3R0PA

Crystal structure of l-psp putative endoribonuclease from uncultured organism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
NKAIIHSDNAPAAIGTYSQAVKVNNTVYLSGQIPLDPVTMQLVEGDFAVQAHQVFKNLRAVCEAAGGGLRDIVKLNVYLTDLANFPIVNEVMGQYFQAPYPARAAIGINQLPRASLIEADGIMVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-PSP putative endoribonuclease
publication title Crystal structure of L-PSP putative endoribonuclease from uncultured organism
rcsb
source organism Uncultured organism
total genus 33
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3r0pA00
3QUWA 3ZOPA 2CVLA 1UI9A 1QU9A 2IG8A 2CSLA 3L7QA 2EWCA 2OTMA 3I7TA 1NQ3A 3D01A 2B33A 2CHSA 3M4SA 1FNJA 1QAHA 2UYNA 2UYNB 5HP8A 5HP7A 2CWJA 1PF5A 2CW4A 2UYKA 3KJJA 2UYPA 3K0TA 1JD1A 3M1XA 3VCZA 1J7HA 3ZO8A 3V4DA 4NWOB 1FNKA 1DBFA 1ONIA 3R0PA 3ZP4A 1UFYA 1COMA 1X25A 3KJKA 1XRGA 3GTZA 1QD9A 1XHOA 3ZP7A 2UYJA 3I3FA 2CHTA 3K12A 3MQWA 3LYBA 4ZK7A 3LMEA 1ODEA 2DYYA
chains in the Genus database with same CATH superfamily
3WJPA 1W59A 5EB1B 3SIVA 1QAHA 1YJWF 5J2TA 3CPWF 5EAZA 2IAFA 3LWRC 5JVDA 2Z1UA 2HQSC 1VQ4F 1JFFB 3PLAC 1FNKA 1DBFA 1VH8A 5CB4B 3TD5A 5G4VC 5IT9M 2GLZA 5GONB 3P0ZA 3QTYA 1M1KH 2ALEA 2RHOA 3FFMA 2HRYA 4ZOLA 2RHJA 4RHAA 5CA1A 1IV3A 5LA6A 2CVLA 3NVIB 3L7QA 2OZBA 1IPAA 3JARA 5HY4A 5IJ9B 2CWJA 1Q7YH 4I55A 5J2UA 2HX0A 2UYPA 3K0TA 3HKBA 4ZHVA 1YJ9F 3MBMA 2VAMA 1X25A 5LOVB 3WGNA 4O4JB 3FD5A 2GVIA 1KD1H 4BT2A 1SA0A 4TV9B 1W41A 2KG4A 5HY1A 4X1KA 2LCAA 3CG6A 3JATB 4G4VA 4LNUB 4EB6B 4C4WC 3ESJA 3LMEA 4ZI7A 5EIBC 2K1SA 3HKDA 5LP6A 2HP0A 3RE3A 1SZQA 3P4EA 2DT4A 3F0DA 3FBAA 2UYNB 5HP7A 2ZVYA 1XBIA 5ITZB 1CK2A 1W55A 3CYQA 3ZP4A 4DRXB 5FLXM 3O85A 4O4HB 5LXTB 3HKEB 1XV2A 3DDNA 1FFXA 3N2GB 3GHZA 4X20B 1RQ2A 3E22A 2DYYA 1QVGF 4O4LB 2VAWA 1TUBA 4B5CA 2HVYD 4BT3A 1VQ7F 2UYKA 3N2KB 5JH7A 3CCEF 1W5FA 5A2QM 3G6EF 1VQ6F 5EYPB 4TUYB 2OHWA 1QD9A 1YITF 5AVMA 2W8BC 4X1IB 4EI8A 4FFBA 1VQ9F 5GINC 2AMTA 3M84A 2G9IA 1YHQF 2PHNA 3JAWB 4O2AB 3TD3A 1CN7A 3VYSC 1Z5WA 5CA0A 4BVQA 3ELCA 2IQQA 5CB4A 3KJKA 5GONA 1JN1A 1VQVA 5KX5B 5EWRA 3OW2F 4BT7A 3I3FA 3C9TA 4IIJB 3HKCB 4IHJB 1S72F 2OTMA 3F0GA 3WGKA 4O4IB 1RA4A 3JAKB 5IJ9A 4TV8A 2RHLA 3DC2A 4M8IA 2Q1YA 1DT9A 1GZ0A 2YYEA 2HP3A 4TZZA 3C9RA 1J7HA 3VTIC 3ERNA 4EI7A 5FJ4C 4NQ3A 3BYQA 5LOVA 3J81M 4O4JA 2ZODA 3G4SF 4O2BB 4U39A 3VMFB 3CC4F 1K73H 4X1YB 3Q8HA 3RYIA 3VIUA 4LNUA 4EB6A 3K12A 3LYBA 3RYFB 4ZK7A 4DXDA 1QU9A 3CXCF 2LBTA 1X52A 2UYNA 5IJ0B 4PWTA 1T0KB 4I4TB 2LBWA 5ITZA 4C81A 2CZWA 1K8AH 3I56F 4C8EA 2H8CA 1VHAA 1YQNA 3F0FA 1NJIH 4O4HA 5LXTA 3HWUA 1Q81H 3HKEA 1H48A 3VI6A 2QA4F 3N2GA 4X20A 5JQGB 4G88A 1KNKA 3IEWA 4O4LA 5BMVB 1GX1A 3I7TA 4LCKA 3WGLA 2B33A 4X3MA 1W2BF 5KMGA 1Q86H 3JALB 3IKFA 3N2KA 1VQMF 3UT5B 3M1XA 1SDSA 2R751 3CCVF 2ZOVA 1GO0A 3LWVC 1COMA 2I6RA 1TVKB 2HS0A 1KQSF 4TUYA 5EB0A 3NVKE 3RYCB 2Z01A 1W5EA 2RB9A 4X1IA 4ZHQB 3ZP7A 4U3JB 3CCSF 3NMUC 3CMAF 5CA1B 5C8YB 3QUWA 1YGYA 3JAWA 4O2AA 3KHNA 3LWOC 5DCVA 3CCRF 3M4SA 1RQ7A 4BW0B 3MCAB 5HXUA 4R40B 3WGJA 5IYZA 3IR9A 3JCMM 3CCUF 4I55B 4F6RA 3S0YA 1H7MA 4BT5A 3D00A 3QHDA 5EIBD 4G4ZA 1M90H 1K9MH 5KX5A 3CMEF 4IIJA 3HKCA 1OFUA 3AGKA 4BY9D 4YJ2B 2BTQB 3JVHA 4O4IA 3JAKA 2YXZA 5FNVB 2KTUA 2OTJF 3VO8A 1CLIA 4YJ3B 3TD4A 2FGYA 5JCOC 5LYJB 4B46A 5GIPC 3V7QA 2H8EA 1YI2F 1U40A 2VAPA 4NWOB 3LWPC 1JFFA 2R6R1 2HS4A 3HTNA 3R0PA 3C8LA 1W3EX 2BO1A 2WALA 4X1YA 1XHOA 4ERHA 3RYFA 3MQWA 1T0AA 2VGNA 4HNAB 2RHHA 3IKEA 3LWQC 3ZOPA 3RYHB 5EZYB 1X7OA 2CHSA 3S06A 3WPXA 5IJ0A 1VQPF 3WGMA 5B8FA 3S02A 1N8RH 3S0HA 1FSZA 2LBXA 3IMPA 1W5AA 2BTUA 3RA6A 3WJQA 3NK6A 2JNBA 2ZAUA 3V3TA 3HAXD 3OBWA 4TV9A 1VQKF 5JQGA 4C8IA 2L26A 3U0OA 3VYUC 1KNJA 2UYJA 3JATA 5JCOA 4G4WA 2QTPA 3C9SA 5BMVA 3CC2F 1UI9A 2FC3A 2IG8A 2EWCA 3IEQA 2Z1FA 3MDOA 3JALA 5CA0B 5LP6C 2AIZP 3WJRA 3UT5A 3P10A 3S03A 4BT6A 2UZHA 3JASB 1YJNF 1PXWA 1ONIA 4WBNB 1Z5VA 1TVKA 5GANK 1U3LA 4DRXA 1XRGA 3RYCA 2I6DA 1YIJF 2NMUA 4BT4A 4I50B 4ZHQA 3E1YA 4U3JA 1IV2A 3MCQA 3CPQA 3VOBA 5C8YA 1ODEA 5MN6A 1VK3A 3WXMB 3D01A 4TV8B 2OTLF 1QVFF 5G4UC 1FNJA 1U3PA 2Z1TA 1JJ2F 1U43A 4EI9A 3OONA 4C8GA 5J2TB 2MQEA 1JD1A 1JY8A 2ZVZA 3VCZA 5JVDB 2QEXF 3HJWC 3SIUA 1W42A 2H6LA 3K14A 3JAMM 3CYPB 5EYPA 3KIZA 5GAPK 2F9ZC 3EORA 3N4ZA 4G4XA 3RYIB 1IV4A 1W581 3RA5A 4BVSA 2QI2A 4ZOLB 4YJ2A 2CW4A 1IV1A 2BTOA 5LA6B 5FNVA 1Q82H 3F6MA 2Q1XA 4YJ3A 3ON1A 5LYJA 3JARB 5HP8A 1OAPA 1PF5A 3KJJA 5J2UB 4BVTA 1W5BA 3HKBB 3ZO8A 3V4DA 2KTVA 3GYQA 1W40A 2P6YA 3FD6A 3GTZA 3E20B 1SA0B 3J80M 1W57A 2CHTA 3CB2A 1ZWZA 2V9YA 4X1KB 4IHJA 2HS3A 4HNAA 1KC8H 1RLGA 2KGWA 1VQ8F 3RYHA 3F0EA 5EZYA 4ZI7B 1X7PA 3HKDB 3VOAA 2HP0B 2N48A 5LP6B 1NQ3A 3S0WA 5KMGB 3CD6F 3G71F 5MN4A 1R1MA 1GO1A 3V7EA 1VQOF 4E6EA 1VQLF 5MN5A 4G4YA 1Q8RA 3OBYA 5HY2A 2VGMA 4ZHYB 1UFYA 4XCQA 2Z1EA 4O2BA 3C9UA 4NUTA 5EO3A 3I55F 2GZLA 4B62A 2HRUA 1FFXB 3J7AR 3K2XA 4C82A 3E22B 3B6NA 1RLUA 3NK7A 2ZF8A 3KE1A 2CSLA 5HXZA 1VQ5F 3CCJF 4BVRA 1TUBB 3CCQF 1NMUB 4RQOA 5IYZB 3LFOA 4B45A 3D54A 4I4TA 4KWEA 4F6RB 5GIOC 1H47A 3JASA 3VYTC 3WPWA 5HWEA 2PMPA 5HY0A 4WBNA 3CCMF 3T80A 5JH7B 3N4YA 4ZHWA 3FPIA 3PAFA 4I50A 2VXYA 3LDTA 3CCLF 3CC7F 4X3LA 1E7KA 1VQNF 2AIFA 4FFBB
chains in the Genus database with same CATH topology
3QUWA 3ZOPA 2CVLA 1UI9A 1QU9A 2IG8A 2CSLA 3L7QA 2EWCA 2OTMA 3I7TA 1NQ3A 3D01A 2B33A 2CHSA 3M4SA 1FNJA 1QAHA 2UYNA 2UYNB 5HP8A 5HP7A 2CWJA 1PF5A 2CW4A 2UYKA 3KJJA 2UYPA 3K0TA 1JD1A 3M1XA 3VCZA 1J7HA 3ZO8A 3V4DA 4NWOB 1FNKA 1DBFA 1ONIA 3R0PA 3ZP4A 1UFYA 1COMA 1X25A 3KJKA 1XRGA 3GTZA 1QD9A 1XHOA 3ZP7A 2UYJA 3I3FA 2CHTA 3K12A 3MQWA 3LYBA 4ZK7A 3LMEA 1ODEA 2DYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUW A;  3ZOP A;  2CVL A;  1UI9 A;  1QU9 A;  2IG8 A;  2CSL A;  3L7Q A;  2EWC A;  2OTM A;  3I7T A;  1NQ3 A;  3D01 A;  2B33 A;  2CHS A;  3M4S A;  1FNJ A;  1QAH A;  2UYN A;  2UYN B;  5HP8 A;  5HP7 A;  2CWJ A;  1PF5 A;  2CW4 A;  2UYK A;  3KJJ A;  2UYP A;  3K0T A;  1JD1 A;  3M1X A;  3VCZ A;  1J7H A;  3ZO8 A;  3V4D A;  4NWO B;  1FNK A;  1DBF A;  1ONI A;  3R0P A;  3ZP4 A;  1UFY A;  1COM A;  1X25 A;  3KJK A;  1XRG A;  3GTZ A;  1QD9 A;  1XHO A;  3ZP7 A;  2UYJ A;  3I3F A;  2CHT A;  3K12 A;  3MQW A;  3LYB A;  4ZK7 A;  3LME A;  1ODE A;  2DYY A; 
#chains in the Genus database with same CATH topology
 3WJP A;  1W59 A;  5EB1 B;  3SIV A;  1QAH A;  1YJW F;  5J2T A;  3CPW F;  5EAZ A;  2IAF A;  3LWR C;  5JVD A;  2Z1U A;  2HQS C;  1VQ4 F;  1JFF B;  3PLA C;  1FNK A;  1DBF A;  1VH8 A;  5CB4 B;  3TD5 A;  5G4V C;  5IT9 M;  2GLZ A;  5GON B;  3P0Z A;  3QTY A;  1M1K H;  2ALE A;  2RHO A;  3FFM A;  2HRY A;  4ZOL A;  2RHJ A;  4RHA A;  5CA1 A;  1IV3 A;  5LA6 A;  2CVL A;  3NVI B;  3L7Q A;  2OZB A;  1IPA A;  3JAR A;  5HY4 A;  5IJ9 B;  2CWJ A;  1Q7Y H;  4I55 A;  5J2U A;  2HX0 A;  2UYP A;  3K0T A;  3HKB A;  4ZHV A;  1YJ9 F;  3MBM A;  2VAM A;  1X25 A;  5LOV B;  3WGN A;  4O4J B;  3FD5 A;  2GVI A;  1KD1 H;  4BT2 A;  1SA0 A;  4TV9 B;  1W41 A;  2KG4 A;  5HY1 A;  4X1K A;  2LCA A;  3CG6 A;  3JAT B;  4G4V A;  4LNU B;  4EB6 B;  4C4W C;  3ESJ A;  3LME A;  4ZI7 A;  5EIB C;  2K1S A;  3HKD A;  5LP6 A;  2HP0 A;  3RE3 A;  1SZQ A;  3P4E A;  2DT4 A;  3F0D A;  3FBA A;  2UYN B;  5HP7 A;  2ZVY A;  1XBI A;  5ITZ B;  1CK2 A;  1W55 A;  3CYQ A;  3ZP4 A;  4DRX B;  5FLX M;  3O85 A;  4O4H B;  5LXT B;  3HKE B;  1XV2 A;  3DDN A;  1FFX A;  3N2G B;  3GHZ A;  4X20 B;  1RQ2 A;  3E22 A;  2DYY A;  1QVG F;  4O4L B;  2VAW A;  1TUB A;  4B5C A;  2HVY D;  4BT3 A;  1VQ7 F;  2UYK A;  3N2K B;  5JH7 A;  3CCE F;  1W5F A;  5A2Q M;  3G6E F;  1VQ6 F;  5EYP B;  4TUY B;  2OHW A;  1QD9 A;  1YIT F;  5AVM A;  2W8B C;  4X1I B;  4EI8 A;  4FFB A;  1VQ9 F;  5GIN C;  2AMT A;  3M84 A;  2G9I A;  1YHQ F;  2PHN A;  3JAW B;  4O2A B;  3TD3 A;  1CN7 A;  3VYS C;  1Z5W A;  5CA0 A;  4BVQ A;  3ELC A;  2IQQ A;  5CB4 A;  3KJK A;  5GON A;  1JN1 A;  1VQV A;  5KX5 B;  5EWR A;  3OW2 F;  4BT7 A;  3I3F A;  3C9T A;  4IIJ B;  3HKC B;  4IHJ B;  1S72 F;  2OTM A;  3F0G A;  3WGK A;  4O4I B;  1RA4 A;  3JAK B;  5IJ9 A;  4TV8 A;  2RHL A;  3DC2 A;  4M8I A;  2Q1Y A;  1DT9 A;  1GZ0 A;  2YYE A;  2HP3 A;  4TZZ A;  3C9R A;  1J7H A;  3VTI C;  3ERN A;  4EI7 A;  5FJ4 C;  4NQ3 A;  3BYQ A;  5LOV A;  3J81 M;  4O4J A;  2ZOD A;  3G4S F;  4O2B B;  4U39 A;  3VMF B;  3CC4 F;  1K73 H;  4X1Y B;  3Q8H A;  3RYI A;  3VIU A;  4LNU A;  4EB6 A;  3K12 A;  3LYB A;  3RYF B;  4ZK7 A;  4DXD A;  1QU9 A;  3CXC F;  2LBT A;  1X52 A;  2UYN A;  5IJ0 B;  4PWT A;  1T0K B;  4I4T B;  2LBW A;  5ITZ A;  4C81 A;  2CZW A;  1K8A H;  3I56 F;  4C8E A;  2H8C A;  1VHA A;  1YQN A;  3F0F A;  1NJI H;  4O4H A;  5LXT A;  3HWU A;  1Q81 H;  3HKE A;  1H48 A;  3VI6 A;  2QA4 F;  3N2G A;  4X20 A;  5JQG B;  4G88 A;  1KNK A;  3IEW A;  4O4L A;  5BMV B;  1GX1 A;  3I7T A;  4LCK A;  3WGL A;  2B33 A;  4X3M A;  1W2B F;  5KMG A;  1Q86 H;  3JAL B;  3IKF A;  3N2K A;  1VQM F;  3UT5 B;  3M1X A;  1SDS A;  2R75 1;  3CCV F;  2ZOV A;  1GO0 A;  3LWV C;  1COM A;  2I6R A;  1TVK B;  2HS0 A;  1KQS F;  4TUY A;  5EB0 A;  3NVK E;  3RYC B;  2Z01 A;  1W5E A;  2RB9 A;  4X1I A;  4ZHQ B;  3ZP7 A;  4U3J B;  3CCS F;  3NMU C;  3CMA F;  5CA1 B;  5C8Y B;  3QUW A;  1YGY A;  3JAW A;  4O2A A;  3KHN A;  3LWO C;  5DCV A;  3CCR F;  3M4S A;  1RQ7 A;  4BW0 B;  3MCA B;  5HXU A;  4R40 B;  3WGJ A;  5IYZ A;  3IR9 A;  3JCM M;  3CCU F;  4I55 B;  4F6R A;  3S0Y A;  1H7M A;  4BT5 A;  3D00 A;  3QHD A;  5EIB D;  4G4Z A;  1M90 H;  1K9M H;  5KX5 A;  3CME F;  4IIJ A;  3HKC A;  1OFU A;  3AGK A;  4BY9 D;  4YJ2 B;  2BTQ B;  3JVH A;  4O4I A;  3JAK A;  2YXZ A;  5FNV B;  2KTU A;  2OTJ F;  3VO8 A;  1CLI A;  4YJ3 B;  3TD4 A;  2FGY A;  5JCO C;  5LYJ B;  4B46 A;  5GIP C;  3V7Q A;  2H8E A;  1YI2 F;  1U40 A;  2VAP A;  4NWO B;  3LWP C;  1JFF A;  2R6R 1;  2HS4 A;  3HTN A;  3R0P A;  3C8L A;  1W3E X;  2BO1 A;  2WAL A;  4X1Y A;  1XHO A;  4ERH A;  3RYF A;  3MQW A;  1T0A A;  2VGN A;  4HNA B;  2RHH A;  3IKE A;  3LWQ C;  3ZOP A;  3RYH B;  5EZY B;  1X7O A;  2CHS A;  3S06 A;  3WPX A;  5IJ0 A;  1VQP F;  3WGM A;  5B8F A;  3S02 A;  1N8R H;  3S0H A;  1FSZ A;  2LBX A;  3IMP A;  1W5A A;  2BTU A;  3RA6 A;  3WJQ A;  3NK6 A;  2JNB A;  2ZAU A;  3V3T A;  3HAX D;  3OBW A;  4TV9 A;  1VQK F;  5JQG A;  4C8I A;  2L26 A;  3U0O A;  3VYU C;  1KNJ A;  2UYJ A;  3JAT A;  5JCO A;  4G4W A;  2QTP A;  3C9S A;  5BMV A;  3CC2 F;  1UI9 A;  2FC3 A;  2IG8 A;  2EWC A;  3IEQ A;  2Z1F A;  3MDO A;  3JAL A;  5CA0 B;  5LP6 C;  2AIZ P;  3WJR A;  3UT5 A;  3P10 A;  3S03 A;  4BT6 A;  2UZH A;  3JAS B;  1YJN F;  1PXW A;  1ONI A;  4WBN B;  1Z5V A;  1TVK A;  5GAN K;  1U3L A;  4DRX A;  1XRG A;  3RYC A;  2I6D A;  1YIJ F;  2NMU A;  4BT4 A;  4I50 B;  4ZHQ A;  3E1Y A;  4U3J A;  1IV2 A;  3MCQ A;  3CPQ A;  3VOB A;  5C8Y A;  1ODE A;  5MN6 A;  1VK3 A;  3WXM B;  3D01 A;  4TV8 B;  2OTL F;  1QVF F;  5G4U C;  1FNJ A;  1U3P A;  2Z1T A;  1JJ2 F;  1U43 A;  4EI9 A;  3OON A;  4C8G A;  5J2T B;  2MQE A;  1JD1 A;  1JY8 A;  2ZVZ A;  3VCZ A;  5JVD B;  2QEX F;  3HJW C;  3SIU A;  1W42 A;  2H6L A;  3K14 A;  3JAM M;  3CYP B;  5EYP A;  3KIZ A;  5GAP K;  2F9Z C;  3EOR A;  3N4Z A;  4G4X A;  3RYI B;  1IV4 A;  1W58 1;  3RA5 A;  4BVS A;  2QI2 A;  4ZOL B;  4YJ2 A;  2CW4 A;  1IV1 A;  2BTO A;  5LA6 B;  5FNV A;  1Q82 H;  3F6M A;  2Q1X A;  4YJ3 A;  3ON1 A;  5LYJ A;  3JAR B;  5HP8 A;  1OAP A;  1PF5 A;  3KJJ A;  5J2U B;  4BVT A;  1W5B A;  3HKB B;  3ZO8 A;  3V4D A;  2KTV A;  3GYQ A;  1W40 A;  2P6Y A;  3FD6 A;  3GTZ A;  3E20 B;  1SA0 B;  3J80 M;  1W57 A;  2CHT A;  3CB2 A;  1ZWZ A;  2V9Y A;  4X1K B;  4IHJ A;  2HS3 A;  4HNA A;  1KC8 H;  1RLG A;  2KGW A;  1VQ8 F;  3RYH A;  3F0E A;  5EZY A;  4ZI7 B;  1X7P A;  3HKD B;  3VOA A;  2HP0 B;  2N48 A;  5LP6 B;  1NQ3 A;  3S0W A;  5KMG B;  3CD6 F;  3G71 F;  5MN4 A;  1R1M A;  1GO1 A;  3V7E A;  1VQO F;  4E6E A;  1VQL F;  5MN5 A;  4G4Y A;  1Q8R A;  3OBY A;  5HY2 A;  2VGM A;  4ZHY B;  1UFY A;  4XCQ A;  2Z1E A;  4O2B A;  3C9U A;  4NUT A;  5EO3 A;  3I55 F;  2GZL A;  4B62 A;  2HRU A;  1FFX B;  3J7A R;  3K2X A;  4C82 A;  3E22 B;  3B6N A;  1RLU A;  3NK7 A;  2ZF8 A;  3KE1 A;  2CSL A;  5HXZ A;  1VQ5 F;  3CCJ F;  4BVR A;  1TUB B;  3CCQ F;  1NMU B;  4RQO A;  5IYZ B;  3LFO A;  4B45 A;  3D54 A;  4I4T A;  4KWE A;  4F6R B;  5GIO C;  1H47 A;  3JAS A;  3VYT C;  3WPW A;  5HWE A;  2PMP A;  5HY0 A;  4WBN A;  3CCM F;  3T80 A;  5JH7 B;  3N4Y A;  4ZHW A;  3FPI A;  3PAF A;  4I50 A;  2VXY A;  3LDT A;  3CCL F;  3CC7 F;  4X3L A;  1E7K A;  1VQN F;  2AIF A;  4FFB B; 
#chains in the Genus database with same CATH homology
 3QUW A;  3ZOP A;  2CVL A;  1UI9 A;  1QU9 A;  2IG8 A;  2CSL A;  3L7Q A;  2EWC A;  2OTM A;  3I7T A;  1NQ3 A;  3D01 A;  2B33 A;  2CHS A;  3M4S A;  1FNJ A;  1QAH A;  2UYN A;  2UYN B;  5HP8 A;  5HP7 A;  2CWJ A;  1PF5 A;  2CW4 A;  2UYK A;  3KJJ A;  2UYP A;  3K0T A;  1JD1 A;  3M1X A;  3VCZ A;  1J7H A;  3ZO8 A;  3V4D A;  4NWO B;  1FNK A;  1DBF A;  1ONI A;  3R0P A;  3ZP4 A;  1UFY A;  1COM A;  1X25 A;  3KJK A;  1XRG A;  3GTZ A;  1QD9 A;  1XHO A;  3ZP7 A;  2UYJ A;  3I3F A;  2CHT A;  3K12 A;  3MQW A;  3LYB A;  4ZK7 A;  3LME A;  1ODE A;  2DYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...