4XWKA 4PHZA 4GX5A 1GNQA 1M73E 4N5IX 4AD8A 2I66A 3IPYA 1L7DA 1RW4A 4MHOA 1VQNF 1GL3A 2XVXA 1KKDA 1W1WA 2DULA 2ROQA 1Y3DE 1H38A 3T7SA 3CC4V 4GZMA 2ZYTX 1ACJA 1TVMA 3ENVA 4AKTA 5AHXA 3LWPC 1OZ0A 4YWHA 4HQNA 2VAMA 3E0XA 4S0XA 1B1AA 4CCYB 2L26A 4LZWA 1M90H 4B8YA 5AOAA 3RRNA 1MSWD 2F66C 3CKYA 3HYTA 1OLXA 2MU1A 2CXPA 1KFKB 3DXRA 4IHJA 1M72A 3O03A 3TGLA 3KJQA 1W0JG 4NDAA 1E1YA 2GD1O 5TSDA 3D4LA 1ONPA 1CIPA 3ZW9A 4B44A 3OWOA 2IEDA 2ZUEA 1R9JA 3ACBA 1MKYA 3OKPA 2G1UA 1VQPF 4ZVTA 4EUNA 4BNDA 1K97A 4KP4A 4FMTA 3AR6A 1SAYA 4ZICA 1J33A 3GGGA 2EYQA 2JATA 2H1LA 1YHNA 4L4SA 4KQHA 4FS3A 1WUTA 4C7UA 1NQXA 5ARCA 3QSYA 3G6WA 3E2EA 3JQ6A 5IT5A 3SHQA 2EQBA 2XOEA 4X85A 1OAKA 4HAYA 4GR5A 4XLTA 4GX1A 4PN3A 1WUHS 5I9LA 5AW3A 5KU7A 2I6UA 1W41A 3AR8A 2N75A 1X9IA 4A2CA 4MVJD 1BMDA 4W5QA 2BOBC 4B3CA 3CUWA 3RE3A 5J4YA 1S1CA 3TGWA 3AG1C 2QTBA 1Q7GA 4C4TA 1CG6A 5JCOC 4Y9DA 3WLMA 1RP7A 3KDAA 4PF1A 3KCQA 1HLGA 1ISRA 2DYSC 3ZE9A 5JI3E 5HY1A 2XOKG 4JOCA 3ESQA 4UULA 2WLTA 1L6RA 3KP1A 2HA7A 1UJ2A 2JGJA 2O1WA 3RC7A 1HFKA 5K7SA 3HLTA 1HT0A 1CUSA 3ZGLA 1E94E 1MDFA 1KETA 3R0IA 4PLPA 4Z1MG 4PHTA 1E1KA 4F2DA 3DTVD 1IVSA 2COEA 3PFHA 3AHEA 4LZNA 1MORA 1G59A 4FIDA 3EEIA 1K06A 3SICE 4ABMA 2PZLA 1BU8A 3K92A 1SXIA 2DETA 2HW8A 1XMVA 2N48A 2YNMA 5IE9A 1MUUA 3KYDB 3VBCA 4JSRA 2PUJA 2IHVA 4WN9B 4DV0O 4GS5A 3MCWA 1L8XA 3P7MA 3AEZA 5ALDA 2XV1A 5DTJA 5T6BA 3WS7A 1BQ0A 4KWEA 2PXAA 3CCSV 4FGJA 1KECA 1HETA 3GEHA 2WWHA 2GFIA 2I1WA 4ZJZA 3F9RA 3W3ZB 3P2OA 1B43A 3INRA 3IOEA 3PL1A 3ZBHA 4U7NA 1N2BA 1VKOA 4NU5A 2ZIWB 5FWYB 1LBEA 1Q2UA 5A4FS 4F85A 5KIAA 2A5JA 1FXWA 1BWQA 4GECA 2IBZH 4GX0A 1XTPA 5AM4A 3OJLA 1YKFA 2PKXA 4WAUA 1CZHA 1N8RH 2CWJA 2IDZA 3DCNA 1I4WA 4E46A 2PBFA 5HILA 2IOHA 2JS5A 2FSGA 3K09A 1J0DA 3ZYCA 2AUTA 2VPZA 4IXDA 5DEIA 3WFIA 2HS3A 4Z0TA 3USZA 1QQ5A 3AEKA 3KYDA 3WLKX 2BMVA 4NU0A 3CM0A 3M4JA 2WK1A 5LBTA 3OIDA 5JDIC 1YB4A 4KXNA 4YRBA 4UDYX 1E0DA 4C7OB 2IXEA 5M5BA 2HRCA 1UC9A 1IIBA 1NVDA 1AQNA 1T8RA 1WVMA 2ZRPA 5CW1A 3MLAA 1TFRA 5JDCC 3CLRD 3CD6V 2PL1A 4N03A 4PIPA 2OORC 1AQ6A 1GO0A 5G2OA 2VZ0A 3ANMA 1Z28A 3UGKA 2QXTA 2I6XA 5BOVA 4I9GA 4F45A 2DM6A 2Z1FA 1JJBA 2BI8A 3JQAB 1V5IA 4DANA 1I80A 2IAFA 2VCHA 5DT9A 2AOTB 1ZZGA 2WIFA 1XEAA 4C89A 3M99B 3VDRA 2YIBA 1A95A 2XLCA 2WKWA 2PXXA 3M6IA 5AXCA 1QIEA 3OSUA 5DM2A 4ZEOA 5E2BA 5IXJA 3WYEA 1N0IA 2ABWA 3PEYA 2QD1A 2ZW9A 5LQSA 3I37X 4WY5A 1TKAA 2DF8A 1C3JA 5AQ1A 4C7OA 1K66A 4M9RA 3D7SA 4ZQGA 4FW8A 1ZTEA 3UY4A 3HCPA 3ONEA 3SS8A 4JMLA 3UCEA 1YZGA 2C7OA 1FK8A 4EJMA 1SXJE 2RJZA 1Y63A 5LZ8A 4H1HA 2HS0A 5KNBA 3GLFA 9ATCA 5B1EA 5EA2A 3ZXUB 3E5RA 5BNWA 5LNK6 1I94B 3R6GA 4AJ1A 2AOTA 3D7MA 4DV6O 1GQOA 3MS2A 3OLYA 5DM4A 3QOYA 3ZP7A 1WEKA 5CFOA 2VHQA 3P27A 4HDMA 1SESA 2G06A 1RMYA 3TJMA 1GL6A 2FN7A 4UVDA 3WAJA 1BWPA 3QE0A 5FNVB 1E1CB 3CXCU 2AUMA 5F9MA 3HJTA 4MVYA 3H8VA 5CUQA 2H0QA 3I9KA 3OAAA 4BGUA 1ECPA 1R5OA 4IUDS 4JJIA 3SQLA 4Z54A 3K0SA 4UTNA 1L5OA 1KAGA 5T7BA 2IYFA 1L7XA 1Z5GA 2C7QA 4DYDA 4X6LA 3PUJA 1M5TA 2O14A 3OTQA 4CM8B 2PU5A 2L19A 2K7FA 2DVMA 3OLWA 2HU7A 4A4DA 5CLLA 4IIHA 3GWKC 1NTZH 4C1BA 1SVWA 1WULS 3KO8A 4QHSA 1OIVA 1SOUA 5EZ6B 4EMUA 1AU9A 3AOGA 3ESYA 1N6PA 1N75A 2HXYA 5DISB 3NW9A 2D8AA 3W4IA 2R72A 2PD4A 1D03A 4ZCPA 5I45A 3DWGA 1BRMA 4KH0A 5HEKA 4WERA 2I91A 1S96A 1TXGA 4JODA 2JL1A 3O9VA 4B4KA 4KQXA 1BROA 3AWIA 1X87A 2QRQA 1ZISA 4QEZA 3I4CA 3DHNA 3H5TA 2WG1A 4JBHA 4OSEA 2JH3A 3H2KA 3BMQB 3OZGA 3MGAA 2WHRA 3U7RA 5KQGA 4NQRA 5AR1A 2RGWA 5EPUA 3NU1A 4II2A 1CJUC 3KAPA 4DQVA 1OV9A 1QH8B 5EMLA 4CGYA 1XGKA 1PUXA 1TQ4A 1NVAA 5JARA 4LXTA 4OMDA 1IK6A 4QPJA 5LL6P 2JLWA 2BT4A 5I7HA 2OBNA 5EMNA 4BYGA 4D0SA 4ZIRB 3VR2D 1WCWA 3IBFA 5JU6A 3VDMA 4IVRA 5HQ3B 3T5CA 3WXBA 2BGWA 1V25A 3SJZA 1R6AA 4CMIB 1QP8A 2VQDA 3NEPX 2Q28A 3ZWXA 4HT3B 3PEWA 3DFFA 1RM1B 4MQEB 1VQ6V 3BMQA 3IT1A 1CJMA 4QAQA 3C1OA 1EDBA 2B8WA 1PL8A 2ORVA 1P4RA 1WB6A 5C7IO 4O4IF 4X94A 3IKVA 1R9MA 4PSVA 1QH8A 2EKZA 3VZRA 3LT1A 2GEFA 2XUJA 1ODIA 1DTWB 1RE0A 1VE6A 2ZDQA 8OHMA 3TE6A 3TWOA 1H3NA 3N8DA 4MA5A 2X5NA 4Y2YA 4NMWA 5DGDA 4RCYA 4Z53A 3CW8X 1SKBA 3A7EA 5FPPA 2HWUA 3TIVA 2J9RA 4EQZA 4AILC 3WGTA 4FM0A 4NBKA 4RTMA 2QU7A 3I3OA 3IDQA 3CLTD 5EC2C 3AZPA 3PGKA 1N6IA 3BORA 5JC1A 5HQ3A 2JHAA 1WLSA 5A4DA 1GNTA 2EFEB 4WXYB 5HPYB 5U9CA 3PICA 3KXKA 4MQEA 3EGDB 1U63A 3FSGA 3ZJZA 2DLCX 1KJQA 3M3HA 5KHJA 1JQEA 2HHJA 4F3KA 5HIIA 1C0LA 5CU7A 4ASUA 3BFRA 1H05A 3PC2A 1GX1A 5AW6A 2XUMA 3STHA 4ARIA 3EZ2A 2SKDA 3NCHA 2J87A 2J3EA 2WJAA 1WCV1 1XPRA 4ETIA 1DTWA 4HVLA 5ER9A 5B64A 2B82A 4WA8A 1SFRA 3FAVB 3KB2A 5KYGA 1KBQA 3H5OA 2NVWA 3LGXA 3GAAA 2BI7A 2ANBA 1KC3A 1XELA 3S3WA 3Q15C 2HU5A 4FMBB 1BFKA 1E89A 4HCJA 1KP2A 1IY9A 1UXJA 2AHYA 4KXMA 4TV9B 2B1RA 3U4QB 1QFSA 4B71A 1QVZA 1OXKB 2JIZD 1YDHA 2ASEA 5L3ZA 3H5AA 5DU2A 3RWBA 3EGDA 1ZK1A 4R1PA 2UZ1A 1XROA 3VYTB 3RPEA 3FGZA 4OAOA 4BMXA 4WKOA 4BU0A 4RJ2A 3WWPA 4D96A 3B1JA 3L4KA 4OX9Y 4CMKA 1W36C 1U3WA 4LDNA 2FWMX 4AG6A 5B6JA 2D62A 2PVSA 3EGCA 4BO2A 3DOFA 4PA7A 1E7YA 4G56A 3AQIA 3J80A 5A03A 3A0BZ 1BHSA 1Z4QA 3Q72A 3MJ4A 1XRMA 3SQDA 4MCIA 2BGGA 3AVYA 4JZGA 1YZLA 2WUEA 4WXMA 3NDJA 1RBYA 2NSDA 5HIAA 3JD4A 4J9VA 4GI2A 3I5XA 3U4QA 1E69A 3CT4A 3FUTA 2H4ZA 5JYDA 3IKFA 1AMUA 3JCMM 3CCUV 1KSHA 1CZUA 1QNFA 3ETEA 4RPKA 4KO3S 2WP0A 1RA4A 4PAGA 1WQ4A 1O03A 4HG2A 4EHHA 3GLRA 5HY2A 1GUAA 4L4RA 1SG9A 3FI0A 5C4MA 4B3RO 4ATNA 5DGCA 1AI4A 2GH1A 1G42A 2NTYC 1NXOA 1PR9A 4KK4A 2Y8EA 1AXRA 1C4WA 2I2AA 2RN9A 1AUXA 2Z5GA 3TRFA 4HAZA 5F64A 4YPVA 2V7QG 2L18A 4JLNA 4FHGA 1Q3KA 2B8JA 1FTNA 3Q6NA 1A27A 4RIHA 3V4ZA 1PL7A 2P4QA 2CTWA 2ZINA 4MR7B 2ZS8A 4PQYA 1SHLA 1SCDA 2BGUA 1MD9A 4C30A 4DGQA 3M89A 4HYQA 5FL3A 4BFWA 3T4ZA 1YJ9V 4DSOA 3OOJA 3G9TA 5EPOA 2JA2A 3K0HA 4GNKA 4EK9A 4W1QA 4AZSA 2OA0A 5CDGA 1MQ8B 2IL1A 2O2XA 4YRPA 1PFGA 3B9PA 2IDKA 1T9BA 3PHLA 4HZGA 2II6A 2CXOA 3H2JA 2H3OA 2OV3A 2CUGA 2ZRGA 3I64A 4IYRA 2I1QA 5FV7A 3ISJA 4TWIA 2WFLB 3EVFA 4RV9A 4JASB 2ST1A 3OZBA 1QVGF 1XCLA 1I9CA 2IBMA 4MR7A 1T5SA 3A7DA 4JF3A 3LCUA 2PKYX 3K8OE 2DERA 4RQTA 1KFEB 3MS4A 2JKVA 1HYQA 2ECKA 1LDYA 1ECCA 4E5MA 4NCBA 3EXG1 5KOYA 1QJ4A 3GP5A 5DWQA 4N6NA 1YNSA 1JEYB 2ETXA 1ISFA 2P9BA 4BQOA 1Z8DA 2ORED 3W9BA 4XJSA 4A91A 5IEJA 2QF7A 4MIYA 4HWKA 3P9PA 3P0FA 4BP1A 4KIGA 3T9BA 3P2KA 1Y7HA 4ER0A 2KQXA 4B34A 1YL7A 2VHCA 1Q19A 2VF5X 2ZIVB 3ND7A 4EUFA 2C5GA 1AROP 1XREA 4N0PA 5JAMA 3NI2A 1PT5A 4D8TA 5KHAA 1JFVA 1Y9EA 2ISSD 3HWUA 4DDWA 1YGYA 4OXNA 3I12A 4DM4A 2CGOA 4GBGA 1WUKS 1RM1C 4X71A 4ZQHA 3LBAA 3HR8A 3PITA 3ADPA 5KOIA 4MKXA 4DC1A 3JQFC 5CT8A 5JY6A 1DIAA 4QOIA 5ADVA 4PIMA 1SMKA 1CUUA 5D8DA 2D06A 3UK7A 2H8KA 4KSCA 1C3OB 2ZUFA 3IMCA 1OLSA 1QVFF 4CR7A 4YAOA 4YYZA 4DLWA 2PUVA 1GYPA 5KX5F 4LGVA 1NI8A 4YY3B 2QL9A 3ZBTA 5CCBA 3QBVA 4DJEC 4L5BA 1YHZA 3S2UA 1Z4JA 1PGOA 3W5BA 1T9AA 3WL7A 2BEKA 4LFBB 1MXFA 5K6AA 4YXWD 2WKRA 2G80A 3NHSA 4WESB 4GXQA 2LP4Y 4RAIA 4IIYA 1KPGA 1ENOA 1E5DA 4L8YA 3OOWA 1HSOA 1BA3A 5JOQA 4ODIA 3NBQA 2Z1UA 3ZS8A 1T91A 3NAGA 1J2EA 2WPDD 2V7UA 1NMUB 1A96A 5C46F 3SBDA 2XNHA 4CMCA 1HDXA 4EKIA 4PZPA 1HBJA 1DFGA 2JJ2A 4B3RB 3L9WA 3I5AA 3JRNA 4AX8A 1XFDA 1LVHA 3LYLA 3CR3C 2HJVA 1ULBA 3N4ZA 2X8AA 2UUBO 5AI4A 4ITUA 5K8CA 4NTWA 3Q87B 2QWRB 3L07A 1PJ3A 2V7EA 2YINC 4J7KA 4TKUB 4PAQA 1NRWA 4FZVA 3WYAA 3TH5A 1IHXA 2XSZA 4JXXA 3F2VA 1DT3A 1P17A 4WESA 2JAXA 4P4SB 3WJ7A 2DP4E 3OPQA 4L8FA 2B0CA 1D0SA 2K4MA 4G9GA 1ZINA 1U4NA 4XE5A 5THXA 5KOHA 3NV9A 3RVPA 3H19A 1N0JA 1IQPA 1OB5A 5LR6A 1U4OA 2FZVA 1V8OA 1ZH6A 1ZOLA 4AT1A 1KI9A 3DCJA 2B7BA 2NU7B 1EA7A 2Q9AA 1R0BA 3JAKA 4R1LA 1P2UA 2Z30A 2F3SA 1NX9A 4GPBA 1PR5A 4OP2A 3Q85A 4ZGGA 2W4IA 3NK7A 5DBFA 3RVNA 3L8CA 1FZQA 2FFRA 1ZR4A 5J2TF 2WHXA 4BV8A 5JRJA 1NQUA 4BPBA 2Y0IA 1W4BA 1HGXA 4AMBA 1UANA 1QP7A 4DMCA 3VC3A 3M6FA 1W2BU 1H2ZA 4TKUA 2P7IA 2IIBA 3P9IA 1ULSA 4OCZA 3FJ1A 3TLJA 2B4YA 1UKYA 2QYOA 4MUNA 1ZJ6A 4WECA 2GZLA 1J00A 1Q44A 3TD5A 5JCJD 1DG1G 4YJ3F 3D8SA 1ZRNA 5ICEA 1ZUD1 3CR8A 5JJEB 5M3BA 2I54A 1P8AA 3GRUA 1T5LA 3QGMA 4J16A 1X3LA 1EWKA 2GBIA 3A0RA 4UVCA 1TK9A 1IAVA 3F7OA 5HW0A 2AW5A 4GOKA 2Q6VA 3WK6A 4P5DA 2ZIAA 4UBIA 2CDBA 1ZD9A 1MHPA 1SVKA 4LH6A 4LX8A 5DTMA 2FSHA 1SN7A 2CTQA 4CWAA 4FHCA 4AFNA 4EGAA 1O89A 2GQ0A 1LSJA 1PRYA 4UFZA 2VWKA 3D3NA 1FF9A 4FLXA 4ICGA 4RLSA 4BLSA 1AHHA 2R85A 1F0NA 1JW9B 2A9JA 4JR0A 4M88A 4NU8X 2B6NA 2JK5C 3D6MA 5DYGA 1DUSA 1DT9A 4TWAA 4RBNA 1YZVA 5LLTA 3T3NA 4RFLA 1TJ3A 3JSNA 5A4KA 4BKOA 3I52A 2Z5VA 3H9CA 2VDPB 3EFOA 2R97A 3ZR4B 3JSXA 3LUGA 4M21A 4JL6A 3KZNA 5EJ6A 3GRRA 1DZIA 3T2MA 5ADHA 5H1YA 1ODLA 4G8BA 3SLRA 2VF8A 5BPHA 2YC0A 3I9NA 4TTQA 2O59A 1IRIA 3CA8A 4PBTA 3E22B 2SCUA 4WK2B 4BVBA 1B2RA 4BO5A 3HO6A 1J1IA 4E2LA 3GWZA 2REQB 3E8GA 2JKZA 2BW0A 2Y3IA 5I7WA 3LG2A 3DTTA 2AVNA 5CVTA 1J5EO 2Q7GA 3O3MB 5K6TA 3I61A 2F2TA 2DBQA 1KBZA 4UM5A 3V4OA 1UK9A 4BX3A 4YXWG 4JX9A 1VQ7F 3E9CA 2JJ1A 4UDOA 1T3SA 1ORQC 2YJZA 1N2OA 4IMIB 5BNIA 4G0VA 4K6CA 4QXQA 3ZRXA 1P2VA 1S2MA 1CUDA 2OLEA 3OA0A 4X92A 3W7WA 5KPJA 2BFOA 5CLHA 3W4JA 1FDVA 1E1LA 4A6PA 1XXHE 5LJIA 2V7VA 4LOLA 1KEUA 1N92A 1WMAA 3KOOA 2Z1NA 1SVNA 1ZP6A 5IWAO 4NBWA 4X3MA 3E22A 2OGWA 4K2AA 4OK3A 4D7SA 1KQSF 3A1CA 1CW2B 5CP8A 4KHPB 2MSWA 4EPTA 4K7JA 1T6NA 1Y1SA 2Y66A 4GSYA 3SQWA 3FBTA 1XA0A 1I2MA 3AY0A 3GZ4A 1EN5A 1WDKA 2ACEA 3QMMA 1UBSB 1QAOA 2A86A 3QVOA 2JIBA 4M8SA 3U6BA 3O0DA 5COAA 1JR3D 1X39A 4KR0A 3K32A 3LQ1A 3S68A 1R0LA 5LQRA 5FLKA 2DKFA 1I33A 1RZ3A 3HJFA 1G5FA 4NFSA 1UDWA 2W2XA 3NETA 3OJFA 4TXNA 5E9JA 4AVYA 1U0TA 3OPNA 4G1UC 2R96A 3ABZA 2FGYA 4EI8A 3NLLA 1JSLA 1J39A 4F8YA 5KUTA 4FT4A 3BL8A 1VARA 3DLPX 3K5MA 3HL0A 3RNOA 4H7HA 1C9DB 3CH7A 2AQHA 5CAEB 2VRNA 2GK7A 3N39C 1BHAA 4IV5A 4PZUA 5CA0F 4KOEC 3CY6A 2O3RA 3WZ2A 4YJKA 2HHCA 1KNQA 4KFRA 3PUIA 3BWVA 2AOUB 1IM2A 1X52A 5KNDA 3NUZA 5KTOA 3W6OA 5B6IA 3BAZA 2P69A 2OAP1 4J0KA 1DBPA 2K9PA 3BFVA 4LSWA 3QLUC 3VOSA 2QRKA 1DKLA 3F3KA 1FRVA 3MRTA 5BORA 2ZR8A 4ZHWA 5BSWA 1DQNA 4G88A 1BGXT 1COWD 3EYAA 1I2CA 1V8PA 3LZ6A 4MQFA 5CDUA 4P4NA 2DWDC 2Q0QA 2PCLA 3ESRA 3WHKA 3DV0B 4UB6Z 4ZMRA 3I56F 3ZVNA 2IW1A 1UBJS 2ZVYA 2PS9A 1O4VA 1C9MA 3ZWBA 3MK31 1JLHA 1FDWA 4ZOQI 3E1SA 4DHEA 1M8JA 4KBGA 4KQWA 5J58A 3STYA 3F6YA 2XT6A 1ZUHA 1BXZA 2AOUA 2FX2A 2XY4A 1N2CB 3MMSA 4XM1A 4DZTA 2Z0AA 1M57B 4D6YA 1SQXH 3LLUA 2WJVA 5GW7A 3ITKA 5EWMB 4IJWA 3IR5A 1HLDA 3VI3B 1FMTA 4IDCA 1ISPA 2KG7B 1KYWA 2MDTA 1A9SA 2I9PA 4RJJA 1ZI9A 4XGRA 1QRUA 4DIKA 2F00A 4XJTA 2FFJA 4BT3A 3RUIA 5A3QA 3OG9A 1ULTA 2IVZA 2AUNA 3T7RA 3CXHF 1AHIA 3BVOA 2ZZNA 4AJJA 1KP3A 2OCIA 4Z4FA 2WYUA 1RAGA 3DV0A 1LDMA 1NXVA 1MO6A 4XOUA 1XU7A 3UJCA 3BY6A 2V1DA 3SJBC 1U8FO 4R2XA 2WUVA 3WICA 3LDUA 4I1YA 1ZG3A 2IYZA 2H5LA 1HM5A 5KKNB 1JHPA 5E4JA 4B43A 3R6WA 1N2CA 5HZKA 1ZN8A 2GEUA 3P0EA 2O0KA 1P60A 2E37A 3VU8A 2O8EB 1M1YB 1C8KA 1U7TA 1OYVA 3GRCA 4QJ3A 4OXRA 3PPYA 4HFRA 4DR6B 5GIOE 5LLSA 2KG7A 4DR2O 4DRZA 1GPLA 5FLXA 3ZMZA 2VF7A 5FB3A 1S5HC 2C0QA 2HPHA 4PDRA 1A8QA 3JATB 2CNLA 4FPPA 1X0XA 1XZFA 4ZYXA 2BZ1A 1Z2PX 3S3TA 2HMTA 1TL7C 3H1JH 1QD9A 2PUGA 1EVZA 2HEGA 1F4LA 1NW3A 1UMBB 4OL9A 3LUDA 2AJBA 4O02B 4TM7A 4QGPA 2ZYWX 3LWZA 4L0DA 4YRQA 1LUAA 1ZXXA 4DREA 4HGYA 2H65A 1YTLA 2ECQA 2BAGA 1KP9A 2X5XA 2NW6A 5J47A 4FXPA 2VS1A 3HY3A 4OXIA 5ALZA 4HWTA 4DDVA 1B73A 1IJFA 3LF2A 4YAWA 3HKDB 1M1YA 1N5JA 4JQOA 3CX6A 3NR2A 1IZ9A 2ZDIA 1DJPA 3KSBC 4AP6A 4S12A 1Q8IA 1EK2A 3UWPA 4G37A 2XOXA 4HAWA 2Q9LA 3VI6A 1TM4E 3FZYA 2Y77A 3ZBQA 3JATA 2IA5A 5DK4A 2JAQA 2TMYA 4DVJA 4MI1A 4JGIA 5D3KA 4LBEC 2CL7X 4V0SA 4AURA 1YRAA 4UEWA 1ZUWA 5ICGA 4Q01A 5BVHB 2A8YA 3TFQA 3FZEA 1ZAUA 2FF7A 1UMBA 3VPSA 1RLMA 4MW7A 1E3QA 2R7AA 3CPWF 2HA6A 3M4SA 3EWAA 1E2KA 3L6DA 2VP4A 4UOQA 1Y4AE 1TVKB 4UREA 3ZGZA 1J07A 1YJWV 2DBZA 1KEEB 1I4EB 1WF6A 3SZ3A 1M2GA 6GPBA 3FTEA 3DEZA 2WA1A 4C7JA 2CY0A 3K9GA 2ZRLA 3KB8A 5DM60 3HKDA 3VJKA 4MS2A 1W88B 1ZK4A 1RHRA 1QR9A 1EHYA 3E8BA 1ZWLA 3P2MA 1NE7A 1XEXA 3Q8WA 4M7WA 1G8JA 2AG0A 1P2BA 1R3LC 3B12A 5EFZA 3IQGX 5HYVA 4EVQA 3G5MA 3HXTA 3RHTA 1E1QD 2ZYAA 2RAUA 1WPRA 1GXSB 3F74A 1WD7A 5I51A 3FNFA 3GPIA 4H4CA 1COWG 3QEJA 5BVHA 5FOQA 1BMFA 4TUYB 1BSMA 3GGPA 2IC5A 1NN3A 4BO9A 1V47A 3GRKA 1RYBA 2J7KA 2PTGA 1JIKA 4CH5A 5I7EA 1P5RA 3OZEA 3DKVA 3Q0EA 2VAPA 5AM0A 4Z4GA 3KOMA 1J97A 3GLKA 2B5OA 2AZ0A 5BV2P 1QCYA 4DSAA 1Y33E 4RAQA 4GXNA 2OKGA 1QHSA 2B2NA 4GUDA 1W88A 1XC7A 3CX7A 2ZNIA 2OCDA 3KWFA 4I46A 2NZ8A 1TIPA 1GV1A 1TD1A 1Y5IA 3DOOA 5EIOA 3AG7A 2Y1FA 4H6VA 3VRHA 3V1LA 4CF4A 1P44A 1GGMA 3OD4A 5BV7A 6YASA 4LVUA 1O2DA 5EJ9A 1ZQ1A 4WFKA 3IAEA 2G9NA 1XEQA 1I6MA 5KWIA 2CNWA 2XD9A 4KV7A 3IIEA 3EMBA 4KX3A 4MB2A 1YQ9A 3AKDA 4AN4A 4XWTA 4EOGA 4DR2B 2O3JA 1MT3A 4FQ7A 1G5TA 1QG4A 1V16B 1GGFA 2BEUA 3QX3A 3QFTA 2YWGA 3SYRA 2BE3A 3H83A 4YCMA 4TQFA 3O4HA 1MSDA 3RVKA 3BKXA 4HEQA 1WB4A 3VO9A 1MZEA 1Q21A 1OAOA 4P86A 3IXQA 1Q6YA 4EG3A 1KC1A 1CETA 1I7PA 3CHYA 2BF7A 3E35A 3OJWA 4NENB 5BW4A 4TYNA 2PN1A 2OXIA 3VIUA 3RUEA 2Q4OA 1ZH0A 3FFTA 3L6OO 3VQTA 5KTRA 3B89A 1X1CA 1XZGA 3UNXA 3UM9A 2GPTA 1W0JD 5IUKC 2BRUC 2AF4C 1WAZA 1VQ5F 3ZRWA 3ZGYA 4TMTA 3FMGA 4O4HB 1GSAA 1U0EA 1UXHA 4N3BA 4Y6QA 7MHTA 4ESVA 5JWHA 1M57C 3EGXB 1WWKA 2CCGA 2WKPA 2RHGB 1J90A 1LDBA 1NUQA 2QLJA 3U4MA 4KP7A 5JT1A 3ERCA 3OICA 3EIUA 1AJNA 3ZWNA 1HR0B 3PZBA 4LYAA 3HV0A 2X5JO 2BDEA 2Z9CA 4WOBA 3I6YA 3FNEA 4P7FA 1CQJB 3ABUA 1G8GA 1B76A 1YZFA 1K8XB 1G5PA 2VWGA 3AK1A 1WG8A 3RIGA 1NVWQ 1RI2A 4UMFA 2I71A 5JPIA 4G27B 1CZRA 3VMFA 3CLKA 2PM8A 1B0UA 2ZBEA 3TVDA 1MF7A 4GPD1 4O4HA 4BVGA 3WWYA 5JJKA 2O8CA 4P3OA 4XD7A 5I8WA 1N4DA 3HDVA 4A5OA 2XOKD 1C3LA 1C3VA 3EGXA 5AVUA 2A9PA 2DZDA 1IXBA 3NWJA 4GQAA 4LKRA 2AH5A 3ABKC 3WLIA 3ZQJA 3RTAA 1QGAA 4PW0A 4FDVA 1DVRA 3H18A 3GFOA 2OUKA 3ECCA 2DFVA 4MXDA 5IT4A 2L82A 2XEDA 1NU8A 1YJAA 2ZFUA 2W6IA 5AM2A 1XI1A 3RIMA 2JLVA 3RC1A 5J43A 3UAGA 5K1XA 4AQDA 3BK2A 3NNNA 5AHOA 2ILVA 2N3ZA 5LD2C 3ETHA 4OGKA 3G1TA 1K5GA 1LSSA 1KJ9A 2OXTA 2R4TA 3RLFA 1WMDA 2ZM6O 2RHJA 1X1AA 2G07A 4QVIA 4CMJA 2QN6A 2BHLA 1DQPA 2ZAOA 4WA7A 3ABLC 1Y6ZA 1JNXX 4FMCF 1E96A 2YRFA 1HI9A 2Z2KA 2P2NA 1BQ3A 3NIDB 1W0KG 3CC2V 1RJWA 5LYJF 1FBTA 5EFOA 2Z4TA 4TTSA 2JH9A 2GS9A 5JCXA 1TC2A 4YQYA 1VPDA 2HQSC 2EG9A 1L3IA 4XYGA 1QR2A 4XVQA 4C4SA 2YI8A 5KTMA 3RS3A 4IIVA 2LIVA 4X6UA 1ESCA 3ZTWA 5DXAA 4AICA 3B82A 2AOVA 3DXRB 3VR5H 1C14A 3NVDA 5I5GA 3TD6A 3K20A 2WMDA 1U7UA 3W34A 2AZ4A 5D1HA 3CX3A 1F4NA 2NUBA 1X1QA 2ZCVA 3GNTA 4DSUA 5FUMA 2KHZA 1KFBB 1NN0A 2RH9B 3D7NA 5FHQA 4P31A 2KSQA 3WV4A 1ZMTA 3U10A 3V4LA 4BNDB 1NQ5A 1USWA 4NR1A 2HO5A 2VQFB 1BRTA 1M34B 1LA2A 5K8JB 3N2YA 1QPBA 1CF2O 1T6ZA 1S1MA 1WA5A 2C3MA 3SQXA 3BIOA 5B36A 2HI0A 1UINA 3FPBA 1TD9A 4NCXA 3F8WA 1XZBA 3AC0A 4ZGBA 2I5PO 2QSYA 2WFAA 5A62A 1ECFA 1JN1A 2CDCA 4JOSA 3AGKA 4EHJA 2A5FA 3AXSA 2BGIA 3GNSA 5ESRA 3HJAA 2HIGA 1QSGA 3DA8A 4FLZA 2P77A 4FE7A 1E77A 4LW8A 4Q21A 2EW2A 1TTTA 2PGJA 1OFHA 4TT3A 4PBRA 1P19A 2IZ0A 2XGOA 2VBIA 4OU4A 4D44A 3N0WA 4AN1A 1IQUA 3LSUA 2XMCA 5CR9A 4MVSA 1VG1A 4IDPA 4JUDX 4JI2O 4G84A 3UENA 2FPXA 1OGIA 1OILA 2P8SA 4RQBA 1M34A 1M2FA 1ZX1A 1ZHOA 4DRYA 5CT6A 3NC0C 3TLXA 3QK7A 2CDYA 1UBLS 1WZEA 3WZLA 3KUCA 3JW8A 2J5XA 5IDYA 4DXDA 4IMPA 2I3GA 1EJ2A 4QBGB 1LLQA 2ODPA 2PIDA 3TECE 4ZK2A 3M1XA 4REOA 4NJOA 4LZPA 4B4DA 5IDWA 4FFKA 2ZBRA 3JYNA 2QR5A 3D9QX 3V1MA 5LGUA 4Q3NA 3KE9A 2QZ9A 3RC9A 1CY4A 5EZSA 3MCZA 3UEOA 2GJSA 2PBLA 5HJ2A 4M9XA 2RC6A 2ZUSA 1GAEO 1VE7A 2P27A 3UJ9A 4MB0A 5AKZA 5BQ3A 2EIKB 1I5EA 3TFOA 2WR8A 3LNNA 5ALTA 1SQPH 3TRJA 3GLUA 3ON5A 3H1TA 2V5VA 3R7DA 1C3EA 1GZDA 4MZXA 2E5LO 1OXXK 1TM5E 4UAUA 2HSWA 3GB9A 5F73A 3JQBA 2I1LA 4PNHA 1NUHA 3JWHA 2XCIA 1MU0A 3GFPA 5EJ8A 5SYAA 5CLQA 1O6BA 2HSDA 2PR7A 2VT7A 5A5GA 4GHWA 3SDZA 1AUVA 2XUHA 3HY6A 2QN3A 1UT6A 4D81A 1Z13A 3CPHA 3Q7RA 1RT9A 4GIBA 2PE5A 4PA6A 4MH0R 4DKXA 3S40A 1P3DA 1UZLA 2J3QA 3OY2A 1KDTA 3RU7A 1QIKA 3AEKB 3IP1A 1TA8A 1FFHA 4AW9A 3OT5A 4RJLA 3TXAA 1J24A 1GMGA 2ZUUA 3LUJA 4NKRA 3GLVA 3I2GA 1KMIY 2O8VA 4FT2A 2DPXA 2MOKA 4XVUA 2B25A 3H3JA 2YHIA 3KV1A 2X76A 5F12A 4I99A 3FYUB 1SC5B 1VGVA 2DBYA 3EXFB 3WG7C 4G5GA 2P79A 3AH8A 1RKVA 3EHBB 3KKLA 3DBVO 4EHFA 3IL2A 3WMRA 1RXCA 3PYLA 3R7BA 3C87A 1JIUA 1QMGA 1I1OA 3H01A 2V74B 5A4MS 2XCTB 2LW1A 1JDZA 2OR3A 2RAPA 3FHCB 4JU8A 1MJFA 2A0WA 2Q69A 5CDFA 1G55A 4CTOA 5L53A 5E79Z 2Z6UA 2A88A 2C4VA 1XT6A 3PJRA 1S01A 2VHJA 3EPLA 4PCLA 4NJEB 1DI0A 5EJIA 4JK3A 2PMEA 3L7DA 1XZIA 3V7NA 4UOEA 4FOSA 2O5EA 4XUEA 3LK6A 3AUYA 3T41A 2FFQA 3EIHA 2PZAA 4RF4A 3FYUA 3HP4A 3QY9A 5A9GA 4FOLA 1GYQA 2ATVA 2FB9A 3ZWMA 3EXFA 3QOWA 4DG9A 5K4HA 5GIPE 4TOIA 4MYUA 4IJVA 3WU2Z 2ENUA 2I4LA 3FHLA 3OEEG 3GLFB 1A4XA 2FTKA 1PQPA 1IEWA 4HD8A 3E9NA 3H6HA 4AI6A 3HNPA 3EE6A 3D0OA 3WNVA 4Z1OA 3MB8A 2VUHB 5DP1A 3GAMA 3UJDA 5JZSA 1E9RA 2P1RA 1YQTA 3B2EE 1C50A 4LH7A 3A6HA 4HDMB 3FFQA 1ZD5A 1ULUA 2F3RA 2B4RO 3HYSA 1L5MA 2XRYA 3LH5A 4NJEA 1XDGA 2CD9A 1XZMA 2AN4A 2LPMA 2B9ZA 1ZICA 2XE7A 1Y98A 1QIMA 3RJMA 2YJ4A 4QLAA 4LQCA 3EXHA 3SEZA 1L0LH 3U0BA 2YYZA 4KFUA 1T3LA 3QRWA 1TQHA 4K6KA 1XK6A 3ZYZA 3MHTA 1XR3A 3CG6A 2JBWA 1D8TA 1WUYA 1O77A 1SR8A 4E2WA 3CBGA 2HBQA 4LE1A 4NU6A 5EC8A 1UAGA 5EPEA 2IEBA 5EBLC 5A3SA 4QGHA 4PLCA 2H7YA 2D3OW 2AHOA 2FN4A 2PWAA 2B3TA 2WUGA 2BSXA 3H1AA 4K3VA 3RSCA 1SCIA 3NO4A 2EERA 2YWHA 4WBSA 4KQ9A 3G5AA 4LYYA 3OX3A 4U3FH 5J4HA 3DZGA 3NOQA 3PJEA 2FY8A 3VGJA 1R18A 2PZEA 2J4FA 1GG8A 4ZHSA 5IKXA 4P2ZA 1XDZA 1JLSA 4XQEA 2YHAA 3KXLA 4GXRA 1NJFA 4B33A 5IP5A 4DZZA 3KHUA 3GAZA 4LK3A 4PCVA 1A5SB 4Y7DA 3BCRA 4DMRA 3G2MA 4GGMX 2E48A 4NATA 4DV0B 2FKXA 4CL3A 1E6MA 1PDVA 3FWKA 3WLFA 2IJHA 3DAGA 5SZKB 1Y48E 1OVGA 4Z9BA 2Z58A 4XWAA 4ZMBA 5IAGA 5AHWA 4MR8B 1USUA 3C3PA 2F9MA 4GE3A 1VE1A 2FQYA 4UHCA 2ZT5A 5KHOC 4CL0A 2D1TA 4X8HA 3OMNB 2F1MA 4JLWA 3VJLA 4P5PA 4BO1A 4P2BA 1G98A 3GH1A 2X22A 1I8TA 3NRBA 3LE8A 3A9WA 5EAZA 3IQDB 1B26A 4YJDA 5AXAA 4BTLA 5C31A 4CU2A 3EULA 2F90A 3K06A 3IILA 2OXCA 2AFRA 4N5NA 4O2RA 3BK7A 4QG7A 3M81A 4XVHA 1K5HA 2BVNA 2VHZA 2BZGA 2G67A 3D8HA 2YXPX 4A82A 2C97A 3CLVA 4CBCA 2WZDA 3N2NA 4WXHA 4INPA 1RIIA 3MWEA 3H3XA 3I1IA 1GRJA 4TT8A 2YNMC 4UUJC 1F0KA 4NH0A 5JH7F 2AGAA 4MR8A 3SG0A 2R66A 3ACCA 5C93A 3I2JA 3FUXA 4EHAA 1E2JA 2XYGA 1JDUA 1KNJA 3OOYA 4PRYA 3TUZC 4NAHA 3PQ4A 4B85A 3VR6H 2NNLD 1JNYA 4Z7JA 4RZQA 3ZVRA 4PEVA 2ID7A 3KHSA 2X6QA 1TM3E 3A9TA 5JD6A 2V7QD 3LC0A 3EMVA 1WE2A 4ZOAA 3LNMB 1ATZA 1C7QA 4QE3A 3WA6A 4WOCA 1UFKA 3DL7A 2NZYA 3AK4A 3CCLF 3K09C 2HZ7A 4BZQA 1WLYA 1BZYA 2FPOA 1B6TA 2JRCA 4IV0A 1MDBA 2H4JA 2WOJA 3L0OA 4HEHA 4KRYA 5TQ0B 5I7AA 3ND8A 3ZU2A 4I0WB 4MV3A 1BW9A 4IFEA 4V1CI 3AW8A 1CQWA 2C29D 1NUPA 1DEKA 5KQPA 3N8IA 1Z6AA 3SC2A 4H1WA 1A5AB 1MRSA 1S3FA 3S0HA 2F23A 1GNPA 2C3UA 1KY2A 3LWOC 4JYPA 4DV6B 4QJ5A 3JSAA 3O93A 3U9TA 1A71A 3R24A 2FZGA 4NYIQ 2YVUA 4XGQA 2ZWIA 1Q7BA 3MJDA 5BV1A 1TM1E 3O2NA 4Y2HA 3C6ZA 1L1QA 1X94A 4HEA1 5EUBA 3FIJA 3HN2A 2VATA 4NCIA 3PHCA 5JVDB 4IDGA 2R3SA 2UZ1B 4C01A 5TQ0A 1PF5A 1U9JA 2O2CA 3R5KA 3G7NA 4Z3KA 1BX1A 4OMFG 1TLTA 2R1VA 3U48A 3C8ZA 1GM5A 3G68A 3VNUA 2XB6A 1Z82A 1AX9A 1KYXA 1XMJA 5AW1A 3LWVC 3RSLA 4LBWA 4G8DA 2WLJA 3PQDA 1VRWA 3BKWA 3G5UA 3OMXA 4HDAA 4MWEA 2W93A 5BR7A 3LY9A 5DNVA 5BSMA 1SBTA 421PA 1ORRA 3DT6A 4MKGA 3CNQS 3CC8A 1NU6A 3GT3A 5ERYA 5LZ5A 1I1QB 2R6R1 2NXEA 2XT9A 5JVDA 4UARA 2QM0A 3O4VA 2CJFA 2PI5A 2YMLA 1RXIA 1GLVA 4LZLA 4U6QA 4GP9A 1K7DA 4TQAA 1GFZA 3BDVA 3CFYA 1NTOA 3KWLA 4QU8A 4H6WA 2GDZA 1VPEA 2OV4A 4B6GA 4GE0A 3KJGA 3RASA 2XKBA 2VZEA 1P8JA 3BM5A 4LRXA 4XTRA 2A0XA 2RGGA 4MVJA 2A7QA 4QUGA 3B53X 4IYHA 1TCCA 1CR2A 2XXBA 5DLDA 3MMNA 1SHJA 4N21A 3W7UA 2CXXA 3LGAA 4EW2A 3QKTA 1FEZA 2LQTA 1LVGA 1PU2A 4GYKA 3U31A 1Z39A 2OC9A 2REBA 1XOIA 2DJIA 3WNZA 3DMNA 2HCJB 1FBNA 4KUMA 2JBAB 1A0OA 5H0IA 3IHLA 4ZEVA 4UHFA 3LAWA 1ND6A 2GF9A 2FJPA 3QMVA 3GPCA 4GRDA 3VC1A 4J4TA 4UV8A 2VLBA 2HDOA 1MIOA 3OZWA 3E9EA 2OIEA 5FCDA 1G6OA 2CKDA 3DTVA 5AJUA 3GVXA 4E5KA 2XF2A 2R9AA 1TNDA 1RWNA 5KYVA 1L1FA 4IO0A 1EZZA 1XL6A 4V0MA 1TZBA 1JAYA 1V71A 221PA 5CA3A 2R4UA 1QCEA 4WLVA 2E4ZA 5FH9A 4MP3A 3V4RA 4FDTA 1KORA 2ONKA 3L0CA 1YQDA 5DVZA 2FW8A 2P9JA 3GQBB 2WU4A 3G89A 1KJNA 4UTZA 3GP8A 3TW4A 4TN1A 5DFAA 4S04A 3NOVA 3MYYA 4KQJA 1VPTA 2O2EA 2FPIA 3FCUB 4Q1FA 2IT1A 7GPBA 3SZRA 4UTOA 4A0RA 3F7VC 4HN4B 1CLUA 4B7EA 2VN8A