2MQEA

Solution structure of escherichia coli outer membrane protein a c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords OmpA domain protein transmembrane region-containing protein
publication title The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2mqeA00
3S0YA 3OONA 2ZVYA 4PWTA 2LBTA 3WPXA 2K1SA 4G4ZA 4RHAA 2W8BC 3S0WA 1R1MA 2ZF8A 3S03A 2AIZP 4B62A 4G4WA 4G88A 3S0HA 5EB1B 2ZOVA 2ZVZA 4G4XA 4B5CA 4ERHA 3LDTA 3TD4A 3S06A 4ZHWA 3CYPB 3IMPA 2MQEA 3WPWA 3TD3A 3S02A 1OAPA 5EB0A 2N48A 3TD5A 4ZHVA 4G4VA 4ZHYB 4G4YA 2L26A 2KGWA 3CYQA 5EAZA 2LCAA 4R40B 3KHNA 2HQSC
chains in the Genus database with same CATH superfamily
2R751 3ZP4A 4TV8B 4F6RB 3F0DA 3I3FA 3SIUA 4TZZA 2VXYA 1R1MA 1FFXB 3O85A 4TV9A 2CVLA 4B62A 3I55F 3WGJA 1TVKA 2CZWA 4BW0B 3N2KA 3L7QA 5KX5A 1U43A 3Q8HA 3LFOA 4YJ2A 2RHJA 3IMPA 5IYZA 2HS0A 3JVHA 5IT9M 3ZO8A 1XRGA 1IV2A 1Q81H 2HVYD 3FD6A 4ZOLA 1SA0A 3HTNA 3M1XA 2AMTA 3G4SF 3RYHB 1JN1A 1U3LA 1DBFA 5LOVB 3G71F 1M1KH 1RLUA 3IKEA 1W40A 3KJKA 1W59A 2CW4A 2HP0A 1IPAA 2P6YA 4B45A 1KQSF 1ODEA 5EIBD 1RLGA 4BT6A 3QTYA 2BTUA 3CCQF 5IJ9A 3FBAA 1X7OA 3BYQA 1TUBA 5IJ0A 1H47A 3OBYA 1OFUA 2R6R1 5LYJA 5BMVA 2GLZA 2I6RA 4O4JB 1OAPA 1CN7A 3K14A 3IR9A 3U0OA 5CA1B 1VQ4F 5HP8A 1N8RH 1QAHA 3GYQA 4BVTA 4BVQA 4ZI7B 5KMGA 3JALB 2HS3A 2OZBA 1YQNA 2VAPA 1FSZA 4X1KA 2VGNA 3VIUA 3CC2F 5HY0A 2H8CA 2CSLA 4NWOB 3VCZA 1T0AA 5MN6A 2H6LA 5JCOA 1IV1A 5JQGA 5CB4B 2UYNB 1X7PA 1JD1A 1VQVA 2HRUA 5FNVB 3LWQC 3DDNA 1COMA 2HRYA 3I56F 4HNAB 2IG8A 2VGMA 2HQSC 1Z5VA 2KTVA 1YGYA 1RQ2A 5GIPC 1YJNF 2ZF8A 3CCLF 3LYBA 2Q1YA 3HKEA 3PAFA 1T0KB 1J7HA 2JNBA 3V3TA 4O4HA 3V7EA 2OTJF 2MQEA 4BVSA 3WJRA 5LP6C 2EWCA 4M8IA 3TD5A 2Z1EA 4DRXB 5HWEA 1YI2F 4O2AA 4FFBB 5LA6B 5JH7A 1VQKF 3P10A 3KHNA 1GZ0A 1W3EX 3M84A 4IHJA 3LWVC 3RYCA 1CK2A 5DCVA 4C4WC 4LNUB 3G6EF 3LDTA 3TD4A 3ELCA 5GONA 4ZHQB 2KG4A 1W5AA 4ZHWA 5J2TB 2PMPA 5EZYA 1W2BF 1W41A 4EI8A 2IQQA 3VI6A 4TUYA 3IKFA 4ZHYB 4ZK7A 3ESJA 3IEWA 4EB6A 1K73H 1NMUB 4U3JB 1XBIA 3UT5B 5G4VC 2OTMA 3VYTC 4TV8A 4F6RA 2BTQB 1IV4A 3CYPB 3NVIB 3KJJA 3CG6A 3E20B 3P0ZA 3FFMA 3N4ZA 2DT4A 3ZOPA 4I55B 4KWEA 2QI2A 3V7QA 4C8EA 3C9RA 3V4DA 3QHDA 4TV9B 3CCEF 5GINC 1YITF 2UYPA 1Q7YH 1VH8A 5HXZA 5KX5B 3EORA 1E7KA 3KE1A 3WJQA 1ONIA 4YJ2B 4BT4A 3LWOC 3RYHA 2RB9A 5LOVA 5HXUA 5EB1B 1CLIA 3F0GA 4ZOLB 5HY4A 3RA6A 1VQLF 1SA0B 4X20B 3HKCB 3HKBA 4U39A 5ITZA 4O2BB 5JVDA 5GAPK 5LXTB 3N2GA 4X1IB 1YHQF 1YJ9F 1XHOA 1KD1H 3K0TA 3N4YA 3WXMB 1YJWF 5EAZA 3J80M 1VQ8F 2RHOA 3QUWA 3RYIA 1RQ7A 3J7AR 3HAXD 3VYUC 3D00A 1TUBB 5IJ0B 1W5FA 1W55A 1W42A 1W57A 2W8BC 2Z1FA 5BMVB 1S72F 3CXCF 4ZI7A 4E6EA 4B46A 4X3MA 3JALA 4O4IA 3CMAF 1JJ2F 2DYYA 2LBXA 4EI7A 1VHAA 5C8YA 2Z1TA 3WJPA 3J81M 1KC8H 2CWJA 5AVMA 3RA5A 1K9MH 3RE3A 3HJWC 4I4TA 3CYQA 3C9UA 1FNJA 5CB4A 4BY9D 2IAFA 2UYNA 4X1YA 3GTZA 5FNVA 3RYFB 5HY1A 3CCUF 3CCRF 4HNAA 1SDSA 5GANK 2WALA 3DC2A 4BVRA 3E22A 3JATA 4I50A 1YIJF 3S02A 1JFFB 4XCQA 1GX1A 5EB0A 3SIVA 3JASA 3FD5A 3HKEB 5A2QM 2LCAA 4R40B 3JARA 1M90H 3S0YA 5EIBC 3NK6A 2Z01A 4O4HB 3WPXA 2CHTA 4C82A 2Z1UA 5CA0A 2B33A 4B5CA 5EWRA 4ERHA 5B8FA 3CD6F 1XV2A 3WGLA 2VAWA 1ZWZA 2BTOA 3JAWA 3CCVF 1Q8RA 1X25A 3JAKA 4YJ3A 3ZP7A 4LNUA 3C9SA 4ZHQA 3JAMM 3HKDB 5J2TA 4O4LA 5EYPA 3CPWF 3RYCB 5GIOC 3LWPC 2UYKA 2NMUA 4IIJB 3WGNA 1U40A 3NVKE 5LP6A 4WBNA 2LBWA 1W581 4G88A 1X52A 1NQ3A 2QEXF 2CHSA 4TUYB 1NJIH 3K12A 2GVIA 4NQ3A 1Z5WA 1QVFF 3UT5A 1VQ6F 2PHNA 4BT2A 1FFXA 5J2UB 1SZQA 4ZHVA 3WGKA 3KIZA 5EO3A 1TVKB 3NK7A 3N2KB 4I55A 2ZVYA 1VQOF 2K1SA 4RHAA 3LMEA 3VMFB 3S0WA 3F0EA 4C81A 5IYZB 2KTUA 4NUTA 2ZVZA 5MN4A 2RHHA 3S06A 3VYSC 1VQ9F 1RA4A 4C8IA 1VQMF 4X20A 3LWRC 2HP0B 2FGYA 3HKCA 2OTLF 1DT9A 1VQ5F 4O2BA 5IJ9B 1W5EA 5LXTA 4DXDA 4O4JA 3CCMF 3HWUA 3D01A 4PWTA 4X1IA 3P4EA 2UYJA 5CA1A 4G4ZA 3HKBB 2YXZA 3VTIC 5ITZB 5JCOC 5LYJB 5JVDB 2AIZP 2G9IA 3OBWA 4G4WA 3WGMA 1IV3A 3N2GB 1Q86H 4X3LA 2VAMA 3PLAC 2RHLA 3RYIB 1KNJA 3TD3A 5KMGB 4EI9A 1PXWA 2HX0A 2N48A 1UFYA 4X1KB 1QU9A 1VQNF 2GZLA 2V9YA 4O4IB 3VOAA 2ZAUA 4G4VA 2LBTA 5C8YB 3F0FA 2HS4A 2Q1XA 3NMUC 3D54A 3MQWA 5JQGB 4G4XA 4I4TB 3RYFA 3ON1A 3MDOA 5MN5A 4RQOA 4X1YB 3VOBA 1GO0A 2F9ZC 3VO8A 3AGKA 2UZHA 4G4YA 1JFFA 3T80A 2HP3A 1KNKA 3K2XA 3OONA 3C9TA 3JCMM 3E22B 4BT5A 3JATB 4I50B 3MCAB 4DRXA 5FJ4C 5HY2A 3FPIA 2OHWA 4FFBA 5LA6A 1PF5A 2YYEA 3C8LA 1Q82H 3CC7F 3OW2F 3JASB 1W5BA 1VQ7F 1H7MA 4O2AB 3JARB 3WPWA 4BT7A 5JH7B 4C8GA 1GO1A 3CCJF 2QTPA 3B6NA 3IEQA 1QVGF 2L26A 4IHJB 3E1YA 3M4SA 1K8AH 5CA0B 3GHZA 2BO1A 4LCKA 2I6DA 2FC3A 1QD9A 3MBMA 1VQPF 2ALEA 5FLXM 3HKDA 5G4UC 5GONB 5HP7A 3S03A 3R0PA 1JY8A 5EZYB 3CPQA 3CB2A 1FNKA 3JAWB 3S0HA 3MCQA 3CMEF 3JAKB 4YJ3B 4IIJA 4BT3A 2QA4F 2ZOVA 4U3JA 3CC4F 2H8EA 4O4LB 5EYPB 3F6MA 3I7TA 2AIFA 4EB6B 5LP6B 2ZODA 3CCSF 1UI9A 4WBNB 2KGWA 1H48A 5J2UA 1VK3A 3ERNA 1U3PA
chains in the Genus database with same CATH topology
3S0YA 3OONA 2ZVYA 4PWTA 2LBTA 3WPXA 2K1SA 4G4ZA 4RHAA 2W8BC 3S0WA 1R1MA 2ZF8A 3S03A 2AIZP 4B62A 4G4WA 4G88A 3S0HA 5EB1B 2ZOVA 2ZVZA 4G4XA 4B5CA 4ERHA 3LDTA 3TD4A 3S06A 4ZHWA 3CYPB 3IMPA 2MQEA 3WPWA 3TD3A 3S02A 1OAPA 5EB0A 2N48A 3TD5A 4ZHVA 4G4VA 4ZHYB 4G4YA 2L26A 2KGWA 3CYQA 5EAZA 2LCAA 4R40B 3KHNA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0Y A;  3OON A;  2ZVY A;  4PWT A;  2LBT A;  3WPX A;  2K1S A;  4G4Z A;  4RHA A;  2W8B C;  3S0W A;  1R1M A;  2ZF8 A;  3S03 A;  2AIZ P;  4B62 A;  4G4W A;  4G88 A;  3S0H A;  5EB1 B;  2ZOV A;  2ZVZ A;  4G4X A;  4B5C A;  4ERH A;  3LDT A;  3TD4 A;  3S06 A;  4ZHW A;  3CYP B;  3IMP A;  2MQE A;  3WPW A;  3TD3 A;  3S02 A;  1OAP A;  5EB0 A;  2N48 A;  3TD5 A;  4ZHV A;  4G4V A;  4ZHY B;  4G4Y A;  2L26 A;  2KGW A;  3CYQ A;  5EAZ A;  2LCA A;  4R40 B;  3KHN A;  2HQS C; 
#chains in the Genus database with same CATH topology
 2R75 1;  3ZP4 A;  4TV8 B;  4F6R B;  3F0D A;  3I3F A;  3SIU A;  4TZZ A;  2VXY A;  1R1M A;  1FFX B;  3O85 A;  4TV9 A;  2CVL A;  4B62 A;  3I55 F;  3WGJ A;  1TVK A;  2CZW A;  4BW0 B;  3N2K A;  3L7Q A;  5KX5 A;  1U43 A;  3Q8H A;  3LFO A;  4YJ2 A;  2RHJ A;  3IMP A;  5IYZ A;  2HS0 A;  3JVH A;  5IT9 M;  3ZO8 A;  1XRG A;  1IV2 A;  1Q81 H;  2HVY D;  3FD6 A;  4ZOL A;  1SA0 A;  3HTN A;  3M1X A;  2AMT A;  3G4S F;  3RYH B;  1JN1 A;  1U3L A;  1DBF A;  5LOV B;  3G71 F;  1M1K H;  1RLU A;  3IKE A;  1W40 A;  3KJK A;  1W59 A;  2CW4 A;  2HP0 A;  1IPA A;  2P6Y A;  4B45 A;  1KQS F;  1ODE A;  5EIB D;  1RLG A;  4BT6 A;  3QTY A;  2BTU A;  3CCQ F;  5IJ9 A;  3FBA A;  1X7O A;  3BYQ A;  1TUB A;  5IJ0 A;  1H47 A;  3OBY A;  1OFU A;  2R6R 1;  5LYJ A;  5BMV A;  2GLZ A;  2I6R A;  4O4J B;  1OAP A;  1CN7 A;  3K14 A;  3IR9 A;  3U0O A;  5CA1 B;  1VQ4 F;  5HP8 A;  1N8R H;  1QAH A;  3GYQ A;  4BVT A;  4BVQ A;  4ZI7 B;  5KMG A;  3JAL B;  2HS3 A;  2OZB A;  1YQN A;  2VAP A;  1FSZ A;  4X1K A;  2VGN A;  3VIU A;  3CC2 F;  5HY0 A;  2H8C A;  2CSL A;  4NWO B;  3VCZ A;  1T0A A;  5MN6 A;  2H6L A;  5JCO A;  1IV1 A;  5JQG A;  5CB4 B;  2UYN B;  1X7P A;  1JD1 A;  1VQV A;  2HRU A;  5FNV B;  3LWQ C;  3DDN A;  1COM A;  2HRY A;  3I56 F;  4HNA B;  2IG8 A;  2VGM A;  2HQS C;  1Z5V A;  2KTV A;  1YGY A;  1RQ2 A;  5GIP C;  1YJN F;  2ZF8 A;  3CCL F;  3LYB A;  2Q1Y A;  3HKE A;  3PAF A;  1T0K B;  1J7H A;  2JNB A;  3V3T A;  4O4H A;  3V7E A;  2OTJ F;  2MQE A;  4BVS A;  3WJR A;  5LP6 C;  2EWC A;  4M8I A;  3TD5 A;  2Z1E A;  4DRX B;  5HWE A;  1YI2 F;  4O2A A;  4FFB B;  5LA6 B;  5JH7 A;  1VQK F;  3P10 A;  3KHN A;  1GZ0 A;  1W3E X;  3M84 A;  4IHJ A;  3LWV C;  3RYC A;  1CK2 A;  5DCV A;  4C4W C;  4LNU B;  3G6E F;  3LDT A;  3TD4 A;  3ELC A;  5GON A;  4ZHQ B;  2KG4 A;  1W5A A;  4ZHW A;  5J2T B;  2PMP A;  5EZY A;  1W2B F;  1W41 A;  4EI8 A;  2IQQ A;  3VI6 A;  4TUY A;  3IKF A;  4ZHY B;  4ZK7 A;  3ESJ A;  3IEW A;  4EB6 A;  1K73 H;  1NMU B;  4U3J B;  1XBI A;  3UT5 B;  5G4V C;  2OTM A;  3VYT C;  4TV8 A;  4F6R A;  2BTQ B;  1IV4 A;  3CYP B;  3NVI B;  3KJJ A;  3CG6 A;  3E20 B;  3P0Z A;  3FFM A;  3N4Z A;  2DT4 A;  3ZOP A;  4I55 B;  4KWE A;  2QI2 A;  3V7Q A;  4C8E A;  3C9R A;  3V4D A;  3QHD A;  4TV9 B;  3CCE F;  5GIN C;  1YIT F;  2UYP A;  1Q7Y H;  1VH8 A;  5HXZ A;  5KX5 B;  3EOR A;  1E7K A;  3KE1 A;  3WJQ A;  1ONI A;  4YJ2 B;  4BT4 A;  3LWO C;  3RYH A;  2RB9 A;  5LOV A;  5HXU A;  5EB1 B;  1CLI A;  3F0G A;  4ZOL B;  5HY4 A;  3RA6 A;  1VQL F;  1SA0 B;  4X20 B;  3HKC B;  3HKB A;  4U39 A;  5ITZ A;  4O2B B;  5JVD A;  5GAP K;  5LXT B;  3N2G A;  4X1I B;  1YHQ F;  1YJ9 F;  1XHO A;  1KD1 H;  3K0T A;  3N4Y A;  3WXM B;  1YJW F;  5EAZ A;  3J80 M;  1VQ8 F;  2RHO A;  3QUW A;  3RYI A;  1RQ7 A;  3J7A R;  3HAX D;  3VYU C;  3D00 A;  1TUB B;  5IJ0 B;  1W5F A;  1W55 A;  1W42 A;  1W57 A;  2W8B C;  2Z1F A;  5BMV B;  1S72 F;  3CXC F;  4ZI7 A;  4E6E A;  4B46 A;  4X3M A;  3JAL A;  4O4I A;  3CMA F;  1JJ2 F;  2DYY A;  2LBX A;  4EI7 A;  1VHA A;  5C8Y A;  2Z1T A;  3WJP A;  3J81 M;  1KC8 H;  2CWJ A;  5AVM A;  3RA5 A;  1K9M H;  3RE3 A;  3HJW C;  4I4T A;  3CYQ A;  3C9U A;  1FNJ A;  5CB4 A;  4BY9 D;  2IAF A;  2UYN A;  4X1Y A;  3GTZ A;  5FNV A;  3RYF B;  5HY1 A;  3CCU F;  3CCR F;  4HNA A;  1SDS A;  5GAN K;  2WAL A;  3DC2 A;  4BVR A;  3E22 A;  3JAT A;  4I50 A;  1YIJ F;  3S02 A;  1JFF B;  4XCQ A;  1GX1 A;  5EB0 A;  3SIV A;  3JAS A;  3FD5 A;  3HKE B;  5A2Q M;  2LCA A;  4R40 B;  3JAR A;  1M90 H;  3S0Y A;  5EIB C;  3NK6 A;  2Z01 A;  4O4H B;  3WPX A;  2CHT A;  4C82 A;  2Z1U A;  5CA0 A;  2B33 A;  4B5C A;  5EWR A;  4ERH A;  5B8F A;  3CD6 F;  1XV2 A;  3WGL A;  2VAW A;  1ZWZ A;  2BTO A;  3JAW A;  3CCV F;  1Q8R A;  1X25 A;  3JAK A;  4YJ3 A;  3ZP7 A;  4LNU A;  3C9S A;  4ZHQ A;  3JAM M;  3HKD B;  5J2T A;  4O4L A;  5EYP A;  3CPW F;  3RYC B;  5GIO C;  3LWP C;  2UYK A;  2NMU A;  4IIJ B;  3WGN A;  1U40 A;  3NVK E;  5LP6 A;  4WBN A;  2LBW A;  1W58 1;  4G88 A;  1X52 A;  1NQ3 A;  2QEX F;  2CHS A;  4TUY B;  1NJI H;  3K12 A;  2GVI A;  4NQ3 A;  1Z5W A;  1QVF F;  3UT5 A;  1VQ6 F;  2PHN A;  4BT2 A;  1FFX A;  5J2U B;  1SZQ A;  4ZHV A;  3WGK A;  3KIZ A;  5EO3 A;  1TVK B;  3NK7 A;  3N2K B;  4I55 A;  2ZVY A;  1VQO F;  2K1S A;  4RHA A;  3LME A;  3VMF B;  3S0W A;  3F0E A;  4C81 A;  5IYZ B;  2KTU A;  4NUT A;  2ZVZ A;  5MN4 A;  2RHH A;  3S06 A;  3VYS C;  1VQ9 F;  1RA4 A;  4C8I A;  1VQM F;  4X20 A;  3LWR C;  2HP0 B;  2FGY A;  3HKC A;  2OTL F;  1DT9 A;  1VQ5 F;  4O2B A;  5IJ9 B;  1W5E A;  5LXT A;  4DXD A;  4O4J A;  3CCM F;  3HWU A;  3D01 A;  4PWT A;  4X1I A;  3P4E A;  2UYJ A;  5CA1 A;  4G4Z A;  3HKB B;  2YXZ A;  3VTI C;  5ITZ B;  5JCO C;  5LYJ B;  5JVD B;  2AIZ P;  2G9I A;  3OBW A;  4G4W A;  3WGM A;  1IV3 A;  3N2G B;  1Q86 H;  4X3L A;  2VAM A;  3PLA C;  2RHL A;  3RYI B;  1KNJ A;  3TD3 A;  5KMG B;  4EI9 A;  1PXW A;  2HX0 A;  2N48 A;  1UFY A;  4X1K B;  1QU9 A;  1VQN F;  2GZL A;  2V9Y A;  4O4I B;  3VOA A;  2ZAU A;  4G4V A;  2LBT A;  5C8Y B;  3F0F A;  2HS4 A;  2Q1X A;  3NMU C;  3D54 A;  3MQW A;  5JQG B;  4G4X A;  4I4T B;  3RYF A;  3ON1 A;  3MDO A;  5MN5 A;  4RQO A;  4X1Y B;  3VOB A;  1GO0 A;  2F9Z C;  3VO8 A;  3AGK A;  2UZH A;  4G4Y A;  1JFF A;  3T80 A;  2HP3 A;  1KNK A;  3K2X A;  3OON A;  3C9T A;  3JCM M;  3E22 B;  4BT5 A;  3JAT B;  4I50 B;  3MCA B;  4DRX A;  5FJ4 C;  5HY2 A;  3FPI A;  2OHW A;  4FFB A;  5LA6 A;  1PF5 A;  2YYE A;  3C8L A;  1Q82 H;  3CC7 F;  3OW2 F;  3JAS B;  1W5B A;  1VQ7 F;  1H7M A;  4O2A B;  3JAR B;  3WPW A;  4BT7 A;  5JH7 B;  4C8G A;  1GO1 A;  3CCJ F;  2QTP A;  3B6N A;  3IEQ A;  1QVG F;  2L26 A;  4IHJ B;  3E1Y A;  3M4S A;  1K8A H;  5CA0 B;  3GHZ A;  2BO1 A;  4LCK A;  2I6D A;  2FC3 A;  1QD9 A;  3MBM A;  1VQP F;  2ALE A;  5FLX M;  3HKD A;  5G4U C;  5GON B;  5HP7 A;  3S03 A;  3R0P A;  1JY8 A;  5EZY B;  3CPQ A;  3CB2 A;  1FNK A;  3JAW B;  3S0H A;  3MCQ A;  3CME F;  3JAK B;  4YJ3 B;  4IIJ A;  4BT3 A;  2QA4 F;  2ZOV A;  4U3J A;  3CC4 F;  2H8E A;  4O4L B;  5EYP B;  3F6M A;  3I7T A;  2AIF A;  4EB6 B;  5LP6 B;  2ZOD A;  3CCS F;  1UI9 A;  4WBN B;  2KGW A;  1H48 A;  5J2U A;  1VK3 A;  3ERN A;  1U3P A; 
#chains in the Genus database with same CATH homology
 3S0Y A;  3OON A;  2ZVY A;  4PWT A;  2LBT A;  3WPX A;  2K1S A;  4G4Z A;  4RHA A;  2W8B C;  3S0W A;  1R1M A;  2ZF8 A;  3S03 A;  2AIZ P;  4B62 A;  4G4W A;  4G88 A;  3S0H A;  5EB1 B;  2ZOV A;  2ZVZ A;  4G4X A;  4B5C A;  4ERH A;  3LDT A;  3TD4 A;  3S06 A;  4ZHW A;  3CYP B;  3IMP A;  2MQE A;  3WPW A;  3TD3 A;  3S02 A;  1OAP A;  5EB0 A;  2N48 A;  3TD5 A;  4ZHV A;  4G4V A;  4ZHY B;  4G4Y A;  2L26 A;  2KGW A;  3CYQ A;  5EAZ A;  2LCA A;  4R40 B;  3KHN A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...