1TVKB

The binding mode of epothilone a on a,b-tubulin by electron crystallography
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, structural protein
molecule keywords Tubulin alpha chain
publication title The binding mode of epothilone A on alpha,beta-tubulin by electron crystallography
pubmed doi rcsb
total genus 103
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tvkB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tvkB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tvkB01
3JARA 3RYHA 5MN5A 4I55A 4I4TA 5GONB 4O2AB 5J2TA 3R4VA 1JFFA 3RYFB 4WBNB 4U3JB 3HKEA 4LNUB 5IJ9A 4B45A 1FFXA 4TUYA 4I50A 5LP6C 3HKBB 1TUBB 5CA1B 3JALA 5JCOC 4YJ2B 3VOAA 5BMVB 3ZBPA 2XKAA 4O4HB 5J2UB 5KMGB 4X1KB 3N2GB 2RHOA 4EI9A 5EIBD 5IJ0B 3WGKA 2BTQB 1W59A 3VO8A 5LYJB 2Q1YA 5JQGA 3JAWB 5IYZB 2RHHA 3WGLA 4X20B 5KX5B 5LP6B 3ZIDA 1TVKB 4ZI7A 4TV9A 4ZHQA 1SA0B 3HKDB 5JVDA 4FFBB 3HKCA 5CA0A 5LOVA 4X1YA 5ITZB 3RYIA 4M8IA 3WGJA 3M89A 3V3TA 3VOBA 4O4LB 3JAKB 5EZYB 5FNVA 3WGNA 5EYPB 3VO9A 4HNAB 2VAPA 2RHJA 2BTOA 3UT5A 4DXDA 1FFXB 3N2KA 3RYCA 3JASB 2GVIA 3M8KA 1Z5WA 2VXYA 3JALB 4O2BA 4O4JB 4IIJA 5GONA 4O2AA 5M7EA 3E22A 5EIBC 4U3JA 3WGMA 2VAMA 1W581 1RQ7A 3JATB 5JQGB 1TUBA 5LA6B 3RB8A 4YJ3B 4ZOLA 4YJ2A 5BMVA 5JH7A 4TV8A 4O4HA 4IHJB 5LXTB 5J2UA 3N2GA 1W5BA 2RHLA 1FSZA 4E6EA 5IJ0A 4X1IB 4DRXA 5LOVB 3HKCB 3JARB 3RYHB 5MN4A 1Z5VA 4I55B 4I4TB 3RYIB 5J2TB 4EB6A 1JFFB 5LYJA 5C8YA 2XKBA 3HKEB 3JAWA 5IYZA 5IJ9B 4X20A 5KX5A 1W5FA 4TUYB 4F6RA 4I50B 1TVKA 5LP6A 4O4IA 5CB4A 2Q1XA 4U39A 1SA0A 5JCOA 3HKDA 1RLUA 4XCQA 3RYCB 4EI7A 5ITZA 4O2BB 3RYFA 4WBNA 1W5AA 4LNUA 4IIJB 4O4LA 3JAKA 5EZYA 5EYPA 3E22B 3HKBA 2R751 4HNAA 3VPAA 5CA1A 4ZI7B 3C8LA 4TV9B 2VAWA 4ZHQB 3ZBQA 5KMGA 4X1KA 3JASA 5JVDB 4ZOLB 5CA0B 4O4JA 4X1YB 4B46A 5JH7B 1RQ2A 4TV8B 1W5EA 2BTQA 2R6R1 1OFUA 4EI8A 4DRXB 5FNVB 3CB2A 4KWEA 3JATA 4EB6B 5C8YB 5LA6A 3UT5B 4FFBA 4YJ3A 4F6RB 3N2KB 4O4IB 5CB4B 5LXTA 4IHJA 5MN6A 4X1IA
chains in the Genus database with same CATH superfamily
2M6SA 4JBGA 3EPHA 1DE0A 1S2IA 4LJ5A 4KPUA 3SR3A 4QC2A 1TZBA 2W98A 4LYJA 4FHGA 2L0XA 1NY5A 5F2KA 2EX0A 2NNUA 4I8IA 4KK4A 4YJFA 1CR0A 2AUTA 5HOEA 4RUEA 1ZAKA 2RGNC 5AK4A 3ZQUA 4GKJO 1LI5A 3MLAA 2KBFA 5KJFA 1BE1A 1FRNA 3HWSA 1IJFA 5AHXA 5HXAA 5FOTA 4JLSA 1QP4A 1OASA 3BZBA 4A0QA 2GCPA 3B52X 5F51A 4L4SA 4ZRMA 3RT3C 3CEIA 4C43A 1AU9A 4L5AA 4EH1A 4BLQA 4U7HA 3FTDA 1CRLA 4IYJA 1A88A 3PICA 5JCXA 5JOQA 3FJYA 1Y74B 4DA6A 2OHIA 3JQGA 3TW8A 2DWPA 2IM9A 4FGKA 4NABA 4XBFA 4O4IF 4BMNA 2MWMA 4G5RA 2J31A 3ZDDA 5JHHB 1P0MA 8ATCA 3IQZA 2NVOA 5AXBA 4MS4B 3A6ZA 2O5RA 1EXMA 4HUQB 1BCSA 2FMFA 5BN4A 5BMVB 5HRAA 2QVLA 1M4UA 3T5BA 3DSRA 4AJ2A 3QEMA 3U16A 3DDWA 2QVCA 1XMOO 4LRUA 3K9SA 2OCPA 3MJCA 1EFHA 4ZDJA 5K3BA 3ZHQA 1EVJA 1JP7A 1E9CA 1ND5A 2NVWA 4BECA 2PUWA 1NVGA 4DQKA 2DR2A 2QF7A 4FMCF 3SX4A 1QF7A 3NAQA 2NU8A 4XKJA 1ZM3A 3KJZA 3E82A 2W6ID 3IEVA 2A1UA 3IALA 1BG6A 2KGWA 3OT7A 2XXAB 3ZK9A 2FYUH 3I5YA 4X6UA 5JMWA 2KSDA 2PY5A 1UFIA 1YS4A 2GZDA 2WHQA 2V5VA 4JFRA 1DDIA 3URMA 2B4KA 2AHRA 4XVCA 1W55A 3ZV7A 4DMKA 1NF2A 4KNVA 1O6FA 4U4AA 4KR3A 4DILA 2VTBB 2B99A 5BWLA 1GZ3A 4IBOA 1L8DA 4G23A 1AD2A 2R7NA 1JIKA 2Y69C 3KQKA 1PFYA 4N65A 1M6WA 3L8CA 3G8CA 3RPEA 2FN3A 3RSZA 1EA7A 3GJ5A 3DKVA 3KR0A 3G2HA 1X8LA 5KUTA 4FQ7A 3PA6A 5A3VA 4DKJA 1EQUA 4I0XA 2V3VA 1IWBB 1ZRMA 3ZDBA 1LPBB 2K4MA 2OAQ1 4BNUA 2VDRB 1JPVA 1Q7BA 5JSKA 1HM5A 2SICE 4I99A 4GKBA 2H18A 4DPMA 2W6IG 1VMEA 1JPJA 1ZC3A 1IXYA 1WVGA 1DFHA 3M5WA 1QQ5A 3IIKA 2F8SA 2E4ZA 4FHCA 4XGIA 3MTEA 2GPYA 1W52X 4Q0MA 1BDBA 1XRPA 2CB0A 3PTLA 2YICA 4DV1O 3NM5A 4FMTA 3HY6A 4CIWA 3NWOA 2BFEB 4RL4A 2Q0SA 3AR6A 1Z6YA 4PDVA 1T9BA 1TU0A 2Q68A 1NUSA 1QVGF 5LWHA 1IPFA 5J2UB 5EIBD 2VAVA 3BZUA 3N2IA 3RAGA 1H7MA 3MQ4A 3WISA 2G1PA 2I9PA 1RHUA 3H4VA 4S1PA 2GZMA 3OCYA 4CIDA 1EN5A 4G4SP 3OR7C 1M34B 1KQNA 4RD4A 1A5SB 1KA9H 1M7BA 3FHOA 3KZXA 4I8DA 2EARA 4JY7A 2ZJYA 3ZLTA 4MWEA 2M9MA 3M8KA 1QIMA 2WYUA 4LCJA 3MJEA 4UKDA 4RAQA 5E4TA 2GCNA 1TUBA 4HL6A 5FFNA 1D7OA 2EJTA 2BD0A 4TLEA 2JARA 1YJXA 4G9BA 1KGDA 1JDBB 3W5SA 5L40A 5HOQA 2XNCA 4Q05A 4OPMA 3TGLA 3UTCA 5DHTA 1O6CA 3AF3A 1DTOA 4JPRA 2HHHO 2X1MA 3OSZA 3W6OA 4ZVTA 1MNGA 5A02A 5HE9A 2CGNA 3PQDA 4FK8A 4RESA 4RY8A 1KB9F 2VP9A 3WOHA 1IN5A 5L7YA 2I2XB 1CDDA 1B8NA 4DV3O 3FTEA 2UUCB 1KK0A 2ZE6A 5I9IA 4IXMA 1OCEA 4S1WA 4C7JA 3CUKA 5LKAA 4G07A 1PVOA 4NZOA 5EWRA 2G72A 4TOIA 1PNVA 1LB1B 5CUQA 1SDSA 2JI9A 2VPWA 5AW4A 5HUHA 4OQXA 5EI5A 2EYUA 1VIYA 2I4MA 1B93A 5CDGA 1Y3DE 1BDJA 3BRWA 2FQQA 1EZ4A 1UKZA 3ZO8A 5LLTA 3PJDA 4A8JC 2NU9A 3ZUPA 2FZVA 1P60A 1YS2X 4AJ9A 1XRQA 1CLEA 4ZOLF 2I2FA 2XUHA 2VK2A 1JVMA 3BTUA 3GXBA 4LZZA 1OE0A 3IXLA 4F3KA 3GLGB 3AVPA 4ZC8A 5I9SA 1ACJA 1IZ0A 4WKPA 4TQDA 4JX9A 2FSHA 4JTCB 3NYQA 4FB4A 1O7JA 2UXCB 2QORA 4QOJA 2VHYA 4FDVA 1GH6A 1N5OX 3I53A 1M90W 4DUYB 3KWFA 2GI4A 4MMXB 3CT4A 2F8MA 4ZMSA 3JXEA 5JCOC 1Y5NA 1YNOA 5EFZA 3AGQA 2X0JA 5K3OA 1D2MA 3ZHTA 2OWEA 4QG3A 1NDHA 5F77A 3RE1A 3SZUA 3FVWA 4H7HA 1PEAA 1TOAA 3R3SA 4AZWA 1Y8RB 2ZYHA 4GOJA 1YFZA 2QI2A 2BTOA 2EJCA 2FW6A 3LWPC 4E88A 4YJ3F 2B94A 3EGEA 4RIGA 3ENVA 3LNNA 4PN3A 4E2WA 3WA7A 1W5BA 1DJMA 2K87A 1CS0B 5DNCA 2DH5A 4KH0A 2G06A 4B1FA 3S55A 2HPHA 2AZ0A 5KYUB 3FFXA 2WU1A 4L4UA 5CPBA 2YINC 2YXZA 5H1YA 2HCBA 4YY3B 3RBVA 1T0IA 2J6BA 2OHFA 2PEZA 1CR2A 4C3VA 2IZ7A 1DT5A 3OAAG 4TXHA 3HNRA 5JO9A 1V1JA 2RB5A 3R8CA 1WA5A 4Y0VA 3FPIA 3B38A 4I14A 4CL2A 2WZQA 1P0FA 1HT0A 3D54D 1NVPD 1VLMA 1YDFA 1GGKA 3IAFA 1P7ZA 3GFBA 1Z56C 4ZZ2A 2YJ6A 5H9WA 3PL1A 4CKBB 2VYND 2XDQB 1QS0B 1CP3A 3WWPA 4JSYA 2EFDB 2BHTA 4B80A 3GV0A 2WJAA 2X3UA 4F2WA 4LOIA 2ATEA 4MZDA 3NQ41 4E14A 3BHIA 2C3PA 2ZUEA 2YYSA 4M98A 1QTRA 1V54C 4BAYA 3PFCA 2ERYA 1XEAA 5KUMA 3CCUV 2JBAB 2OLJA 1QZ3A 4KP7A 1XDWA 2BZGA 3SYRA 3K04A 1CB0A 3OUFA 2AZXA 3WLMA 5KTNA 5GJVC 3KYBA 3DVAB 1W9HA 2AHZA 2OOSA 2HBQA 2UZ1B 2P90A 1CETA 3IVRA 1C7EA 5EKXA 3SQLA 1FJHA 4Y9DA 4CVNA 3OU7A 2VWJA 2IYPA 5BRJA 4TV8B 2QUZA 2RGWA 2G1JA 4WL0A 4ZZIA 1ZAYA 5F98A 3B6KA 3UV7A 1ZCBA 2W42A 4CUZA 3ZWNA 1CXZA 1MQ8B 2YJ4A 1J09A 2CZWA 1NMYA 3R3YA 3ZV4A 1Y42X 4TRMA 4C8GA 1DGQA 1SUCA 3WLJA 2P9CA 3P3PA 4NFSA 5LP6B 3SJAA 3FPHA 1X8KA 3LWNA 2CMHA 2HS4A 3CHXA 2QD5A 1KFEB 4JBHA 2Y48A 2WJ3A 4F4IA 2AA3A 2JKVA 2ZIAA 5ALXA 1I0IA 4AKHA 5EWMA 4HWSA 1WJGA 2Q5LA 5FUYA 5B3SB 5F7ZA 3W0LB 3IFXA 2OBXA 2WZCA 4XD7A 3RFUA 3KZIZ 1A2QA 2GZRA 3MQFA 4EA7A 1KECA 5DEOA 5CDHA 4M0EA 3QVNA 2WDPA 3DMNA 3QLTA 3LL4A 5DIZA 3FRJA 2NR5A 2EBUA 4YAGA 1WSDA 4PZDA 2HEGA 3PFHA 1DEOA 1NQAO 3WBBA 1TAQA 3X2QC 3A05A 3EAFA 1PJQA 1ZVVA 2ACEA 3CONA 5DCUA 2DYSB 4JI2O 2ET6A 4OHYA 1EK6A 1Z74A 1QWSA 4JUIA 2ZG6A 2C57A 2H29A 2OB1A 4GPTA 4BUJA 5ALGA 2PO7A 5IAEA 3VR5H 3LQ4A 2JHCA 1FY2A 4KWIA 1ULZA 1PR6A 2CVLA 1ZJ4A 4M9XA 1D2DA 2DPGA 4NY1A 2NSYA 2OD9A 1DAHA 1CZUA 1VPLA 1S5LZ 3MTAA 2PX3A 2QV7A 1OXMA 5E1BA 3QBEA 1HZZA 4FDTA 4JQCA 3CR8A 1KYTA 2PUDA 1D07A 2W6JA 1R4NB 2J5RA 2RGXA 1H6CA 2F3UA 4MV4A 4RQEA 2VUTA 3FCUB 3BA8A 4NNPA 3DFMA 3DOEA 1BXKA 4YTEA 2G28A 2WE8A 4LCEA 2H2GA 1PNKA 5TGDA 1SOUA 3UHAA 1UFKA 2EKZA 4J8PA 3G2MA 4QJ5A 5LHGA 3TW6A 3O2QB 1E7QA 1J25A 1VRCA 2I2BA 2BZ0A 2P9GA 4MUHA 1U6KA 1ODSA 4XCVA 4TWKA 3SYAA 1FQKA 3DTTA 5FPHA 1FXVA 5TV2A 5JPIA 4MQ5A 3PUIA 1DEKA 2P6YA 4A15A 3G2QA 5DWVA 3EVGA 2H7VA 2P40A 3Q3JB 5GAJA 4RVHA 2QE6A 2ENWA 4HKTA 4X3OA 3HSYA 3QJYA 1QVWA 1RPNA 2CH7A 2JI4A 2IV3A 3IBCA 2F3QA 4MYRA 2PIDA 1E66A 3K0HA 1CIPA 3CNOA 1ILEA 1RT9A 1NVDA 4ZPJA 5DOVA 1Q5PA 4AO6A 2YNMC 4BDSA 3AKEA 2H2WA 1KZGB 3AI3A 2DW4A 3UH1A 1ESEA 3PGKA 4R51A 4NYJQ 1PTKA 1U7DA 1FFYA 4IDOA 5BUQA 1EWQA 1OV4A 1QUFA 4D02A 2VN8A 2VK4A 3N2NA 5CVTA 5KWJA 3ZDYB 4BLOA 4Y67A 3ZDQA 5GWXA 3LI2A 1GVHA 5EE3A 1IY0A 4O25A 1WB9A 5CNJA 3T1TA 3IAEA 2XWPA 3QA3E 2VATA 1A69A 4GMDA 1MD9A 2XD4A 1XEWY 4OUKX 2MTBA 1SKUA 3ABLB 4GOND 1TTPB 5JPCA 1U9IA 2HJFC 1KP2A 1SIBE 2GDSA 4ZEXA 1W76A 1LDEA 4WQMA 4EVIA 3UUGA 3ADDA 4O08A 2ZIGA 3ILVA 4MW1A 2PBLA 3WK8A 2BSXA 3PXDA 3IQIX 4EDHA 4AI6A 5AD1A 2OTJV 1DKQA 1S4MA 3MBOA 2I3DA 4MULA 1XYYA 1EA5A 3MYYA 4HMQA 2CDCA 4RKRA 3N4ZA 3OT1B 2E4AA 5LA6A 1ONSA 2A0UA 3IUEA 2QPOA 5D84A 2FW9A 3CPWU 4M54A 5KQRA 5KVQA 3KHTA 3IFSA 1YBVA 4FT2A 3ECSA 3AUTA 3GH3A 3BSYA 4XCXA 4QGFA 4GXRA 2RGAA 4P1ZA 3WWCA 1GFSA 5BNFA 4NV1A 1P6QA 1WXQA 3HA7A 5LL6Y 1VQKV 5HF8A 1TQDA 4JNKA 4US1R 1EFDN 4C4RA 1PD3A 5BNTA 2AFIA 1B3RA 1Y98A 1IQUA 4C3ZA 3QKWA 5A5EA 1DB3A 4DUGA 4DR1B 3PYLA 4AULA 5H80A 3K2BA 3O8QA 4XB1A 1A8UA 2FDXA 3O4FA 3U44A 4EZIA 5B2ZA 2H52A 2ON6A 1LSSA 2IW3A 3EQZA 1P2SA 1KF0A 3G2JA 1SC6A 3TQFA 1QKJA 2ZNIA 1DSSG 1JFVA 3VHLB 1JVSA 2FJUA 3RGWS 2RGBA 1S5HC 1G5QA 4BO4A 3DEAA 1YUBA 5CITA 4PPGA 3NWEA 1VE6A 4R1OA 2TRSB 5KKNB 4X64B 4LAFA 4I1RA 4CIBA 3U7QA 3TTTA 1E9DA 1E2FA 4CTOA 1N9GA 3NX4A 4C6TB 1H0HA 2ZB7A 4BRWA 1NTKH 5EJ8A 4Q1CA 5DBEX 2PGIA 3ADCA 2E9SA 1GEGA 5EBWC 1EK2A 3BGVA 1W3EX 2NSHA 3PKIA 1AKVA 5DGCA 4YONB 4JJKA 4JBYA 4DV7O 5ARBA 1E1LA 2DMRA 4IJ6A 1W5FA 2XE7A 2QWQB 5JJBA 2PLFA 3I76A 2R6GA 3M6FA 3PXUA 5D3MB 1G8JA 3IAAA 4YGYA 2PI4A 1BOFA 3QYJA 2FFAA 5AM2A 1V8PA 2QTPA 4ZGWA 2Q4PA 2DQZA 2QTHA 5AVOA 1BSVA 3PXCX 1NBMD 1OGJA 1T5DX 3DV9A 3MWFA 5TQJA 2IH1C 3VISA 2DYRC 1Q1QA 2Z1UA 4ERXA 1K92A 4E5UA 3SQNA 2AOWA 3CRAA 3L40A 1B7GO 4KFRA 1O95A 3KK0A 5ALTA 2O1EA 5EG5A 2OCHA 2PZJA 4YC7A 4BX9A 2Y66A 3KJIA 3EYAA 3UAWA 2PS0A 1BO6A 2FK7A 4YCLA 2HD4A 1XZHA 3QITA 2QMOA 3ICEA 3T5PA 5EUCA 4AF6A 4RTNA 1TGOA 1PPJH 4M1ZA 4HJRA 1D2NA 4JSRA 4E46A 4M37A 1ZX3A 3K1JA 2E4WA 5DCWA 2GJKA 3L84A 4DV4O 4AL4A 3T94A 2ZZMA 2BGUA 2WJ4A 3DE6X 1LQ2A 1LUAA 1UFYA 1O8CA 2BO1A 3T4DA 5M04A 1T6NA 4W82A 2ZUCA 1YK0A 2JDIA 5IEJA 4DM7A 4L0DA 1ZLXA 1QCEA 1DAMA 2XT0A 3DEFA 1UBUS 4B33A 4X65B 1PQPA 4DDVA 3IT1A 5AW3A 5IJ0B 3G2KA 1F38A 1JEQB 4JP3A 4XR9A 2NYUA 1QYWA 2VDLB 3CXHF 1XD9A 3DAFA 2GLUA 4XJSA 2BF4A 3ZBHA 2NU7B 3RHFA 2RHWA 4I9WA 5B1AC 1SXJE 3JVVA 1OX4B 1O5OA 2GEVA 2XCIA 1M2FA 1HFWA 3O4IA 1YZBA 4J0EA 1SBIA 5E3JA 1ST3A 1K68A 1CSEE 2ZZNA 1YDGA 1RYEA 1PR4A 2BGWA 3Q8WA 4JKOA 2QTLA 3LYLA 1K33A 3GUUA 2DE0X 3ORFA 1M34E 3FD5A 5A05A 4DC0A 3QW4B 5DLQC 3UT0A 2H8GA 3MCUA 1E2NA 1XAHA 2QXTA 4LPSA 4H6VA 2CLSA 3N5KA 2RI6A 1HFEL 3W5VA 1UP4A 1Q44A 1VE5A 2DH6A 4QRHA 3GEBA 3APQA 5C34B 1KOFA 3AVXA 3MGBA 4Q47A 2BC9A 1ABEA 2JFHA 2NG1A 3P9ZA 4LY3A 4TLMB 4YDSA 4DAOA 5BW6B 3KOYA 1XTBA 3CZMA 3DBHA 1FDIA 3WFJA 1JUDA 4DLRA 2ZRQA 5I47A 2WTAA 3ZCVA 4JENA 3LMKA 3TR0A 3FVQA 3MS2A 2VP4A 3D1JA 3DDSA 1L5VA 5A9TA 5B7NA 4LCKA 1ZGCA 5IPFA 4FLTA 4HTFA 3PYXA 3QMPA 4NXNB 1Z5NA 4I4TB 3EIEA 3FYSA 4LUCA 2WMDA 1XEQA 4WWHA 5FPQA 1NMXA 2XWSA 4Y2QA 3V7YA 1P6XA 4Y9TA 1EZZA 1OAOA 2R2AA 3OQ6A 3HGMA 5DM0A 1BDIA 4WESB 2QT1A 3KQUA 2ZSIA 2ALJA 3KZVA 4I4CA 4B46A 1ABFA 3EFBA 5LBIA 4Y3UA 1KBOA 3LOUA 3TPFA 4A7PA 3EF1A 3L8GA 3FLAA 1ORDA 5EB0A 4JJFA 1A8HA 1A71A 3IP1A 3LDDA 3NGMA 3HDTA 1UXKA 3QTBA 2Y1GA 3A6GA 3WHIA 4MMYB 3K9HA 2EULA 1EM8A 2UVQA 3ZHOA 2QPAA 1HE5A 3TNLA 3W7UA 1DAEA 1X9GA 4KK3A 3I01A 3M1XA 4X93A 3JD0A 1K8AH 3TIXB 3IUYA 3ANLA 2ZD9A 2HH9A 2X13A 4Q3AA 1W46A 2QRHA 3KSRA 5J4YA 5EIBC 4M2LA 3T15A 3E03A 4F86A 4KAFA 2VJDA 3RJZA 3WICA 1TCUA 5BV0A 3NB0A 3G9ZA 4V0MA 1YONA 2I80A 4WH0A 2IIPA 4KTVE 2CKDA 4AI8A 2XCOA 4M0UA 4HNVA 5IDVA 4JQOA 1P5RA 3I30X 3DC2A 4V3CA 1E9FA 3CNBA 2ATVA 2X2OA 2HU5A 5BRAA 5EHGA 4XAQA 3U60B 4H6PA 4BKQA 4D42A 2HMSA 2GNOA 1FYVA 3PEVA 2EOAA 4DIFA 1RQGA 3QTYA 5IWAB 3GHHA 3GLTA 1H85A 2JBHA 2P1DA 1MRNA 4QPKA 1II8B 1GN3A 3ME5A 4L8FA 2VWKA 1Q8IA 3LCRA 1FS6A 4G84A 4GPAA 2GZLA 4RHUA 4C6SA 1C8LA 3QVOA 2QVGA 2YZNA 4F9FA 1R0BA 8MHTA 2G1UA 2CNLA 1DADA 2BFPA 2OCXA 3NOQA 4QJ3A 4DR2B 3CE9A 5LA6F 1TM4E 4EKDA 3HJGA 2CXUA 2FPSA 2BSAA 1IBSA 3LT5A 1DUIA 3FYCA 5D5QA 3R6WA 4LN1A 2VHUA 1PKEA 2HRYA 4KVZA 1PGOA 4HLQB 2G3YA 3HU5A 4FZVA 1BGYH 4NOJA 2XUQA 5CR9A 3M3PA 1OA1A 2WINI 3AY3A 1AVTA 1V4BA 3A1EA 3H9QA 5C8YF 4C81A 4FONA 3NAGA 1YJ9F 3WRWA 4N6NA 1CUFA 2CJWA 3M4SA 4JUFA 1H2XA 1X39A 1M2OB 5DGHA 2AOUA 1XP5A 3WO0A 3TRHA 4R9SA 2OPBA 5JBQA 2O2HA 1P77A 2B7CA 2FPPA 1IL0A 3T1HB 3ICVA 4PXYA 4IJ5A 5U9CA 2NN3C 5F33A 1YGPA 2HBRA 3OOWA 1H2GA 4Q4AB 4MLZA 5FOXA 3C6XA 4UPDA 1Q5OA 3NYRA 1Y76A 2V4UA 4QUBA 3ZZ1A 4DDTA 1Y5IA 3O4GA 4YCMA 4EG0A 4AJEA 1DL5A 1SUWA 2V9YA 5LQDA 3MJHA 1T3HA 1YB2A 4FM9A 1OY1A 4YRLA 4KLCA 1KKUA 4RK5A 1T9GS 4MARA 3I9KA 1QH0A 4WXMA 2UYGA 2IPMA 4BU0A 1BCCH 1I94O 4CRWB 1XQXA 4DCMA 1EVIA 1R12A 2PU7A 4DR3O 4X9QA 4A92A 3O75A 1PBTA 2XNDD 5B64A 2BI7A 3KEQA 3DMGA 2Z43A 4XUEA 3SVZA 4D3YA 3FLMA 4REQB 2J4FA 5T7BA 2Y4OA 3AFMA 3HA3A 2V3CC 3NVIB 1BH2A 3A0RA 2OQVA 5BRNA 4MQFA 4GR5A 1A8PA 2GEKA 4XFKA 4LBEC 2G0TA 2H00A 1BHAA 2IHZA 2QV0A 5KHKA 4WXRA 1Y8ZA 3LLCA 4U0KA 1T3SA 4IYHA 1CEYA 3OECA 4BEBA 3NUQA 3LUTB 5LNK6 2WPDG 3V46A 1QAQA 1MAVA 2HA3A 2CLKB 2WKRA 1YO6A 2BZSA 2NLJC 4HGOA 4FOPA 5LL6P 4X44A 3AETA 4MIYA 3A2KA 3K8OE 3KZOA 5AJUA 1XVLA 3NK7A 4AY5A 3FETA 1NVMB 4DDHA 1L5YA 1FFWA 1GU1A 5HQTA 2C8KA 1JNYA 1OOEA 3H11B 2ZETA 5DNAA 3UK1A 1U9YA 4MP8A 4FPPA 2XNDG 3UCXA 3Q4GA 3GJ8A 1GARA 2RAUA 1N5LA 3HA2A 1NJSA 2D74A 1DT9A 4UEKA 2B78A 1H8HA 1LBQA 3A11A 2O6LA 2CLFB 1H2WA 4WCFA 4G8CA 3W9YA 3RV3A 1VKNA 4U7DA 1D1PA 1NMZA 2X5KO 2O57A 2FKAA 2B82A 2TYSB 3T0FA 2ZS8A 3ZHXA 5FA5A 1M0TA 4BQIA 1T0HB 4PG4A 1TO2E 3HGQA 4YWHA 1G4AE 3CCMF 3CZ9A 3E8GA 4JI3O 3FNIA 2ZRBA 1NXSA 1Z4IA 4F12A 2JS5A 4M7WA 1KNXA 2IYOA 2QD1A 3H42B 3R4CA 1AE1A 1PJTA 1A9QA 4R2IA 3ZD6A 4R1TA 4D9JA 2GOYA 4LDRA 3BFVA 4L5BA 1VQPV 3UC9A 2FG7C 4ALKA 4JI1O 2XTNA 2JH8A 4XB2A 2O9JA 2Y1LA 5MGBA 2X6TA 1HR0O 5FPOA 4X0EA 1XZBA 2EF0A 4MYHA 5EMHA 3ZW8A 3BE5A 4XDKA 3VZRA 3O2NA 4I1PA 1QDLB 3QZUA 4W5QA 1BFDA 2ADMA 3VO8A 3H9GA 1GZVA 3VH4A 3KQTA 3UVEA 2GYYA 3GRVA 4MOWA 4GM1A 4GWKA 5E9AA 5GZ1A 2C3MA 2MSCB 3WMFA 2RD2A 1NJ2A 5K8VA 5DNDA 4G65A 1I7PA 3T0IA 3AUYA 4IIDA 3P3NA 3OIFA 1W8IA 2X2EA 5D5PA 3FFBA 4JAVA 3D3NA 5AXCA 4TYNA 4DBZA 4OO3A 4FN5A 1NQVA 1H3FA 1XXHA 1NKVA 2P5TB 2ZBFA 2J0UA 3E89A 4QAQA 2H3EA 4Y98A 4L6IA 4S24A 3KKZA 3OWOA 1K4KA 2WWXA 1VIDA 4XEHA 3HB1A 1E9AA 4RUKA 2UU9O 1L5QA 2E7ZA 2IPLA 5G0UA 1X80A 4ZHWA 1FDOA 1JWBB 3G71V 1YIJF 4MWSA 1US6A 3SG0A 2XGMA 4MAAA 3KKYA 3AY6A 1I9GA 4YUZA 3JQ7A 4DR7O 4E03A 2P8JA 1L4BA 4CM1A 4NZYA 2FPRA 4BCDA 3DLPX 1STOA 3EZXA 1GZHB 3ADOA 1I3NA 3GQBB 4H77A 3UBMA 5ALMA 3LYUA 1KHHA 5HILA 2DUJA 3G9TA 3GLQA 3CW8X 4E6EA 2IIBA 3F7MA 1XPJA 3BHPA 3WVNA 2Z1DA 3KJGA 3Q7EA 1T9AA 4IM7A 2ZR2A 3V8BA 1G8HA 1SCNE 2ECKA 3ZCRA 4DR4O 1KMHA 5HJEA 2PRIA 4LMAA 3D5EA 1VH8A 1WDMA 1OU4A 3AHFA 4QDXA 2M32A 3TXXA 1B1AA 3QE2A 5B30A 1XK6A 2PH7A 2DFTA 3RSFA 2DPMA 2HMVA 3VDRA 2VT2A 2FMTA 4DZTA 3HKDB 2RKWA 4M9SA 4K9OA 1US8A 3IL2A 1B8VA 2NWQA 1P5FA 3QWHA 1YC2A 2QSYA 2O1WA 4RPHA 4B31A 3TXAA 2FR1A 2ZVYA 5IDXA 1ZN2A 2G8LA 4E6PA 2IPAB 4FYHA 4URVR 3JW8A 2Z9BA 2ZDIA 1CZHA 3WYDA 4QTUB 1GGHA 3WJAA 3LBAA 5JIBA 4BMVA 3KQMA 2MSWA 4QUEA 4UPVA 4WZAA 1SS3A 4UMFA 1PT8A 1OLOA 3IEPA 3D0KA 4Q6BA 3EASA 2NO4A 3WGQA 2QYTA 2QK4A 4DVJA 4JYMA 1JQDA 5C51B 3NH6A 4Q9NA 2CD9A 1P18A 2Q3JA 1UC8A 3NVAA 4FINA 4LZLA 2W90A 1IHXA 4IY1A 2QJRA 1FW8A 2WR8A 2QPLA 5BN5B 4BKMA 1SVMA 3FD6A 4RTPA 4WVFA 1K9VF 1NX6A 4CDRA 3GRRA 4BAGA 5IF3A 4LZNA 4IFEA 2OR3A 4QRIA 2AB0A 4AIIA 2D1SA 1PCXA 1W19A 1FUIA 1QO9A 1XD2A 2MSLA 3PC8A 1JEDA 4L51A 4EDFA 1WULS 1QSGA 3ML1A 5DFAA 5IDJA 1HOXA 2GN6A 4XJVA 2HJWA 3KTAB 4FZRA 4GMGA 5K6AC 2RH8A 5C5IA 1P44A 4CMGA 5T5QA 2RMKA 2QUBA 2YWBA 1UXIA 4PC3A 3ZIUA 4HXYA 2JK0A 1YQNA 4AJHA 2QTTA 2EU8A 3BAZA 4GZ5A 4FDMA 2B1IA 4YROA 3T7IA 3U3OA 3O4JA 2VTEA 5CCDA 4CDGA 3F6RA 3BABA 4CBCA 4O2AB 2FJPA 4OQPA 2IEDA 5FBKA 5GTIZ 3KOOA 4E1BA 2OHJA 5SY6A 1P17A 4CGYA 3ZUGA 1QOZA 3UJ3X 2BKLA 4N49A 3WYFA 1EFTA 5TPWB 4E15A 4QKQA 4B79A 4C08A 4QJFB 1ULSA 4BJHB 1KORA 1QVVA 1KH2A 2Q3LA 1SZCA 5C1IA 3JATB 1G38A 1X1EA 1KBZA 3CLSD 4GSKA 3L8DA 3QUCA 5KLVH 2JCYA 3RASA 3BWMA 1T3TA 1KEPA 1VF5B 4JI4O 4WFJA 3PI7A 4QUHA 4WY8A 2EZTA 1KTIA 1YITF 5H16A 5FJJA 5JLAA 1IEVA 3WXBA 4PY2A 2HO4A 1MDBA 1AX9A 2WWYA 1ILWA 1V48A 3KOWA 3BOSA 1S3FA 2XOKD 3X1DA 4DR6B 4G5FA 3BK7A 1YFLA 4LJKA 3LSTA 1YJCA 2J3KA 2I7DA 3QFRA 2EIJB 3RW9A 3SNHA 2HNBA 5K3SA 2Q6VA 2RC5A 1XXLA 4B3TO 3FYUB 2VPPA 4G5OA 2BE7A 3SI7A 5JWRA 1YRBA 3CUTA 3VAYA 5AR1A 1ODKA 4MA5A 2UYKA 3W8DA 1OTYA 3OUZA 2P3SA 1MB4A 3CA8A 4UCTA 1MW8X 4R1QA 5BSRA 3G49A 4DSUA 1ZUNB 4U2EA 3KAPA 4L5JA 1GK9A 3PUKA 1L9KA 4PA3A 3LXMA 3L1IA 1OKKD 3R7BA 1UDAA 2ZYUX 3ZCSA 1YJNV 2HU2A 4DA9A 3LY9A 4NL4H 1C2YA 2VZ9A 3DTVB 4PINA 2A3QA 1TM1E 1N7GA 2CMDA 2YJTD 3IRVA 2DHCA 4BWAA 3HJAA 2PZMA 1SUAA 1XZIA 2LE0A 1KI8A 1MU0A 3COVA 4CLRB 1U96A 4XTRA 1ULBA 2XOKG 5BW5A 4PJ0Z 3Q6IA 3ZVRA 3FOEC 2J59A 3MNFA 1JPXA 3U9SA 4Q03A 1S1MA 2OIEA 5AW6A 1X8XA 3QV1A 1SBNE 4M9CA 1L7AA 1KDZA 3ROMA 1O9GA 4AF7A 3SBDA 3D3QA 2YUTA 2FCRA 3JQ6A 4BPRA 4E2FA 3Q1LA 3URKA 3AB8A 2CLMB 3LQRA 1SKVA 1CUYA 4HNAB 1T2AA 3DTNA 2NPOA 3P45A 3OPQA 2VQFB 4ZARA 5FI5A 3JTMA 1FDUA 2E75B 1M2EA 3BILA 5C5DA 2JJ1D 1SVWA 2C2GA 2B4TO 2Q2OA 3B82A 4DMHA 4KN6A 2QI9F 4QFMA 2EJWA 2ZRJA 2BM9A 4UVHA 3F9CA 4WOJA 1MABA 3LWZA 4WAUA 3DDZX 3LPDA 4KXWA 5CBPA 2PZEA 1B0AA 3H7AA 1MA0A 3GYGA 3JYOA 4QUAA 3M6VA 4KG7A 1GGNA 3LO5A 1XNGA 1RQXA 5DIFA 1R5JA 1P3DA 2JJ2A 1FSPA 5JZ9A 4LHVA 2HTEA 4C82A 3S27A 1NBAA 3EBOA 2VC2B 5D8DA 3WXMB 5CG1A 2WSYB 1IG3A 3ETLA 1DP4A 4F3NA 1FEZA 3EPPA 4DY4A 3QM1A 2ACVA 1RM0A 2EGHA 5A3JA 1OCZC 1ZOIA 1K6EA 1WP9A 4FGLA 4GVPA 1AI6A 4ZJZA 3GC6A 4B7ZA 4YUYA 3U6KA 1Z0IA 2QAGB 4FP9A 3TYXA 1Z0DA 3B5IA 1PZNA 2JJ1G 2I1VB 3DZJA 1BWRA 4BT4A 5ERGB 2XBUA 1P80A 1Q1ZA 4BUZA 3P0FA 2IF0A 3ELYA 1ZGBA 1UBRS 1P5JA 3M70A 2ZSBA 2WTUA 1AT1A 4E51A 3FB5C 1ZO8A 3DE2X 4QLOA 4G4VA 1QCDA 2B5VA 2O2CA 1GRNA 2HJSA 3F8WA 4QGPA 3F3KA 2GBGA 4HSGA 1KO5A 3DFUA 1DIGA 4KXMA 2WSSA 4HYQA 4JWTA 3Q3GE 4IICA 2AJBA 2FFHA 1KI6A 2HIGA 2ZR0A 1Z35A 3Q3HA 3ROQA 4R40B 2ZWIA 2GCGA 3ONWA 4MR7A 3TIFA 4DZZA 3FVTA 4JBXA 3BA1A 1YE5A 2Z6AA 2W2LD 3G79A 5JJ5A 5ICEA 1A8SA 2B9VA 4WZBE 2QGFA 2XNKA 5LCXA 3A31A 4RXUA 1K88A 5FUXA 1T8TA 3HE3A 3M6IA 5FTJA 2A30A 2QRNA 1FFSA 1EVLA 3SR0A 2PV7A 1Q7GA 2IPNA 3NR2A 2ZOSA 1B2RA 3IMCA 1U31A 3I4FA 3VQTA 4QM6A 3ZGLA 1Y5RA 3CXCF 4E07A 2I9KA 1U7UA 2ZIEA 1SXJB 5LMZA 5C52B 5HX7A 3HDJA 1Y3HA 2QG4A 2Z2ZA 1MW9X 3AR5A 5IJAA 4LHYA 4JYZA 5EEGA 1KAMA 1PLLA 1Q74A 3VQWA 2XMSA 5GY7A 2Q3DA 2HF7A 4LH7A 5HS4A 1YA6A 1EFPA 5HQJA 5FEUA 2HSZA 3L1VA 5KMGB 4QU8A 4WOBA 4N5DA 2YHBA 1YUMA 3VAZA 1WCYA 2P9QA 3ZP4A 3GD7A 3EDMA 3UNXA 4ENTA 1A2KC 2OCGA 2PXXA 3WY9A 3R6DA 4LDPA 1BVYF 3IUSA 4Q9AA 2VJYA 2GSDA 3BK2A 1R4MB 2C4HA 4NDZA 2AMLA 1SVKA 1N7IA 3AEKA 4V2IA 2GPNA 4RGVA 2QUHA 4O0MA 1RNLA 3W4IA 4AJ1A 2YJGA 2VH5R 4XWOA 3CRNA 4LXXA 3LPLA 4Q20A 3GT4A 4EY4A 2ORVA 4WBNA 4F6CA 4YMGA 3ZHBA 1KJJA 1SQ5A 4EJ6A 1RLGA 5BV1A 4F46A 3HHPA 2RK3A 4JUAA 2NUPB 1HKHA 4NK4A 4GXNA 4ZQFA 1BROA 4HDNA 3BTVA 3DO8A 3PWTA 1HL7A 2J3IA 2EFGA 4HNQA 2EL7A 4I5IA 4JI6O 3DT8A 2LP7A 4DYHA 2G4LA 4RELA 4KRYA 3HKBB 4CHGA 4RJLA 2H57A 4BE9A 1SHKA 2OBYA 3DW3X 2YS6A 3CMMA 2M6LA 2A94A 3KXPA 2QUAA 1N9ZA 4N01A 1H9CA 1UKCA 1LK7A 3SHTA 5FNVA 3CCFA 1QR2A 4HY3A 4JBLA 2OM2A 3RRBA 3D3EA 2Q27A 2AWOA 1MVNA 2BGKA 1RLJA 2OCCC 3DKKA 4RF5A 3F5QA 1U2RA 5IT9A 3TGPA 1N75A 3ZGYA 4LJ7A 4DA8A 2Q2VA 3P9IA 3ZWOA 2WUFA 1PNRA 3UGQA 2Q8NA 3USZA 4HS4A 2OQIA 1N8RW 5EEHA 1NNI1 4WFFA 4B3SB 1KEVA 2H0QA 3L74H 3L75H 2W22A 3H9BA 4GE3A 4MVUA 1LU9A 2QTGA 5LBTA 3UMCA 2R751 2DQYA 1N6IA 2YYAA 4KOEC 3VHRA 3RHTA 1TK9A 2FVYA 3X1KA 5DHSA 5FHRA 4QNNA 3LBFA 3R9XB 1WQ1R 1C14A 5AWFC 2ZAGA 5AHWA 2GZ1A 4BRUA 2E5LO 3CD6V 3HCRA 4A2QA 4JFAA 2GF9A 4EHFA 3AG5A 1Q7CA 5BR4A 3WB2A 3S2EA 4AICA 3CH5A 4HZ3A 4IGIA 1XRSB 2QP4A 1G21A 2F59A 4K40A 3MILA 3WGNA 2HJVA 2VP3A 3AG3C 1BGVA 4TVBA 4W4TA 3KBOA 1Y3BE 2GAFA 3O9ZA 5E6RB 1SCUB 5T8KC 2QMHA 5A1TA 2OBFA 1IK6A 2QZJA 4YRKA 4DRXA 2AZMA 5CBFA 3ZXUB 4R84A 1EK1A 1TK3A 4Z7QB 2KI5A 1IY8A 5I7OA 1L4YA 4F6RA 4PCAA 1W6UA 3A1VA 2B4YA 2FMIA 1PS0A 4RGBA 2QENA 4HQLA 3MW8A 5KYXB 3OQPA 3I9LA 1LCIA 2JKYA 5KJCA 3KJHA 3VYUC 2ZRLA 2ZJ1A 3LUGA 4AYXA 3DAYA 1QTIA 1W1UA 4Z9AA 2POQX 5B6JA 4MW3A 1LSOA 4OP3A 2XXJA 2YBEA 2RHDA 3ILSA 4TV9A 5JW6A 1CUAA 3ZRVA 1F4LA 5G2OA 5KHAA 5JD5A 9ATCA 3TGWA 3ZE0B 1BC5A 1NVUQ 4HXGA 4WXPA 5BOSA 1CUGA 3DE0X 1JJBA 1JG1A 1QR6A 1R9NA 4YLYA 2YJZA 2R7MA 2FPOA 4B5KA 2HMAA 4W8OA 4XCQA 2D1QA 4D26A 4HI0E 3ZK7A 1YCHA 2JGKA 4WRRA 1ZEMA 4ZANA 3A06A 4WOCA 2HNAA 5EBMC 4B2PA 4IOMA 3DZCA 4MHTA 1T15A 3VUEA 3LX8A 1SHTX 2YHSA 1OZ0A 2CNWD 1VG1A 3TMYA 3K08A 1CUXA 4PXSA 2DYYA 4DA4A 3K0AB 1SRYA 1YE3A 1M6VB 4AUMA 4X20B 3AILA 4BPBA 4KKXB 4AMYA 1R6NA 3VH2A 4FWTA 3VSBA 3T7EA 4AN0A 2J87A 2JEOA 5I9BA 1SESA 4NFLA 1UL1X 1C8KA 4GS5A 3V8PA 1NRXA 3B2QA 1ZW1A 4YT8A 5AKHA 4P3KA 2J7PA 1GNLA 1QXSA 4RPLA 3E8FA 1EN4A 1Q6IA 1K9SA 1CUDA 5CVUA 3D7LA 4U39A 4CTJA 1SF9A 2J9XB 2Y1WA 1VL2A 4IMIB 3FR8A 2H4HA 2F3TA 4ASUD 1QH1B 4IMPA 4URYR 1KRWA 3NTQA 2PJZA 2H1HA 5GMOA 2XUDA 5B1HA 4US2R 3HYSA 3UWPA 3ML0A 1AILA 3MEQA 2WD7B 4NU8X 3WG7B 4ZIRB 5ESRA 1ZAUA 1KO8A 1NHGA 4BYMA 1JSCA 3T3DA 1JHYA 1XNJA 5BR8B 4RKEA 5L4NA 3TTUA 4LXGA 3UENA 1DBRA 2FQ1A 1G5RA 4MUXA 3ZXIA 2IBMA 3PTZA 1UC4B 3S7ZA 4HYOA 4UTZA 4AY4A 3AIMA 4V0NA 1QV6A 2BEKA 3W5AA 4FOOA 1INLA 1R15A 4C0SA 4C0XA 1GPDG 3F0TA 2A0YA 5AHOA 3P9CA 4X85A 3TD3A 3D3JA 1EFRA 1SM4A 4KIUA 5EQJB 1RRGA 2AMTA 1W85B 2OE2A 4GQBA 4NS4A 4U7JA 3CUYA 2VQEB 4U2KA 2QX7A 3NRCA 1F2TA 4PYRA 3G0OA 3D7RA 3N2LA 2P3OA 2GM3A 4OFZA 3OTQA 1OCCC 2BTUA 4UVIA 1AY0A 4DNXA 4E12A 1IH8A 1FP6A 1EINA 3BD9A 3RVOA 2NZJA 4HR7A 1J49A 4CKYA 3J7AC 3R66A 3DCIA 2NO9A 5GIPE 1UIRA 5CMLA 4CV0A 3OHSX 4YNBA 1NXPA 2QT0A 1W93A 1FXKA 2XNHA 4MW7A 1IJKA 1G8SA 5B57C 5KWVA 4M7PA 3DBOB 4U7PB 3UYLA 2VBFA 1N2JA 4D9CA 4M46A 3ZVNA 4EECA 3K94A 3SVTA 5IXYA 1LV7A 1T2DA 2R7LA 4XX0B 5FPRA 1XRNA 1ZICA 1VI5A 1B43A 4P53A 2C8VA 3Q4HA 1BNCA 3IXMA 3BGDA 4Q9KA 1OLUB 3M4JA 2WG2A 1X1AA 3GFTA 2KWIA 4FILA 4LS3A 1VMKA 1RZRA 3QMWA 2R25B 2PWYA 4PO1A 4NHOA 3QI2A 4ARUA 4YRMA 3BFRA 4D7AA 5DCLA 2RBEA 1NRWA 1ZMOA 3WGUA 5BSEA 4LC1A 2ATKC 3EPJA 3E0XA 3TQHA 3CEMA 1ODJA 4NV0A 4PPFA 2YWEA 3FYTA 1MR3F 1U1IA 5HZGA 4WFEA 1TCCA 2HA6A 3K0BA 1ISSA 5KWSA 1T5BA 2JG3A 1FFTB 5FRDA 4JQSA 4RF2A 2O8FA 4G4WA 4BVFA 3CG0A 3SC4A 3L06A 1I6WA 2QN2A 4S05A 3BGIA 1IBCA 2GTPA 4FS3A 1Z8NA 1LI4A 2WI8A 3IP7A 3PJFA 1NXWA 4ZZ1A 5E6SB 2R4QA 1JQ3A 3WJ2A 2Q7OE 5JS8A 3B12A 1X7DA 3WIOA 4F2GA 4GL2A 2JAQA 2X6QA 1W40A 2W0SA 2HYIC 1XTKA 4E2XA 3AF6A 5JXGA 4S04A 3R5XA 2ASEA 4QYIA 2QKCA 3QJGA 3ICWA 3U49A 1DC6A 3OC0A 1XPRA 1EE9A 4D3XA 4QPJC 3JR3A 5BW8A 3S3WA 1NOKA 1I4WA 2I6DA 5CFRA 5A9GA 4DV2B 3Q5GA 5GADl 1PNMA 4JI7O 1VL5A 1EWYA 2AXTZ 1I0ZA 5GJWC 1A7AA 5AM0A 5B4UA 2ONZA 2FPKA 4ODIA 4X91A 5L3FA 1QKIA 1A50B 5JEDA 3HG7A 3RLIA 3CCSF 5DYNA 2AEJA 1UBGA 4ZK2A 1ZZEA 2IYVA 1HZJA 2I4LA 3NUGA 4LMBA 1UJ6A 4N5LA 1XZKA 1ZA1A 1H1LB 1TJNA 1WZ2A 4BIIA 2DJ5A 3OTWA 4PHCA 5FORA 1JLMA 3EZYA 4OQ4A 2O8DB 1YAJA 1NT2B 3NHLA 1NN1A 4Q1EA 3CLSC 2FN4A 3ZU5A 1C29B 2QNRA 1Y1SA 1AZWA 1UBJS 4HC4A 1NUQA 4B5CA 4CCYA 3PA8A 5ALOA 1DKLA 5GONB 3DF7A 1GGJA 5E8JA 5I3CA 3TOVA 4ILKA 4LDZA 3HCPA 4Y1GA 2FWJA 4CQMB 1P7BA 4DV5O 2ZUVA 4OL9A 1CJBA 4B32A 3RSQA 3ZIDA 4OVKA 4HRXA 1RP3B 2GEFA 5HUJA 5K3CA 4DSAA 4H60A 1CQWA 4MVXA 1Q77A 5JY6A 4IX1A 2Q4TA 3VKGA 2FRDA 4O2BA 4UTNA 4X5OA 2JNWA 1PJ3A 2BR5A 2QTMA 2ASVA 1CNMA 1SQGA 3VNSA 3OJCA 1DUSA 3JD2A 2Q1WA 1LLDA 1ZQ9A 4C8EA 4EA8A 2VTVA 2D7CA 4R98A 5EJ2A 2J3LA 3MJ4A 2QJOA 4MVJD 2EW1A 4OMFG 4O02B 1U3FA 1T2NA 2Q5CA 1WDTA 4NX2A 4EY7A 1NULA 1DX9A 3VDQA 1BXRA 5E4YA 2DPLA 1PD0A 3YASA 1K9MH 1NRIA 2BISA 2VVTA 5DNEA 1XJ5A 2Q62A 2PCJA 1VL1A 2ECQA 1SZQA 3BRCA 2PPVA 3A1CA 2ODEA 2YWXA 4ZWNA 4K8OA 3EEYA 5B3JC 3I37X 1P0CA 4OIMA 5E0KB 4OGLA 1KFBB 2XPCA 4U9HS 4P93A 5BPHA 1T0KB 4LV5B 4K6GA 2ZJBA 2V4MA 1JQEA 1ADGA 4XVRA 1JJOA 1L0NH 3Q8HA 2FXIA 1SD5A 2J4CA 5ILOA 1G8GA 2BKEA 3Q72A 3VRHA 4HT3B 2QXYA 1Y0BA 3DXYA 1YQDA 4JVMA 5CD9A 4RVSA 3FPCA 1KZ9A 5K45A 4RHCA 4LF4B 3PQ7A 9LDTA 3GGJA 1HE2A 2PUCA 2DUNA 4BB5A 5HKKA 1FFAA 3IBFA 2WIKA 4LOJA 4M8LA 1NBMG 3OFSA 4R2HA 1P0PA 5I7AA 4MTFA 1UEIA 1GNPA 3U3DA 3AW9A 3D6UA 4J07A 2QTVB 3RKSA 3ZNOA 1KZYC 5DSZA 4MVJG 4Z9BA 3IR9A 1LDGA 5KYYB 5FLEX 2ZUDA 1FJGO 1UEXC 3UJ6A 4JIMA 4YECA 3PRHA 4IYIA 5LBUA 3SE0A 2H0AA 3MIIA 1IJBA 5IC5A 2XI4A 4U3JB 3AMVA 1DHRA 3ACBA 4D6XA 1U8AA 5KPJA 3J81M 5EP4A 4DGSA 2FQYA 2OCIA 1N8NA 1RXSA 3IKEA 1VBKA 5HM8A 1KH1A 2IITA 1C7ZA 3ZCPA 5F2OA 1NTOA 4DDMA 1E6KA 3G1UA 5ARCA 4X7MA 3LT0A 3QF7A 1SEPA 4P4UA 1VIAA 3K0SA 4HMOA 4OBBA 3SQWA 5K8UA 1T3ZA 3W7TA 2Z5LA 3E35A 3FPKA 2O0JA 1HY3A 1RRPA 1VB5A 1GG5A 2QBYB 3Q7QA 2C9BA 2AI1A 3FJOA 3NDRA 4J2OA 4EFBA 3JARA 1PUIA 1RZUA 5AVQA 4L07A 3HP7A 1T34A 4W5RA 1TT5A 4LNHA 1SXIA 3DZFA 1QHHA 2VDQB 1NBEA 2HL6A 1BA2A 3AO0B 4NTYA 2GPBA 2C97A 4KXFB 3ZTYA 2Q4OA 1SR8A 1UBHS 4UU8A 2GKOA 1TAUA 1U4SA 8GPBA 3LC2O 1FBNA 1QHTA 5IY5B 1MT3A 4MMZB 4JR0A 1KSHA 5BUSA 4DQDA 5BSUA 3DWEX 5EZ5A 1I8TA 2VFAA 5A71A 3EGWA 3OD5A 2JGIA 3EVTA 4DDWA 2RCNA 2GK6A 1Z63A 2NNWB 4V0LA 4LYEA 2HV8A 1MCZA 3B1VA 5EZSA 5HY0A 1P81A 13PKA 5B1BC 1I2CA 4HATA 1ZMBA 4FFDA 2RJZA 3C5CA 4E5MA 1EFLA 1SQQH 1VRVA 2YMMA 4KZKA 3DNMA 2OL4A 3NYIA 4RZ3A 3TWOA 4MAFA 3GEDA 4KWCA 3ZNQA 4MO2A 2FQWA 2R87A 4RLFA 5KDOA 3MCVA 3MCAB 1GXSB 3S4YA 2IHYA 4KZPA 4LVCA 1JB1A 4YRZA 2EW2A 3UMVA 1KRHA 4RX1A 2P0AA 4PWZA 1TTHA 4JJAA 2R6HA 5L6MB 3W5HA 4O2RA 2AX4A 4DQ0A 2VS0A 2R5WA 2CHSA 4NBLA 2XCSB 1KXJA 1R0LA 1T5IA 2VSFA 3JSXA 3EGOA 4LWPA 3JVUA 3MTJA 1XN1A 3SDZA 1VRWA 4X60A 3BQ9A 3HFSA 4FFNA 1KO1A 4OLAA 3IHWA 4Q3LA 4J80A 1S4QA 3HSKA 3FDFA 5IH7A 4TGLA 5TJHA 2QKAA 5FR1A 4IR7A 3PWKA 1OWLA 4WXHA 4IIEA 5EPEA 3FSGD 3QKIA 3QVUA 1R0SA 4KIFA 2X8JA 4LQDA 2WWTA 3DEIA 4KGDA 5H6QA 2DFPA 4ZO4A 4MUIA 3DOCA 4AYTA 4JUBA 1FLAA 1YHQF 4BQFA 3GVPA 1MGPA 1FYJA 1ZK4A 2XKAA 1EKXA 4FCVA 1FYWA 3IT3A 3WYCA 4BVTA 1C9NA 4Y9UA 2ZQ5A 2GAJA 2H59A 3PSHA 3QVJA 2C2MA 2Y1KA 4NEGA 1F51A 3RUEA 1I5RA 4D8YA 3AIKA 1D2CA 5GOZA 5KNCD 4N0DA 2B25A 3GW8A 1SG0A 1KE2A 3TQCA 2BP7A 1H2FA 1J5EO 4C5AA 3GFVA 3KPUA 2QN9A 3OM8A 3SF8B 2D1YA 5GIOE 4JXJA 3FLEA 2JW5A 3GYBA 2B8EA 1JLHA 2ZDQA 1Q86H 5IANA 3BD7A 4WZBB 4Q4JA 4OHXA 4M7RA 1N6KA 4WK2B 1CWUA 4L4XA 2HGSA 3P9QA 4LVUA 5JLJA 2DWQA 1NAHA 1ZH4A 4CFSA 3QK7A 4EMSA 3VMFB 1KEKA 1KIAA 2C7PA 3ASOC 2G5CA 3DO6A 2O5EA 3K8YA 2Y1CA 3MPOA 1LF5A 4LRQA 5IJ9A 3N87A 2YXYA 5KNBD 3H9EO 4B3BA 3FZNA 2SNIE 5AI5A 3ZJVA 3G6BA 2F43G 1LVUA 3GLHE 2R68A 3W7AA 1E5XA 1HG1A 5ENVA 3KIZA 4WNAA 5K0BA 1ZW6A 1W4BA 4YAOA 1ONBA 3ZI4A 3A6EA 1NU6A 5DTMA 3LWRC 1XDGA 1P7PA 3SYLA 5DXFA 4YCAA 1Q12A 4O4JB 3KFLA 4GXTA 1DAIA 4L85A 1KOJA 4NECA 2VGNA 4IDEA 4HQFA 3M33A 3HEMA 3NBFA 7MDHA 2AMVA 3E1KA 16PKA 4BGIA 3LHIA 4WNYA 1DC7A 1GRQA 4HBNA 5HTKA 4IKPA 4RTLA 1V1MB 3TINA 1RXEA 4RD1A 4YP1A 3FCEA 4GOMD 4IDFA 3SICE 3L05A 3NOXA 4JITA 1G9XA 3DOHA 4GI3A 5BWCA 5JBNA 1E92A 2Z1NA 1T35A 4HB0A 4O8CA 2APJA 1JXQA 2R00A 2RONA 2B30A 4G26A 1D2RA 3BPSA 3CF6R 1G2PA 2RJ3A 5DNUA 5THQA 3B53X 2R62A 3VHXA 2WJJA 4JOQA 3PDHA 3K32A 4OGGA 1RHJA 5EZYB 3AEQB 2UVPB 3C3XA 4D3DA 1HV8A 1LF0A 2BHNA 3RF7A 3CX5F 5K09A 3UHJA 4OU4A 3KE9A 3GARA 4PX2A 4IDDA 3ZGNA 3ZS8A 5JMTA 1I9CA 4RE5A 3WPXA 4HQNA 4UUOA 2G70A 4Z9YA 3UMRA 2OGUA 2VNJA 3WIVA 3WAJA 4HZUB 4JC5A 2XLBA 4KE9A 1II0A 1COWD 1YL5A 1RAEA 1KO4A 3D6NB 3I3SR 4UQPA 4MUAA 4B3DA 1MJGM 1NR7A 1DRVA 5A4DA 2GDJA 3D7NA 2QA4V 3DV2A 3CLHA 5TISZ 4WFBV 4L6CA 1KDRA 3GFQA 5GV7A 1EX9A 1XMJA 3I0NA 2J33A 4UTOA 4CBVA 4P5EA 4TQAA 2QN3A 4FYJA 2HHAA 1GLVA 4K1LA 1Q50A 4D1YA 4XB6B 3FMPB 2O1SA 2BWJA 2OV4A 3SYQA 4JH0A 4EL0A 1DQSA 1R9GA 4UHKA 5BYAA 2HRRA 4UDOA 2C0PA 1VJ0A 3CCEV 1XREA 1AKEA 3QY0A 3V5NA 1Q21A 1NQTA 4L7QA 4V0OA 4ARBA 4CCSA 5E95A 3DE4X 3H1FA 6LDHA 3BL5A 1YKFA 5CW2A 4JV5O 5L3QA 1COWG 4YV1A 1M73E 2OV2A 4PANA 1XNQB 4XRRA 4HWGA 3AG6A 3OPVA 2XCTB 4Q9DA 3N8GA 3B36A 3N70A 3A70A 2NTVA 1I14A 3QVKA 5CB4B 3TZCA 4XVHA 5J4KA 2JBWA 3QV2A 2Z58A 3RVDA 2AFRA 3DPIA 2PA3A 3LWQC 2FDRA 1Z62A 3U48A 2E3JA 1H38A 4C4WC 1WSBA 1KJZA 3V7WA 1JGTA 4ZVKA 2R72A 4ZMBA 2YX1A 5I7UA 5EYPB 2JEUA 4BFYA 1L7DA 2PGAA 1KOGA 5DTEA 5BNZA 3DB2A 3THOA 2AW3A 3IS3A 3ODGA 4X92A 1X7ZB 3GEMA 1H1TA 4OBXA 5L3SB 4CL8A 3OFKA 4XD2A 4F71A 3KPVA 1GP2A 3VBBA 1JT2A 3AVYA 3H4IA 4TTTS 2BDEA 4UHCA 4M22A 4KX5A 3AK3A 3A25A 1XWFA 5ALQA 3UG7A 1W2WB 3DAGA 4CT5A 2YOFA 5IP5A 1J06A 2QE7A 1DFGA 9ABPA 1JHOA 2CVOA 1UBFA 2RIPA 5ALJA 4IGFA 4UZFA 5H70A 2XT6A 2C2KA 4MV5A 4XIJA 2FSPA 2JAPA 3DLHA 2PUHA 3FWYA 4AURA 2O0LA 4PFKA 4W1QA 4U0JA 6ABPA 2P2YA 2VBIA 1G98A 4ZREA 2CLEB 3K5HA 1PJLA 5B7PA 4OXSA 1YWGO 5IT5A 1HYGA 5EXDA 3K53A 2R1VA 5G0TA 1R3KC 1IYZA 1TMGE 4XUGB 1E99A 3E8SA 1D8AA 1UKEA 3G85A 1IN1A 4NYMR 2QTZA 3TZEA 5A4JA 4BNDB 2I4IA 1FLNA 1M8FA 4TT3A 1RBZA 5HDQA 1GA4A 3CS3A 1K5PA 1RD4A 1UIMA 3DO5A 1EX6A 1D3AA 2G08A 3RSGA 1HL3A 5DGDA 3WTBA 3SJCA 5LGTA 4J4TA 5MFZA 4IKEA 3GFGA 5KYGA 2AYXA 2OILA 4N41A 2ZSHA 5FO1A 1ZHOA 1MTZA 3UB4A 4J3FA 2EJUA 1JEYA 4OSEA 4CQNA 4MR9A 1YRWA 2NT4A 4IF4A 4GRIA 4LCBA 1EESA 1RCTE 2PS9A 1I5EA 2NXCA 4FLWA 1UBTS 4N8EA 3U1BA 1J21A 2KSQA 4FQ5A 3EWSA 4LOKA 3R20A 4IXTA 2J9GA 4HDSB 4H7DA 2HRUA 3KRTA 5B8FA 1RI2A 3QLVA 2VHWA 1UMBA 2HCTA 4D98A 2YJ3A 2CWDA 3BWBA 1C0LA 1WTAA 2P4EA 1B14A 4DQVA 3V8NA 1CR4A 1T5HX 1UKVY 4RK1A 1FSZA 5K0CA 4OFXA 3KAQA 3K30A 3IBTA 5G4KA 1X70A 3CC2F 1JHXA 4EGAA 3JQ9A 4I1SA 2BRUC 4ENSA 1VQ5V 1R9JA 3W8NA 2IV7A 3OE7D 4Q7LA 2WHEA 3W34A 2XWQA 4HPWA 5CVEA 4U8GA 2IJJA 2ZB8A 4IZ6A 4G89A 1R37A 5HF5A 5TF4A 1RAAA 3M5CA 3RVLA 4CMIB 3RS3A 3AHCA 1VQOF 4C20A 4I5SA 3NUZA 5JAIA 1G1XB 1MB2A 5DN6D 2ZRKA 4DO2A 3LCUA 1USUA 4B71A 4E32A 2MW2B 2Y77A 4C9BA 1ECPA 4LYYA 1CK4A 5CA0A 3STTA 1L5HB 1F6DA 2X5NA 2ITDC 4UDNA 2J07A 1JAIA 1XTZA 4EJSB 2ID4A 4GBMA 2HF8A 3MHSC 1SCKA 1FYEA 1EI9A 3RBAA 3KELA 3A0BZ 2J8ZA 5CHEA 3AVQA 3ZY3A 4QARA 3CURA 4M1SA 1UJCA 4HHEA 2LZ0A 1M6HA 5KA6A 3A37A 1G8FA 3DPSA 4UC0A 4YIOA 5DLYA 3GEHA 3A4IA 5FWXB 3BXZA 2E4YA 1ZJJA 1KC8H 1RJEA 5C4MA 4IOLA 1O96A 2V6IA 2HVJC 2H9IA 4ZAZA 2H8PC 3D3WB 2ZBRA 2CZCA 2PM8A 4QO8A 2QLNA 4JD5A 2ZSDA 3JQAD 2BEUA 4RF3A 4IHQA 4ZD6A 5BXQC 1HF3A 2CVQA 2EKQA 3VAAA 1H9BA 4J41A 5DN6G 4PS0A 3O1LA 4AKIA 1DQZA 1J22A 1Y5MA 1KETA 2QW8A 3WLSA 1F6WA 3FXAA 4TYPA 3L0PA 3EH1A 4K46A 3AEZA 4IGEA 4FFLA 3MMZA 5CM2Z 3SXPA 1U02A 4HNHA 3CLTC 5EZQA 1PX2A 2NTEA 4OHMA 5BVHB 4N23A 3JAMM 3OX4A 5TQ0B 2ZIFA 4LOHA 4HQOA 1NAIA 1NBIA 4YXWD 5J4LA 2VXOA 4E4EA 4BTLA 4NH4A 2PWBA 3C8ZA 2BFCA 5K0ZA 3INTA 2ST1A 2C82A 3CRW1 4MUKA 3H1TA 2LWIA 1FRFS 3UWDA 3VYTB 3MD0A 4OBWA 2VDMB 3MGKA 1O89A 4A73A 4L8JA 2R60A 5HMLA 5TR9A 3C3PA 2GBLC 1JBKA 4D9BA 1QF6A 4CV1A 3HB3B 1J0BA 4MWZA 2FDCA 4JIGA 1WV0A 1N1GA 2I1QA 1V8ZA 5DBHX 5C0OE 4K6MA 5FBVB 4OKIA 1V2GA 3ESXA 3NAZA 2F8LA 1WN7A 3GR6A 4M87A 2BMAA 3N2YA 1XKQA 4C2BA 1G5IA 1WHTB 3QX7A 1SEVA 1RWMA 1M5IA 1UDBA 2PR7A 4OQMA 1U2SA 1R5NA 3OEED 1V55C 2CHQA 4HGYA 4QBHA 1BH6A 1TQ8A 2GPWA 5K0JA 1ZC4A 4YXWG 4CL0A 3O03A 4UTRA 4L9AA 2NLOA 3A04A 2QLLA 3D36A 4EFDA 3L5KA 4JI8O 2O7RA 2YV1A 2FFQA 4NBRA 3BYZA 3V55A 2P2GA 4P4SA 3U10A 3E8XA 4X1YB 4TTVA 1Q22A 3W6PA 3ZE1B 1XLWA 4NJOA 5FI1B 5KTMA 4C1BA 1VOTA 2IWHA 1QC5A 2CLCX 4BNZA 1O8BA 3CLRD 2LW1A 4MI1A 2YVUA 3EFOB 4PLZA 3ZJ4A 1U2GC 4NCAA 1Q14A 4UB8Z 4GM0A 4AO8A 4B2YA 3F74A 3CVJA 1H05A 1ECLA 4K9SA 2DQKA 1QP7A 4WUTA 5E4FA 1N8TA 2QTRA 2D6FA 4ZYZA 4PD4F 2CEKA 5E6UB 4X66O 1UBLS 4MGZR 4NJEB 3CPHA 3C9UA 2WYWA 3OEEG 1RAHA 1U2EA 1OYYA 3VPFA 4Q3KA 5AK0A 2FMHA 3HJTA 1SNYA 2V9ZA 3CEPB 4J6FA 1TO1E 1WIWA 2NUAB 3OOYA 2Q99A 4B3HA 3K5WA 1E6CA 3OCWA 3G0DA 1Z4KA 2D4HA 3I2HA 4D8UA 4F4CA 5KDDA 2XE6A 3EXEB 3X1ZA 4B3RO 2M6YA 3TZQA 1K5GA 4R6WA 1D09A 2W0MA 1K8YB 1XKTA 1DJOA 2I54A 4BCCA 4I9UA 5CEJA 3ESAA 2QDKA 2R3SA 2X4GA 2BBOA 3BHNA 3CBGA 3N8DA 3AVOA 4FOSA 4OEHA 2XHBA 2CMKA 3L6UA 4MVCA 2JIZA 1O6GA 1VQVA 3GROA 121PA 3BIOA 4FW9A 1W36B 4B08A 1Y74A 3IE1A 5J58A 1LPSA 4AYWA 1PW7A 1D0IA 4C4ZA 1K27A 1X1QA 4FR0A 2K2QB 1VLZA 4G88A 5K8LA 2D0OB 5A7GA 1TCBA 3LE8A 2WWWA 1X13A 3FJ1A 4BS9A 1VPDA 4FHEA 4C29A 2R9VA 4HWPA 5JH7B 3J81k 3ZGOA 3DS8A 5TC4A 1RU3A 3AOEA 2RH5A 1JFLA 5CLJA 4HOYA 5CG2A 2RHTA 3HN2A 4J7XA 3MT7A 1W25A 3DONA 1UDCA 3GJ7A 2YRFA 1EBFA 4PX3A 2ZM6O 3ESDA 5EWLB 1V9CA 1TZKA 5L3BA 2WNIA 1XK7A 2CCGA 2LUOA 2XYPA 3MG9A 4NENA 4MCAA 3O26A 3ONDA 1KQOA 5D87A 2PKEA 5C8VA 2QRVB 2C2AA 1ZYUA 4Y2PA 1RYYA 2XXAA 3LPMA 2GHRA 2YIMA 2V6GA 4P32A 1WUIS 2H2AA 1VF7A 3AK1A 4NXMO 2HQOA 2ATIA 3FVRA 1JG4A 3CJTA 5FYDA 3TOSA 3MJDA 4KQHA 3BQNB 2C00A 2DKOA 1RXYA 2GF0A 2M7WA 5TGTA 4JBIA 1FU4A 3R76A 4Z49A 2DT5A 1DDOA 4PLTA 2VTBA 1GD1O 3BWVA 3G2PA 3J80A 3NT4A 3OCVA 3LT1A 1R00A 4QLBA 4WZZA 4MKFA 4HX2A 1YJQA 2O2JA 2C54A 3F5TA 4DW1A 1Z18A 3HVIA 3AZQA 3HCEA 1DIBA 3VPSA 4PA6A 2ZZKA 4EQ6B 2CK3D 1VL6A 2CJFA 1Y6ZA 3UJDA 3MOGA 4HNTA 1DOAA 3O92A 5M34A 4CTKA 1W35A 2WLTA 3T3PB 1KYWA 4BLSA 1AKTA 2W2PA 3T1NA 2LBPA 4DYLA 1KFKB 4NFHA 3NJ8A 1ISMA 5K4AA 3B9QA 3CC7V 1ODFA 1Z07A 3VTKA 1JDJA 1H4TA 3D1LA 4OHBA 3OPXA 2XUZA 3ZX4A 2QIOA 2IX3A 3C16C 1QIDA 2QVBA 2YV5A 2IS6A 1JFFB 2GWRA 3CPQA 2JIPA 3PPIA 3I2GA 2F3PA 2DFNA 4LI3X 2XBLA 4K3UA 2KX7A 1VI6A 3CVXA 3BXGA 1U1FA 4H4DA 4JP1A 1BX0A 1V37A 4MRRA 4MV9A 5ALLA 3AVVA 1AB5A 3EMBA 4MITA 1J8DA 3R75A 3SXJA 1GL6A 1O97D 3LLVA 4FXOA 1RPOA 2R6ZA 4EUHA 4K2HA 3HC7A 2CHEA 5KNDH 1BWQA 4FEEA 3W4KA 1VGVA 1SC5B 2CK3G 2C0QA 3A8TA 1T4DA 3D4PA 3UF0A 4UCOA 4BFSA 1ULUA 4Y1EA 3VR4D 5MFPA 4F4HA 5HNKA 1N6LA 3OJFA 4RM2A 1R6XA 1YKGA 2NZYA 4MQBA 3QFFA 3OJ0A 1MEOA 4BLPA 4WUVA 5T67A 4OGFA 1RIFA 1A4UA 3H19A 1U28C 1RRCA 3LWVC 5BSWA 4RTJA 2WIAA 5L8VA 4D8VA 1VYTA 5AYVA 4B6PA 3IC9A 1YTUA 1IUKA 4X00A 3GRPA 4LXUA 2H11A 3RKRA 4HEA6 4Q01A 1MZPA 2WE7A 3IBYA 4AROA 4IOKA 1BGWA 2WA3A 5JQWA 2OHWA 1XEFA 4BASA 5DOZA 2LKDA 1FPOA 1RJ9A 1U0TA 3W3AA 1OF1A 3TRKA 3EIOA 4IFIA 4GC9A 2NO1A 2XB9A 5T6MA 4OHKA 4GQIA 1O9HA 1Z4OA 1CJVC 5HCNA 4XWKA 1YR9A 1XQWA 4YMIA 2VLIA 2QL5A 5EHNA 1X42A 4ZKEA 4FEYA 1KK2A 5DBOA 2BSQA 4PHHA 3ZHZA 1V5GA 4RFSB 3QHAA 3F4LA 1TAEA 4OK3A 1U43A 3I55F 3GLGA 3OPMA 4CDMA 3W7VA 2FZWA 1CV2A 2X0LA 1BCRB 1MAUA 3IV6A 3BBLA 3H1KH 1Z25A 2XZPA 1MTOA 4Z4IA 1XJQA 4GSYA 5H4HA 3QTLA 3JSNA 4UQLA 2QEXF 1ZWKA 4GL4A 5TT1A 3HDYA 3JWIA 2Q41A 4J9ZB 3IEQA 3SY8A 1UI9A 1F5SA 3IB3A 7ADHA 2AOTB 2IH2A 4BT5A 5DE3A 2ONCA 1XQ9A 1F1JA 2OT5A 4RMHA 4DLPA 1WO8A 1PQ4A 1BXGB 4LQCA 3D3IA 2IZ1A 1QQBA 5TIIA 2WJWA 4RXTA 4MVYA 4FI3F 5SZHB 1C9YA 3NIWA 2CL6X 4MYSA 5BQ3A 3AG4C 3LVFO 4DIMA 4FE3A 4HWTA 3R9WA 4YCNA 1A9ZA 1CS0A 4MB0A 2YDEA 1GNQA 4GMFA 4TT8A 4WA7A 4Z0PA 2ZR7A 4DK0A 3WB0A 3I8XA 2VLBA 4G2NA 4YRFA 3BD8A 1W8DA 3ZY4A 3G59A 2WT8A 4UUQA 2P5OA 2Q8QA 3CCQF 2YFQA 2IHKA 3NT5A 3L2OB 3GLHB 3QUBA 3ZHUA 1L1EA 1DNPA 1DS6A 1EZ1A 4JCCA 5B58T 4OAQA 3C6BA 4EUFA 1O0CA 4PYQA 3TW4A 1SN7A 3VOSA 1Q17A 4AZ3B 4MUFA 3AL3A 3F0FA 4RH3A 2XDQA 4GBED 1VXRA 4X3MA 4MW4A 3MN1A 3CGWA 4FYKA 3KKMA 5C31A 2F1MA 3V42A 1OCRC 1DARA 2FPIA 1Q1EA 1ZL2A 5GANK 2WNHA 3R0VA 2P0EA 2JBAA 4NZNA 3FZQA 3J7AU 3PD7A 3H3FA 4U2BA 4JN6B 1AK2A 3M89A 4WCDA 1F06A 4F06A 2G0AA 3H5LA 5KKAA 3QVSA 2UZ1A 3EY4A 2ZINA 2HK9A 3N0XA 2A9KA 4ZXFA 2C2XA 4I9NA 5ECGC 5E0OA 4TV8A 3A0HZ 2CUNA 1NKSA 4N9WA 4OHRA 3KOXA 1XNRB 1D5AA 4D3FA 2DR0A 1JJAA 4NU0A 3OZTA 1MFZA 2DJVA 3QO7A 3T54A 1H47A 3ZDRA 5IG2A 1T8YA 3FWNA 1NE2A 1GQYA 1EN6A 3V80A 5DBIA 4DPLA 2VPQA 3ESCA 3P2JA 3T6KA 1NZJA 5TEWA 3S8MA 3EPRA 4WLEA 4TWZA 5C3UA 4MWOA 5EIEA 4GMKA 4TLCA 2P41A 1DC5A 4KQ2A 1Z8HA 1C0EA 4FFBB 2X5OA 1Z6TA 1V7PC 4TLDA 2Z9CA 3RRFA 4OX9O 4IUBS 1N0UA 3HXPA 3T9DA 1QGYA 5F9FA 1IPHA 4GI5A 1A9XA 5A5FA 4X89A 5KYWB 4YP5A 2G5GX 1KS2A 5IZCA 4ASUG 5GOTA 3EIHA 3SKYA 5LQJA 1XHFA 2EKPA 4WGFA 4FFWA 2C9DA 2I65A 3IBSA 5JT1A 1MEEA 2ANCA 1VLHA 2DEUA 1TKBA 1N33B 5FLYA 2CVFA 3TLEA 3C70A 4ZYVA 2Z2XA 3EZGA 2B5OA 4X62O 4HGPA 4HLCA 1WPQA 3G5LA 4KUHA 3OZ7A 2Z57A 4ZYLA 4BNFA 3HGTA 4ND4A 1Y9DA 2YHIB 4PF1A 3C90A 1GA6A 4HPJB 4E5YA 3A36A 4RVOA 1BT8A 1MJHA 4W5TA 3G8DA 1MC5A 1OX5A 5CP8A 4E0BA 1NLYA 1KMCA 1C3OB 1GPKA 2XCUA 2VF4X 4RVCA 4Y6LA 4LK2A 5LB4A 2EZPA 1DAGA 5I7HA 1VB3A 3JV7A 2G1AA 3BX1A 2CMGA 1BQEA 2UYOA 2XMPA 3LHDA 5LZ9A 1Q1BA 4XQCA 3PDIA 3WX0A 4II7A 2N74A 3U40A 3OZAA 3GVMA 1VC2A 2AI3A 4K9RA 3O4VA 5JYBA 1T1GA 4A6XA 5CA3A 2V7UA 1PTJC 3IEMA 2DCMA 1B0UA 3HI4A 3BERA 3NJRA 3TO5A 3SIXA 2ZROA 3V33A 1AKNA 1A27A 4DFDA 4F96A 4QOFA 4BFWA 4WBNF 1XHOA 4WE3A 3VQVA 4EKGA 2OTCA 1ADJA 4WADA 2D1RA 3ZWQA 2JRCA 2JZNA 1QHGA 3OR6C 3AR3A 1G20E 4GR4A 4YRGA 4M4SA 1TLFA 4P7FA 4R5HA 3NAMA 3DDNA 4ZCQA 3GNSA 1FAFA 2EDCA 2PSHA 2WHRA 2EILC 3IP6A 2AFHA 1V5FA 2WUEA 1W4ZA 1RYHA 1BOOA 3IKTA 1C3LA 5FUQA 1F5NA 2YIBD 4LG1A 3ADPA 5FNVF 3E2IA 3EFFK 3LF2A 4LIPD 4I8XA 4RJTA 4ZQEA 1C1DB 2Q9UA 4ZJUA 3STUA 4TUYB 4FZ0A 4P81A 2N48A 5BURA 5LP1A 4EGQA 1W88B 2GN4A 1OLXB 3VPAA 1P29A 1FFEA 3AV3A 3EISA 4OA5A 3X1YA 3ASUA 4IRUB 1L8OA 4OHZA 4OQFA 3Q3VA 1U8CB 4JVOA 3NBYC 2Y93A 2OZVA 2LDXA 2V6BA 2TSYB 4DBLC 4CODB 1PSDA 1SVOA 3SZ3A 1J2TA 3OG9A 3BJRA 2OV6A 4I4NA 3VVBA 5CLGA 2UV8A 3MA0A 4ZCMA 5AW8A 1N6OA 1W4CA 5FWYA 3CG6A 3N58A 4LVNA 5ALHA 1PR5A 3HXMA 1M8JA 3NS7A 1R6BX 2ZSEA 2QMUA 4S0ZA 2GETA 4NF2A 4AWBA 2VJQA 2JZOA 2WM2A 2HC9A 3MOIA 4B4VA 2HS3A 5JWOA 1JHMA 5A7FA 1SKMA 2F66C 3OT1A 4WKGA 4KQWA 1M5RA 1Z26A 5E1MA 2EBFX 1G291 1R6AA 3I56F 1NSFA 3UPTA 1QIEA 3CLTD 4KO1S 4QSMA 3G9XA 3FDZB 4PV1B 3JCMM 2B1GA 4GKKO 1VL8A 2PMFA 3PEEA 3O93A 3K9GA 5JXWA 1K8ZB 3RU2A 1ORRA 2J3DA 4NH0A 4AWAA 3NM6B 1LBEA 2A84A 3V97A 3IERA 4Q16A 2A0KA 1VFNA 1GZ6A 5KHGA 1JWLA 2ZRCA 1TUEB 2YJ5A 4AKSA 2WAXA 4EMTA 2HA4A 2OK8A 2YQ5A 4TV9F 1U0SY 2P2SA 1REQB 4D45A 4FZJA 3RT7A 4NZPA 3BJZA 3PNOA 4XFDA 4H44B 1GG2A 2WW8A 3AOGA 4QDUA 3DHNA 4M9RA 1UANA 2XB6A 4PZ9A 1K7YA 3HHEA 3QE4A 4DM4A 1PBNA 5DPMA 4PHZA 1GSHA 3O85A 3RC3A 2X0EA 4JKYA 4Z4FA 2WAYA 3WIDA 1E1CB 4FFVA 3LY7A 1T9ZA 3WRYA 1E77A 5NLLA 5CDYA 3TB6A 2EZ8A 3FGOA 3T7RA 2JI8A 4UM7A 4KX3A 4X7PA 4ARZB 2OVBA 1GO2A 5MN5A 3VU1A 2X41A 2IJHA 4HDCA 5HFMA 2ODQA 1QBKC 1P4JA 2LP4Y 4TRJA 1ODLA 3EXHA 3AJRA 1QK4A 3K0TA 1KKDA 2OTLF 3D2BA 5K0TA 1DF4A 3ENKA 4UZEA 4WOKA 5E2IA 1HLGA 2H2DA 1L5RA 3CLRC 2Q5ZA 2FSFA 4N0PA 2HP0A 4UUMA 2ZF8A 3IUBA 4TQGA 2AN3A 2QDXA 1WNTA 2GN2A 5B2FA 4CS4A 3DZ8A 4TPKA 1KI4A 5DX0A 7REQB 3E1SA 3LKVA 1DKRA 1Q81W 1V47A 1R10A 4FJ2A 4C7VA 3ILXA 2QX4A 2X77A 3PEWA 2IEGA 1IWOA 2EIHA 3BDVA 4I2NA 3K92A 3DMPA 4ZOBA 1OZAA 1U0FA 3IRUA 2VG8A 3JTEA 1A96A 4NBUA 4BKOA 4I55A 1ZA2A 3RE3A 1OXSC 3ZJUA 1M83A 4M0KA 3HP4A 1VHJA 2HIAA 2UYNB 1N36B 1D5NA 4BJ5A 4NCJA 5D6OA 2DOKA 3FYDA 4BBAA 2ZYVX 4FU0A 3PN1A 1L4MA 4DMLA 1IPAA 2B8NA 2XMRA 4GGOA 3HXLA 2CHGA 5FI0B 3X2EA 1SUDA 3Q7PA 4GIBA 3MTIA 1YCDA 3EODA 1SOMA 1A72A 4M8SA 2YJNA 4EPXA 1HNNA 3H2GA 5BQ5A 3ET5A 4QPPA 1L6RA 3K6SB 5KTKA 1KVUA 3MDSA 1YH3A 2RFLA 1PV2A 3MWYW 3U4MA 1XKLA 5CIWA 1CF4A 4BR6A 3O38A 5DX1A 5EJIA 4N0QA 1JEQA 1QIIA 1WMFA 1DG1G 3E53A 4GWLA 1R6DA 1PWXA 2B61A 3GAZA 4CZ2A 4FK5C 4OUDA 2NU7A 5FTNA 5ALNA 5M29A 2R1TB 1Z45A 4PC2A 3HBFA 5K01A 3KZCA 3S0WA 3O8DA 4W7IA 3AG2B 1LA2A 5EKSA 3E5MA 3R7WB 2BSKB 1UK7A 1HNZO 4NCHA 3ADKA 2HSEA 2BONA 3VBEA 2PI5A 4ZOQI 1P91A 4BB0A 2FR8C 2C3UA 3PXGA 1Z83A 1WPBA 3MMNA 2JASA 4EG6A 2XMQA 3BH6A 4BZPA 4BO8A 1HRKA 3I6ZA 2DFVA 2PS1A 1QFJA 1ZINA 2EFHB 2UXNA 4IV5A 3RK1A 2OCDA 2WABA 4UD6A 3OESA 3S8YA 3MD9A 3GL9A 2V9CA 4FKZA 1GL3A 4HP8A 1CK2A 1ORTA 4G5YA 3BIXA 5I4IA 1S02A 3PQ2A 4QPDA 2A9HA 5DNYB 1Z2DA 4UE6A 5IBQA 4OYYA 2P9FA 2JPDA 3TSWA 2PTGA 3JVIA 5A3SA 4UUAA 1EUYA 1H4VB 3KCXA 2DWUA 1DELA 2AJLI 3BCCH 4L08A 4AECA 3UJPA 4TWIA 3WIBA 2PKXA 4R5MA 3L18A 4RU1A 1QHXA 3MWKA 1Y67A 2BKXA 9MHTA 1SRQA 2EFCB 3DLBA 1GU7A 1J8FA 1GN9A 2V5AA 1UKBA 3DEKA 1Q6UA 4J6EA 3P20A 1EK5A 4BFLA 4CC5A 1FFCA 4H0NA 5DEIA 2I8AA 2I3ZA 1EG2A 1LVGA 2ZJZA 1V16B 1PDOA 5HKAA 4CMHA 4N9QA 1GM5A 1PU2A 4JA0A 1DKUA 2MINB 3BA9A 1GG8A 4J94A 4U7WA 3OTOB 5B6PA 1E18A 1O57A 3THSA 4DC1A 2X86A 2UUAO 1FC0A 4HDKB 3GY0A 1YL6A 1JI0A 3V32A 3USCS 3G2OA 1Y1TA 1IRIA 2PQ6A 1Q7YH 1YOVB 5EJAA 3K9BA 2D06A 5ICCA 2MIIA 4KGZA 1W5EA 2G36A 5H5NA 4UCFA 3ZD7A 2IYRA 2XA2A 1EAMA 4M86A 3JQFA 5F73A 1GTJ1 3D6FA 4LGMA 5J3JA 2QX6A 4R7CA 4RCYA 4RSMA 3QOWA 3V7UA 2GAOA 2YMPA 3NNDA 5HJ7A 1O97C 3WLOA 4G0QA 5EE9A 1W0KD 2HQSA 3OM0A 2YS8A 4GPIB 3SHVA 1NMEA 3AR9A 4EEQA 3EDYA 1PZHA 1VF6C 1ZSYA 1PEYA 2OK7A 3UQYS 1KNKA 2DWEC 5DECA 1H2HA 1SCQA 3NHRA 5B3KA 2FUEA 1Z5VA 3RVZA 2QIPA 4EJ0A 2FW1A 1W0CA 3GRZA 2EWCA 2YHAA 1F23A 1H22A 4HWRA 3QF4B 1ML3A 4O4LA 1G6KA 3IAYA 3QP9A 2PZSA 2RKBA 4QNHB 2PIAA 1M3SA 4FC7A 5G0SA 2BM0A 1EXVA 4B8YA 2HHCA 3UJCA 1P1JA 2WZDA 4YLEA 1SU7A 6CHYA 1SBTA 1M56C 3EQ8A 3U7GA 3OEHD 3PIRA 3GDOA 1OTXA 4TTJA 2ZE5A 1GTL1 1LC0A 5CA1B 3T8YA 4DTCA 2X7RB 2ECOA 5TY0A 3D43A 1OC4A 5DW3A 2UYHA 4FNAA 1GZ0A 1L1QA 1UJWB 3VNAA 1W0KG 4P4NA 2Q5FA 2C4UA 2CY0A 4MGIR 3W5JA 1Y3FE 4G0MA 2ZTSA 4LBYA 4FWBA 3TR5A 3R3UA 1G41A 4DNPA 2IH5A 1N3IA 5AI8A 3N6XA 5MN4A 2ABWA 2TMKA 4G6ZA 2NP6A 3QWBA 4O2BF 2E48A 4BUCA 3BCRA 2Q8PA 3VYSC 3U0VA 3QMVA 4EO9A 3ZCUA 4II3A 4BHTA 3I8OA 1H5QA 2IUTA 5EUMA 2DXIA 2GA9A 4IUDS 1NTMH 3N4YA 1QCCA 2G7MC 2JFFA 1O94D 4QG7A 2ECFA 1QG4A 3NEYA 4A8PA 2H1RA 5EXEA 3OEHG 1LQUA 1DLBA 1EAYA 1VBFA 4YAJA 3IKJA 1MORA 3PHBE 3QVLA 3PNVA 1WJZA 3FHCB 1E2QA 2LCFA 3OE5A 2PGXA 2XTMA 3HCNA 1X1DA 3RS4A 5BWNA 1I5XA 3A9WA 2NYVA 4NQRA 4UHEA 4R9UC 1RWPA 1PV4A 4HH4A 1XTJA 4B7CA 4CIXA 3IJ5A 4BC1A 5EN4A 4PYJA 4LWSB