3R0PA

Crystal structure of l-psp putative endoribonuclease from uncultured organism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
NKAIIHSDNAPAAIGTYSQAVKVNNTVYLSGQIPLDPVTMQLVEGDFAVQAHQVFKNLRAVCEAAGGGLRDIVKLNVYLTDLANFPIVNEVMGQYFQAPYPARAAIGINQLPRASLIEADGIMVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-PSP putative endoribonuclease
publication title Crystal structure of L-PSP putative endoribonuclease from uncultured organism
rcsb
source organism Uncultured organism
molecule tags Hydrolase
total genus 33
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3r0pA00
3D01A 1QAHA 2CW4A 2CSLA 1FNJA 1X25A 2EWCA 3I3FA 3KJKA 2CHSA 1ONIA 3M4SA 4NWOB 3V4DA 3GTZA 3ZP7A 4ZK7A 1JD1A 3MQWA 1XHOA 2IG8A 5HP7A 2UYKA 3KJJA 3VCZA 3I7TA 3M1XA 3ZP4A 3ZO8A 3L7QA 1QD9A 1COMA 1ODEA 2DYYA 3LMEA 3LYBA 1PF5A 3ZOPA 5HP8A 3K12A 1DBFA 2UYNA 1J7HA 3K0TA 1UFYA 1XRGA 1FNKA 2B33A 2OTMA 2UYJA 1NQ3A 3R0PA 2CWJA 2UYPA 3QUWA 2UYNB 1UI9A 1QU9A 2CHTA 2CVLA
chains in the Genus database with same CATH superfamily
1U43A 3JAWB 3VYSC 4TUYB 4U3JA 4TV9A 4X1KA 1W5EA 3HKEB 2AMTA 1H47A 5EO3A 5MN4A 3B6NA 1U3PA 2KG4A 2YYEA 5G4UC 3MCQA 1IV2A 1YJ9F 3VYTC 4X1YB 1N8RH 5HY4A 1VQNF 4BW0B 2B33A 2L26A 1YI2F 5JQGB 2FC3A 2UYNB 3SIUA 2RHOA 3WJRA 2Z1FA 3CYPB 3LWOC 3WGJA 1YQNA 1H7MA 5IJ9B 1YIJF 2V9YA 3S0WA 1Q81H 5C8YA 5J2UA 1XHOA 4BT5A 3J7AR 3RYCB 3M1XA 2BTUA 3WJPA 4ZHQB 3DDNA 3V7EA 2DYYA 1TVKB 3LYBA 3WXMB 3RYHB 2H8EA 3KE1A 3LWVC 1KC8H 4G4VA 2LBTA 5IYZA 3UT5B 4O2BB 3R0PA 5CA1B 3N4YA 1KNJA 1T0AA 4U39A 3CCMF 4BVRA 2HRUA 3NK7A 3CCJF 2BTOA 4I55B 2CHSA 5ITZA 4C81A 4IIJA 3KJJA 5EIBC 1VQ8F 5GONB 1QD9A 2QTPA 1RLUA 3RYFB 4X20B 4ZOLB 4LCKA 1Q7YH 1YHQF 1UFYA 1XRGA 1X7PA 2OTLF 2HX0A 2ZOVA 3JATA 1QU9A 2KTUA 4DRXB 2Q1YA 1FFXA 1FNJA 5CB4A 4O4LB 3M4SA 1X7OA 2GZLA 3CCQF 3RA6A 5GIOC 3JARA 3CG6A 4YJ2B 1CN7A 3C9UA 3M84A 1ZWZA 2I6DA 3CCUF 3HTNA 2PHNA 3TD5A 3HWUA 3WPXA 2VGNA 3GYQA 5GINC 1NJIH 5IJ0B 4C8GA 1IV3A 2CHTA 3E1YA 3S0YA 4G4ZA 1Z5VA 3D01A 4LNUB 4BT6A 5LOVA 2RB9A 4O4HB 4C8EA 3CB2A 2HQSC 4F6RA 2Z1UA 3KJKA 4G4WA 4IHJB 4NWOB 5LXTA 3KIZA 2N48A 3E22B 3F6MA 4YJ3A 3VI6A 2Z1TA 1Z5WA 5HXUA 5JH7B 5HP7A 2UYKA 4EB6B 4O4IB 1VQ7F 2ZF8A 3P10A 3RYIA 3K14A 5GANK 1XV2A 3F0FA 1VQKF 2P6YA 1VQMF 1VQ6F 1U40A 3N4ZA 3WGNA 1W41A 1W59A 2HRYA 1NQ3A 2GLZA 1Q82H 3G71F 4BT4A 5KMGA 1QAHA 1KNKA 5LP6B 5CA0B 3V4DA 3JAMM 1W3EX 5FNVB 5HY1A 3LWQC 1GZ0A 1IPAA 3FPIA 3JAKA 3CXCF 3FBAA 3C9SA 2RHHA 3OONA 3WGLA 3CC7F 5HWEA 1PF5A 4G4YA 5HP8A 3HKDA 1J7HA 2HS4A 5KX5A 1T0KB 3JASB 3HKBB 3J81M 3CCLF 3HKCB 3JAWA 1TUBB 3N2GB 2QEXF 4TUYA 3F0EA 3D54A 2KGWA 4ZI7B 3CPWF 2R751 3HKEA 1X25A 3C8LA 5JCOA 3P4EA 5MN6A 2RHJA 1SDSA 3G4SF 4FFBB 2OZBA 1IV4A 3VIUA 3L7QA 4X1YA 3CC4F 4TV8B 4O2AB 2VAMA 5JQGA 1VH8A 4BT7A 2UYNA 1GO0A 3FD6A 1VQOF 1QVFF 5LA6B 4BY9D 1GO1A 2ALEA 2HS0A 1JFFB 3T80A 1Q8RA 2I6RA 2KTVA 1CLIA 3F0DA 2HVYD 4BT2A 3CYQA 4O4JB 4X3MA 4C82A 5BMVB 5IJ9A 2Q1XA 5J2TB 3RYCA 1RLGA 3VTIC 2VAPA 4ZHQA 1NMUB 3CMAF 3S02A 2PMPA 1CK2A 1TVKA 2IG8A 3MQWA 3U0OA 3RYHA 3C9RA 4EI9A 4C8IA 4X1IB 4C4WC 3UT5A 4O2BA 2GVIA 5CA1A 4EI7A 5JVDB 4O4JA 3I56F 5LYJB 4E6EA 4WBNB 4TZZA 1JY8A 4PWTA 3C9TA 4I55A 5JCOC 3OBWA 1VQPF 3Q8HA 1RA4A 4ERHA 2ZVZA 1RQ7A 1W581 1W40A 5GONA 3ZP7A 1JD1A 4B45A 3NVIB 5FJ4C 1SA0B 3NVKE 4RHAA 3RYFA 5HY2A 3CC2F 4X20A 4B46A 3MBMA 4ZOLA 5EZYB 4M8IA 3K12A 2VXYA 3JALB 4I50B 3V7QA 4BVQA 3CCRF 1DT9A 2CWJA 4DRXA 2HS3A 3J80M 1M90H 5EYPB 2BTQB 3FD5A 2QA4F 3FFMA 4O4LA 3F0GA 2CW4A 4HNAB 5DCVA 5GIPC 2LBWA 3PLAC 4BVTA 1K73H 3VMFB 4YJ2A 3KHNA 4G88A 2AIFA 3IEQA 1COMA 3GHZA 3IEWA 1W55A 1JN1A 2WALA 5IJ0A 3CCVF 3QUWA 3HJWC 2HP0B 3N2KB 4LNUA 2ZVYA 4I4TB 2Z1EA 4O4HA 3WJQA 5B8FA 4IHJA 3I3FA 3E22A 3JVHA 5JH7A 1ONIA 2NMUA 4EB6A 3SIVA 3IMPA 4O4IA 2K1SA 4U3JB 4TV9B 4X1KB 3MDOA 5EB0A 5EIBD 1M1KH 1VQ9F 5AVMA 3VOBA 3ERNA 3IKEA 2VGMA 3TD3A 4KWEA 1VQ5F 3LMEA 1YGYA 1W5FA 2OTMA 3P0ZA 2RHLA 1W57A 3K2XA 3PAFA 3TD4A 1UI9A 2ZAUA 3VOAA 5LP6A 3OW2F 3BYQA 2G9IA 5CA0A 5IT9M 3ON1A 2UZHA 2IAFA 4G4XA 5FNVA 1VQ4F 2W8BC 3NK6A 1W5BA 4R40B 5C8YB 5J2UB 5EB1B 4X3LA 5HXZA 3JASA 3HKBA 1DBFA 3HKCA 3WPWA 1TUBA 3N2GA 1W2BF 4ZI7A 2UYPA 5G4VC 5IYZB 1QVGF 2FGYA 5HY0A 3LWPC 3O85A 3OBYA 4FFBA 2BO1A 5EAZA 4BVSA 1JJ2F 2IQQA 4TV8A 5ITZB 4B62A 4O2AA 1KQSF 4IIJB 2HP3A 4ZHYB 4XCQA 1X52A 3RE3A 3RA5A 5MN5A 2JNBA 5LA6A 3EORA 1JFFA 1IV1A 2ZODA 3K0TA 2OHWA 1RQ2A 2UYJA 2LCAA 5LP6C 1VK3A 2F9ZC 3ESJA 4DXDA 5BMVA 1Q86H 3S03A 5J2TA 1YITF 1K9MH 3JATB 2YXZA 3MCAB 1GX1A 2EWCA 2LBXA 2VAWA 1FFXB 3DC2A 1VQVA 5CB4B 4X1IA 2CZWA 3I7TA 3HAXD 3CMEF 1SZQA 1ODEA 1VQLF 3JARB 5JVDA 2DT4A 4RQOA 5LYJA 4WBNA 1K8AH 3S0HA 4ZHVA 1FNKA 2AIZP 1S72F 2Z01A 3V3TA 3VYUC 5A2QM 3LDTA 2H6LA 2CSLA 1OAPA 3D00A 1SA0A 3CD6F 5LOVB 5EWRA 3GTZA 4ZK7A 1YJWF 4F6RB 3JCMM 5EZYA 3VCZA 4ZHWA 5LXTB 4YJ3B 3IKFA 3ZO8A 3JALA 2R6R1 3ZOPA 4I50A 2H8CA 3CCEF 1YJNF 1R1MA 3WGKA 3RYIB 1W42A 5EYPA 4NQ3A 3LWRC 1FSZA 3QHDA 3I55F 1VHAA 2OTJF 5FLXM 1H48A 4HNAA 2CVLA 3CCSF 2MQEA 1W5AA 2QI2A 3WGMA 3E20B 5KMGB 3VO8A 1XBIA 1OFUA 3IR9A 3G6EF 1KD1H 3ZP4A 1E7KA 4EI8A 4B5CA 3JAKB 4BT3A 1PXWA 2HP0A 3N2KA 4NUTA 3LFOA 4I4TA 3CPQA 1U3LA 3HKDB 3QTYA 3ELCA 3NMUC 5KX5B 5GAPK 3S06A 3AGKA
chains in the Genus database with same CATH topology
3D01A 1QAHA 2CW4A 2CSLA 1FNJA 1X25A 2EWCA 3I3FA 3KJKA 2CHSA 1ONIA 3M4SA 4NWOB 3V4DA 3GTZA 3ZP7A 4ZK7A 1JD1A 3MQWA 1XHOA 2IG8A 5HP7A 2UYKA 3KJJA 3VCZA 3I7TA 3M1XA 3ZP4A 3ZO8A 3L7QA 1QD9A 1COMA 1ODEA 2DYYA 3LMEA 3LYBA 1PF5A 3ZOPA 5HP8A 3K12A 1DBFA 2UYNA 1J7HA 3K0TA 1UFYA 1XRGA 1FNKA 2B33A 2OTMA 2UYJA 1NQ3A 3R0PA 2CWJA 2UYPA 3QUWA 2UYNB 1UI9A 1QU9A 2CHTA 2CVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D01 A;  1QAH A;  2CW4 A;  2CSL A;  1FNJ A;  1X25 A;  2EWC A;  3I3F A;  3KJK A;  2CHS A;  1ONI A;  3M4S A;  4NWO B;  3V4D A;  3GTZ A;  3ZP7 A;  4ZK7 A;  1JD1 A;  3MQW A;  1XHO A;  2IG8 A;  5HP7 A;  2UYK A;  3KJJ A;  3VCZ A;  3I7T A;  3M1X A;  3ZP4 A;  3ZO8 A;  3L7Q A;  1QD9 A;  1COM A;  1ODE A;  2DYY A;  3LME A;  3LYB A;  1PF5 A;  3ZOP A;  5HP8 A;  3K12 A;  1DBF A;  2UYN A;  1J7H A;  3K0T A;  1UFY A;  1XRG A;  1FNK A;  2B33 A;  2OTM A;  2UYJ A;  1NQ3 A;  3R0P A;  2CWJ A;  2UYP A;  3QUW A;  2UYN B;  1UI9 A;  1QU9 A;  2CHT A;  2CVL A; 
#chains in the Genus database with same CATH topology
 1U43 A;  3JAW B;  3VYS C;  4TUY B;  4U3J A;  4TV9 A;  4X1K A;  1W5E A;  3HKE B;  2AMT A;  1H47 A;  5EO3 A;  5MN4 A;  3B6N A;  1U3P A;  2KG4 A;  2YYE A;  5G4U C;  3MCQ A;  1IV2 A;  1YJ9 F;  3VYT C;  4X1Y B;  1N8R H;  5HY4 A;  1VQN F;  4BW0 B;  2B33 A;  2L26 A;  1YI2 F;  5JQG B;  2FC3 A;  2UYN B;  3SIU A;  2RHO A;  3WJR A;  2Z1F A;  3CYP B;  3LWO C;  3WGJ A;  1YQN A;  1H7M A;  5IJ9 B;  1YIJ F;  2V9Y A;  3S0W A;  1Q81 H;  5C8Y A;  5J2U A;  1XHO A;  4BT5 A;  3J7A R;  3RYC B;  3M1X A;  2BTU A;  3WJP A;  4ZHQ B;  3DDN A;  3V7E A;  2DYY A;  1TVK B;  3LYB A;  3WXM B;  3RYH B;  2H8E A;  3KE1 A;  3LWV C;  1KC8 H;  4G4V A;  2LBT A;  5IYZ A;  3UT5 B;  4O2B B;  3R0P A;  5CA1 B;  3N4Y A;  1KNJ A;  1T0A A;  4U39 A;  3CCM F;  4BVR A;  2HRU A;  3NK7 A;  3CCJ F;  2BTO A;  4I55 B;  2CHS A;  5ITZ A;  4C81 A;  4IIJ A;  3KJJ A;  5EIB C;  1VQ8 F;  5GON B;  1QD9 A;  2QTP A;  1RLU A;  3RYF B;  4X20 B;  4ZOL B;  4LCK A;  1Q7Y H;  1YHQ F;  1UFY A;  1XRG A;  1X7P A;  2OTL F;  2HX0 A;  2ZOV A;  3JAT A;  1QU9 A;  2KTU A;  4DRX B;  2Q1Y A;  1FFX A;  1FNJ A;  5CB4 A;  4O4L B;  3M4S A;  1X7O A;  2GZL A;  3CCQ F;  3RA6 A;  5GIO C;  3JAR A;  3CG6 A;  4YJ2 B;  1CN7 A;  3C9U A;  3M84 A;  1ZWZ A;  2I6D A;  3CCU F;  3HTN A;  2PHN A;  3TD5 A;  3HWU A;  3WPX A;  2VGN A;  3GYQ A;  5GIN C;  1NJI H;  5IJ0 B;  4C8G A;  1IV3 A;  2CHT A;  3E1Y A;  3S0Y A;  4G4Z A;  1Z5V A;  3D01 A;  4LNU B;  4BT6 A;  5LOV A;  2RB9 A;  4O4H B;  4C8E A;  3CB2 A;  2HQS C;  4F6R A;  2Z1U A;  3KJK A;  4G4W A;  4IHJ B;  4NWO B;  5LXT A;  3KIZ A;  2N48 A;  3E22 B;  3F6M A;  4YJ3 A;  3VI6 A;  2Z1T A;  1Z5W A;  5HXU A;  5JH7 B;  5HP7 A;  2UYK A;  4EB6 B;  4O4I B;  1VQ7 F;  2ZF8 A;  3P10 A;  3RYI A;  3K14 A;  5GAN K;  1XV2 A;  3F0F A;  1VQK F;  2P6Y A;  1VQM F;  1VQ6 F;  1U40 A;  3N4Z A;  3WGN A;  1W41 A;  1W59 A;  2HRY A;  1NQ3 A;  2GLZ A;  1Q82 H;  3G71 F;  4BT4 A;  5KMG A;  1QAH A;  1KNK A;  5LP6 B;  5CA0 B;  3V4D A;  3JAM M;  1W3E X;  5FNV B;  5HY1 A;  3LWQ C;  1GZ0 A;  1IPA A;  3FPI A;  3JAK A;  3CXC F;  3FBA A;  3C9S A;  2RHH A;  3OON A;  3WGL A;  3CC7 F;  5HWE A;  1PF5 A;  4G4Y A;  5HP8 A;  3HKD A;  1J7H A;  2HS4 A;  5KX5 A;  1T0K B;  3JAS B;  3HKB B;  3J81 M;  3CCL F;  3HKC B;  3JAW A;  1TUB B;  3N2G B;  2QEX F;  4TUY A;  3F0E A;  3D54 A;  2KGW A;  4ZI7 B;  3CPW F;  2R75 1;  3HKE A;  1X25 A;  3C8L A;  5JCO A;  3P4E A;  5MN6 A;  2RHJ A;  1SDS A;  3G4S F;  4FFB B;  2OZB A;  1IV4 A;  3VIU A;  3L7Q A;  4X1Y A;  3CC4 F;  4TV8 B;  4O2A B;  2VAM A;  5JQG A;  1VH8 A;  4BT7 A;  2UYN A;  1GO0 A;  3FD6 A;  1VQO F;  1QVF F;  5LA6 B;  4BY9 D;  1GO1 A;  2ALE A;  2HS0 A;  1JFF B;  3T80 A;  1Q8R A;  2I6R A;  2KTV A;  1CLI A;  3F0D A;  2HVY D;  4BT2 A;  3CYQ A;  4O4J B;  4X3M A;  4C82 A;  5BMV B;  5IJ9 A;  2Q1X A;  5J2T B;  3RYC A;  1RLG A;  3VTI C;  2VAP A;  4ZHQ A;  1NMU B;  3CMA F;  3S02 A;  2PMP A;  1CK2 A;  1TVK A;  2IG8 A;  3MQW A;  3U0O A;  3RYH A;  3C9R A;  4EI9 A;  4C8I A;  4X1I B;  4C4W C;  3UT5 A;  4O2B A;  2GVI A;  5CA1 A;  4EI7 A;  5JVD B;  4O4J A;  3I56 F;  5LYJ B;  4E6E A;  4WBN B;  4TZZ A;  1JY8 A;  4PWT A;  3C9T A;  4I55 A;  5JCO C;  3OBW A;  1VQP F;  3Q8H A;  1RA4 A;  4ERH A;  2ZVZ A;  1RQ7 A;  1W58 1;  1W40 A;  5GON A;  3ZP7 A;  1JD1 A;  4B45 A;  3NVI B;  5FJ4 C;  1SA0 B;  3NVK E;  4RHA A;  3RYF A;  5HY2 A;  3CC2 F;  4X20 A;  4B46 A;  3MBM A;  4ZOL A;  5EZY B;  4M8I A;  3K12 A;  2VXY A;  3JAL B;  4I50 B;  3V7Q A;  4BVQ A;  3CCR F;  1DT9 A;  2CWJ A;  4DRX A;  2HS3 A;  3J80 M;  1M90 H;  5EYP B;  2BTQ B;  3FD5 A;  2QA4 F;  3FFM A;  4O4L A;  3F0G A;  2CW4 A;  4HNA B;  5DCV A;  5GIP C;  2LBW A;  3PLA C;  4BVT A;  1K73 H;  3VMF B;  4YJ2 A;  3KHN A;  4G88 A;  2AIF A;  3IEQ A;  1COM A;  3GHZ A;  3IEW A;  1W55 A;  1JN1 A;  2WAL A;  5IJ0 A;  3CCV F;  3QUW A;  3HJW C;  2HP0 B;  3N2K B;  4LNU A;  2ZVY A;  4I4T B;  2Z1E A;  4O4H A;  3WJQ A;  5B8F A;  4IHJ A;  3I3F A;  3E22 A;  3JVH A;  5JH7 A;  1ONI A;  2NMU A;  4EB6 A;  3SIV A;  3IMP A;  4O4I A;  2K1S A;  4U3J B;  4TV9 B;  4X1K B;  3MDO A;  5EB0 A;  5EIB D;  1M1K H;  1VQ9 F;  5AVM A;  3VOB A;  3ERN A;  3IKE A;  2VGM A;  3TD3 A;  4KWE A;  1VQ5 F;  3LME A;  1YGY A;  1W5F A;  2OTM A;  3P0Z A;  2RHL A;  1W57 A;  3K2X A;  3PAF A;  3TD4 A;  1UI9 A;  2ZAU A;  3VOA A;  5LP6 A;  3OW2 F;  3BYQ A;  2G9I A;  5CA0 A;  5IT9 M;  3ON1 A;  2UZH A;  2IAF A;  4G4X A;  5FNV A;  1VQ4 F;  2W8B C;  3NK6 A;  1W5B A;  4R40 B;  5C8Y B;  5J2U B;  5EB1 B;  4X3L A;  5HXZ A;  3JAS A;  3HKB A;  1DBF A;  3HKC A;  3WPW A;  1TUB A;  3N2G A;  1W2B F;  4ZI7 A;  2UYP A;  5G4V C;  5IYZ B;  1QVG F;  2FGY A;  5HY0 A;  3LWP C;  3O85 A;  3OBY A;  4FFB A;  2BO1 A;  5EAZ A;  4BVS A;  1JJ2 F;  2IQQ A;  4TV8 A;  5ITZ B;  4B62 A;  4O2A A;  1KQS F;  4IIJ B;  2HP3 A;  4ZHY B;  4XCQ A;  1X52 A;  3RE3 A;  3RA5 A;  5MN5 A;  2JNB A;  5LA6 A;  3EOR A;  1JFF A;  1IV1 A;  2ZOD A;  3K0T A;  2OHW A;  1RQ2 A;  2UYJ A;  2LCA A;  5LP6 C;  1VK3 A;  2F9Z C;  3ESJ A;  4DXD A;  5BMV A;  1Q86 H;  3S03 A;  5J2T A;  1YIT F;  1K9M H;  3JAT B;  2YXZ A;  3MCA B;  1GX1 A;  2EWC A;  2LBX A;  2VAW A;  1FFX B;  3DC2 A;  1VQV A;  5CB4 B;  4X1I A;  2CZW A;  3I7T A;  3HAX D;  3CME F;  1SZQ A;  1ODE A;  1VQL F;  3JAR B;  5JVD A;  2DT4 A;  4RQO A;  5LYJ A;  4WBN A;  1K8A H;  3S0H A;  4ZHV A;  1FNK A;  2AIZ P;  1S72 F;  2Z01 A;  3V3T A;  3VYU C;  5A2Q M;  3LDT A;  2H6L A;  2CSL A;  1OAP A;  3D00 A;  1SA0 A;  3CD6 F;  5LOV B;  5EWR A;  3GTZ A;  4ZK7 A;  1YJW F;  4F6R B;  3JCM M;  5EZY A;  3VCZ A;  4ZHW A;  5LXT B;  4YJ3 B;  3IKF A;  3ZO8 A;  3JAL A;  2R6R 1;  3ZOP A;  4I50 A;  2H8C A;  3CCE F;  1YJN F;  1R1M A;  3WGK A;  3RYI B;  1W42 A;  5EYP A;  4NQ3 A;  3LWR C;  1FSZ A;  3QHD A;  3I55 F;  1VHA A;  2OTJ F;  5FLX M;  1H48 A;  4HNA A;  2CVL A;  3CCS F;  2MQE A;  1W5A A;  2QI2 A;  3WGM A;  3E20 B;  5KMG B;  3VO8 A;  1XBI A;  1OFU A;  3IR9 A;  3G6E F;  1KD1 H;  3ZP4 A;  1E7K A;  4EI8 A;  4B5C A;  3JAK B;  4BT3 A;  1PXW A;  2HP0 A;  3N2K A;  4NUT A;  3LFO A;  4I4T A;  3CPQ A;  1U3L A;  3HKD B;  3QTY A;  3ELC A;  3NMU C;  5KX5 B;  5GAP K;  3S06 A;  3AGK A; 
#chains in the Genus database with same CATH homology
 3D01 A;  1QAH A;  2CW4 A;  2CSL A;  1FNJ A;  1X25 A;  2EWC A;  3I3F A;  3KJK A;  2CHS A;  1ONI A;  3M4S A;  4NWO B;  3V4D A;  3GTZ A;  3ZP7 A;  4ZK7 A;  1JD1 A;  3MQW A;  1XHO A;  2IG8 A;  5HP7 A;  2UYK A;  3KJJ A;  3VCZ A;  3I7T A;  3M1X A;  3ZP4 A;  3ZO8 A;  3L7Q A;  1QD9 A;  1COM A;  1ODE A;  2DYY A;  3LME A;  3LYB A;  1PF5 A;  3ZOP A;  5HP8 A;  3K12 A;  1DBF A;  2UYN A;  1J7H A;  3K0T A;  1UFY A;  1XRG A;  1FNK A;  2B33 A;  2OTM A;  2UYJ A;  1NQ3 A;  3R0P A;  2CWJ A;  2UYP A;  3QUW A;  2UYN B;  1UI9 A;  1QU9 A;  2CHT A;  2CVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...