2MQEA

Solution structure of escherichia coli outer membrane protein a c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OmpA domain protein transmembrane region-containing protein
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2mqeA00
3CYPB 2W8BC 1R1MA 3S0WA 3WPWA 4G88A 3S0YA 2MQEA 2ZOVA 5EAZA 3WPXA 3IMPA 3S02A 5EB1B 3S0HA 2ZVYA 3S06A 4G4YA 2LBTA 2KGWA 4R40B 3KHNA 3TD3A 4B5CA 3S03A 2N48A 4G4WA 3TD4A 2AIZP 4G4ZA 2K1SA 3LDTA 3CYQA 4ERHA 4RHAA 3OONA 5EB0A 4PWTA 4ZHWA 2LCAA 4G4XA 2HQSC 3TD5A 4G4VA 4ZHYB 4B62A 2ZVZA 4ZHVA 1OAPA 2L26A 2ZF8A
chains in the Genus database with same CATH superfamily
2UYPA 4BVSA 3J81M 1YITF 4X1KA 2RHOA 2ZOVA 2HRUA 5BMVB 5LA6B 2P6YA 3OBYA 1K73H 2UYKA 3KHNA 3T80A 2LBXA 5HXZA 3VTIC 1K9MH 1JJ2F 2HP0B 4C4WC 1IV4A 5GINC 3ERNA 1FFXB 1S72F 5JVDA 2OTMA 4X1KB 1X7OA 4G88A 1M1KH 3VO8A 2Z1FA 5EB1B 3LWVC 3CC2F 3VOBA 3WGNA 3CCVF 3F6MA 4IIJB 3E22A 3D00A 4BVRA 5JH7B 5EWRA 1IPAA 2H8CA 1TUBB 3G71F 2HX0A 3NVIB 2B33A 2HS0A 4EI8A 5JCOC 2HQSC 1YJNF 5LP6C 2ZAUA 1GX1A 3HAXD 3CCEF 3ESJA 3MQWA 3MBMA 1VQ5F 3WPXA 3F0EA 1M90H 2GLZA 3AGKA 3O85A 4LNUB 3K2XA 2OHWA 3UT5B 5EIBC 2H6LA 3CC7F 4C8IA 2IAFA 5JH7A 4X20A 1J7HA 4YJ3B 2RHLA 5IJ0B 2K1SA 1W5AA 3N4ZA 1NQ3A 3CYQA 3HKBB 4O4IB 3V7QA 5EB0A 1T0KB 3R0PA 2G9IA 5CA1A 4RQOA 2KTVA 5GONB 3WGKA 1GO0A 5HWEA 3MCAB 2VXYA 2I6DA 2DYYA 1TUBA 4ZOLA 5EO3A 3IMPA 1ONIA 4EI7A 5IYZA 1YJWF 1VK3A 1PXWA 5JQGB 5C8YA 1YHQF 5CB4A 1COMA 5HY4A 3V3TA 5HP8A 3RYFB 3GTZA 2Z1UA 5LA6A 3JAWA 5KMGB 3N2GB 5MN6A 4I55B 1Q8RA 1VQMF 2L26A 3CYPB 3M4SA 4YJ3A 2VAWA 3F0GA 2CHTA 1KNKA 3RA6A 1W55A 3JAKA 3CCQF 5LP6B 3CCUF 3LWOC 3IKEA 2KG4A 4ZI7B 1YI2F 3S03A 2N48A 4I55A 4BT7A 5G4VC 2WALA 1VQNF 1YIJF 4TUYA 4X1YB 4TUYB 5EZYA 3LWPC 1KQSF 5G4UC 3ELCA 3JAWB 3CCLF 4BY9D 3C9SA 4ZHWA 1H7MA 4G4VA 1SA0A 2I6RA 2QA4F 4BT6A 1T0AA 5CB4B 2BO1A 3G4SF 4X3LA 3J80M 2LBWA 3MCQA 5J2TB 5EAZA 4LCKA 2ZVYA 5ITZA 2DT4A 4IHJA 2ZODA 3NK6A 5HY1A 3I7TA 3TD4A 1H47A 2H8EA 4BT3A 3K12A 1Z5WA 3I56F 4O4IA 3K14A 3D54A 3P0ZA 5BMVA 1U3LA 1QD9A 5KX5B 2Q1YA 3NVKE 1Z5VA 3U0OA 4ZI7A 2ZF8A 1W59A 5IJ0A 4BVTA 3Q8HA 4BT5A 5GIPC 1GZ0A 1U3PA 1W42A 1VQKF 1JN1A 3WJQA 2KGWA 1QVGF 3JARA 5HY2A 3IEQA 3NMUC 1U40A 4NUTA 1CN7A 4EB6A 4RHAA 2GZLA 1FSZA 4O4LA 5ITZB 3RE3A 3LMEA 4E6EA 3VIUA 3JATA 3LWQC 2YXZA 2VAMA 4ZOLB 3CG6A 3QHDA 3FD6A 3K0TA 3WXMB 1XHOA 2UZHA 3FD5A 3WGLA 3C8LA 3QUWA 1SA0B 4NWOB 3C9UA 5LYJB 3CCMF 2AIFA 3J7AR 3LDTA 5J2TA 5FJ4C 2AMTA 1K8AH 4I4TA 3VYTC 3ZO8A 1YQNA 2LCAA 5A2QM 2GVIA 3L7QA 3JATB 3KE1A 3UT5A 5LP6A 1XBIA 2FGYA 5GAPK 5LYJA 3CCJF 4KWEA 5LOVB 3S0YA 2MQEA 5J2UA 2CZWA 2OTLF 5DCVA 4C81A 3S02A 2CSLA 2YYEA 1FNKA 1VQ7F 2LBTA 3VI6A 2HP3A 1GO1A 3RYCB 4O2BB 1VHAA 4YJ2B 3RYHB 2RHJA 3RYFA 1X7PA 3FFMA 5EIBD 3JALA 3N4YA 4X3MA 4I4TB 3I3FA 2BTOA 4PWTA 4DRXA 5C8YB 1VQVA 4B62A 2ZVZA 1RQ2A 3WJPA 3VCZA 3WPWA 1VQOF 3PAFA 3C9RA 3ON1A 1W40A 3S06A 3LYBA 3GHZA 5CA1B 1X52A 2Q1XA 4R40B 3JASA 2Z1TA 3G6EF 2OZBA 2UYNB 5EYPB 1OFUA 3HKCA 4G4ZA 3WGJA 3E1YA 1KC8H 4EB6B 4XCQA 1JY8A 1W41A 1YJ9F 2CW4A 3CB2A 5IJ9B 1RA4A 3TD5A 3BYQA 3HTNA 3ZOPA 2CWJA 2Z01A 3D01A 3HWUA 1Q81H 4HNAA 2V9YA 2Z1EA 3MDOA 4F6RB 3V4DA 3CPWF 1JD1A 4LNUA 4X20B 1VQPF 3JAMM 3CMEF 3FPIA 2HVYD 1VQ8F 1FNJA 1H48A 1NMUB 5GIOC 1Q82H 3HKEA 3CPQA 1SZQA 3KJJA 2QEXF 4ZHYB 3V7EA 4HNAB 1UI9A 3N2KA 1DT9A 5GONA 3VOAA 4ZK7A 1RLGA 1RLUA 4O2AB 3DC2A 3KIZA 5HP7A 5JQGA 4TV9B 4TV9A 5KX5A 1Q7YH 5IYZB 4TZZA 1ZWZA 1NJIH 1PF5A 4B5CA 3WJRA 3RYIA 3RYCA 1VQ9F 2CVLA 1SDSA 1CK2A 1W5FA 5MN4A 4O4LB 1W5BA 3PLAC 3OBWA 4IHJB 2IG8A 3CC4F 1TVKB 1XV2A 3JCMM 1VQ4F 3HKDB 3F0DA 3QTYA 1R1MA 3S0WA 5J2UB 3SIVA 3IEWA 3E20B 2BTUA 5HY0A 3GYQA 1X25A 2EWCA 2ALEA 1W3EX 1QAHA 5LXTB 5GANK 4O2BA 4WBNA 3SIUA 3B6NA 5MN5A 3NK7A 5EZYB 4I50B 4I50A 3HJWC 2IQQA 4U39A 2HS4A 2VGNA 3EORA 4BVQA 3C9TA 4X1IB 1TVKA 4O4HB 3CXCF 2RB9A 3WGMA 4DXDA 1Q86H 2UYJA 1OAPA 5LXTA 5FLXM 3CCSF 3HKCB 2W8BC 3CCRF 4M8IA 1VH8A 3CMAF 4C82A 1W5EA 1UFYA 2NMUA 3JASB 1RQ7A 1W581 5HXUA 4O4HA 4EI9A 2CHSA 3IKFA 3N2GA 1W57A 4YJ2A 5IT9M 3RA5A 1IV3A 1XRGA 4FFBA 2PHNA 1JFFA 4TV8B 1ODEA 3DDNA 4C8EA 3HKBA 4C8GA 2QI2A 1QU9A 4DRXB 3KJKA 1IV2A 4G4XA 1U43A 1E7KA 5CA0A 4WBNB 1VQ6F 3VMFB 3RYHA 1CLIA 2R751 3JALB 2HP0A 2VAPA 2PMPA 3F0FA 4X1IA 3S0HA 1QVFF 3IR9A 3LFOA 2VGMA 3CD6F 3JARB 5KMGA 2BTQB 2F9ZC 2QTPA 5JVDB 3P4EA 1FFXA 3TD3A 4O4JB 3ZP7A 4G4WA 4FFBB 4O4JA 5LOVA 2AIZP 2KTUA 1VQLF 3ZP4A 4BT4A 3OONA 5IJ9A 1YGYA 4BT2A 4BW0B 3JAKB 5CA0B 4B45A 1IV1A 4ZHVA 3E22B 3HKDA 4U3JA 5B8FA 2UYNA 5EYPA 4F6RA 3M84A 5FNVA 5AVMA 1JFFB 4TV8A 1N8RH 4O2AA 3VYSC 4NQ3A 3LWRC 4G4YA 2OTJF 3I55F 2FC3A 4B46A 3RYIB 3OW2F 3FBAA 1KD1H 4U3JB 2R6R1 3M1XA 1DBFA 1KNJA 4X1YA 4ZHQA 3HKEB 2HS3A 5FNVB 4ERHA 3JVHA 4ZHQB 2RHHA 3VYUC 2JNBA 1W2BF 3P10A 4IIJA 3N2KB 5JCOA 2HRYA
chains in the Genus database with same CATH topology
3CYPB 2W8BC 1R1MA 3S0WA 3WPWA 4G88A 3S0YA 2MQEA 2ZOVA 5EAZA 3WPXA 3IMPA 3S02A 5EB1B 3S0HA 2ZVYA 3S06A 4G4YA 2LBTA 2KGWA 4R40B 3KHNA 3TD3A 4B5CA 3S03A 2N48A 4G4WA 3TD4A 2AIZP 4G4ZA 2K1SA 3LDTA 3CYQA 4ERHA 4RHAA 3OONA 5EB0A 4PWTA 4ZHWA 2LCAA 4G4XA 2HQSC 3TD5A 4G4VA 4ZHYB 4B62A 2ZVZA 4ZHVA 1OAPA 2L26A 2ZF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYP B;  2W8B C;  1R1M A;  3S0W A;  3WPW A;  4G88 A;  3S0Y A;  2MQE A;  2ZOV A;  5EAZ A;  3WPX A;  3IMP A;  3S02 A;  5EB1 B;  3S0H A;  2ZVY A;  3S06 A;  4G4Y A;  2LBT A;  2KGW A;  4R40 B;  3KHN A;  3TD3 A;  4B5C A;  3S03 A;  2N48 A;  4G4W A;  3TD4 A;  2AIZ P;  4G4Z A;  2K1S A;  3LDT A;  3CYQ A;  4ERH A;  4RHA A;  3OON A;  5EB0 A;  4PWT A;  4ZHW A;  2LCA A;  4G4X A;  2HQS C;  3TD5 A;  4G4V A;  4ZHY B;  4B62 A;  2ZVZ A;  4ZHV A;  1OAP A;  2L26 A;  2ZF8 A; 
#chains in the Genus database with same CATH topology
 2UYP A;  4BVS A;  3J81 M;  1YIT F;  4X1K A;  2RHO A;  2ZOV A;  2HRU A;  5BMV B;  5LA6 B;  2P6Y A;  3OBY A;  1K73 H;  2UYK A;  3KHN A;  3T80 A;  2LBX A;  5HXZ A;  3VTI C;  1K9M H;  1JJ2 F;  2HP0 B;  4C4W C;  1IV4 A;  5GIN C;  3ERN A;  1FFX B;  1S72 F;  5JVD A;  2OTM A;  4X1K B;  1X7O A;  4G88 A;  1M1K H;  3VO8 A;  2Z1F A;  5EB1 B;  3LWV C;  3CC2 F;  3VOB A;  3WGN A;  3CCV F;  3F6M A;  4IIJ B;  3E22 A;  3D00 A;  4BVR A;  5JH7 B;  5EWR A;  1IPA A;  2H8C A;  1TUB B;  3G71 F;  2HX0 A;  3NVI B;  2B33 A;  2HS0 A;  4EI8 A;  5JCO C;  2HQS C;  1YJN F;  5LP6 C;  2ZAU A;  1GX1 A;  3HAX D;  3CCE F;  3ESJ A;  3MQW A;  3MBM A;  1VQ5 F;  3WPX A;  3F0E A;  1M90 H;  2GLZ A;  3AGK A;  3O85 A;  4LNU B;  3K2X A;  2OHW A;  3UT5 B;  5EIB C;  2H6L A;  3CC7 F;  4C8I A;  2IAF A;  5JH7 A;  4X20 A;  1J7H A;  4YJ3 B;  2RHL A;  5IJ0 B;  2K1S A;  1W5A A;  3N4Z A;  1NQ3 A;  3CYQ A;  3HKB B;  4O4I B;  3V7Q A;  5EB0 A;  1T0K B;  3R0P A;  2G9I A;  5CA1 A;  4RQO A;  2KTV A;  5GON B;  3WGK A;  1GO0 A;  5HWE A;  3MCA B;  2VXY A;  2I6D A;  2DYY A;  1TUB A;  4ZOL A;  5EO3 A;  3IMP A;  1ONI A;  4EI7 A;  5IYZ A;  1YJW F;  1VK3 A;  1PXW A;  5JQG B;  5C8Y A;  1YHQ F;  5CB4 A;  1COM A;  5HY4 A;  3V3T A;  5HP8 A;  3RYF B;  3GTZ A;  2Z1U A;  5LA6 A;  3JAW A;  5KMG B;  3N2G B;  5MN6 A;  4I55 B;  1Q8R A;  1VQM F;  2L26 A;  3CYP B;  3M4S A;  4YJ3 A;  2VAW A;  3F0G A;  2CHT A;  1KNK A;  3RA6 A;  1W55 A;  3JAK A;  3CCQ F;  5LP6 B;  3CCU F;  3LWO C;  3IKE A;  2KG4 A;  4ZI7 B;  1YI2 F;  3S03 A;  2N48 A;  4I55 A;  4BT7 A;  5G4V C;  2WAL A;  1VQN F;  1YIJ F;  4TUY A;  4X1Y B;  4TUY B;  5EZY A;  3LWP C;  1KQS F;  5G4U C;  3ELC A;  3JAW B;  3CCL F;  4BY9 D;  3C9S A;  4ZHW A;  1H7M A;  4G4V A;  1SA0 A;  2I6R A;  2QA4 F;  4BT6 A;  1T0A A;  5CB4 B;  2BO1 A;  3G4S F;  4X3L A;  3J80 M;  2LBW A;  3MCQ A;  5J2T B;  5EAZ A;  4LCK A;  2ZVY A;  5ITZ A;  2DT4 A;  4IHJ A;  2ZOD A;  3NK6 A;  5HY1 A;  3I7T A;  3TD4 A;  1H47 A;  2H8E A;  4BT3 A;  3K12 A;  1Z5W A;  3I56 F;  4O4I A;  3K14 A;  3D54 A;  3P0Z A;  5BMV A;  1U3L A;  1QD9 A;  5KX5 B;  2Q1Y A;  3NVK E;  1Z5V A;  3U0O A;  4ZI7 A;  2ZF8 A;  1W59 A;  5IJ0 A;  4BVT A;  3Q8H A;  4BT5 A;  5GIP C;  1GZ0 A;  1U3P A;  1W42 A;  1VQK F;  1JN1 A;  3WJQ A;  2KGW A;  1QVG F;  3JAR A;  5HY2 A;  3IEQ A;  3NMU C;  1U40 A;  4NUT A;  1CN7 A;  4EB6 A;  4RHA A;  2GZL A;  1FSZ A;  4O4L A;  5ITZ B;  3RE3 A;  3LME A;  4E6E A;  3VIU A;  3JAT A;  3LWQ C;  2YXZ A;  2VAM A;  4ZOL B;  3CG6 A;  3QHD A;  3FD6 A;  3K0T A;  3WXM B;  1XHO A;  2UZH A;  3FD5 A;  3WGL A;  3C8L A;  3QUW A;  1SA0 B;  4NWO B;  3C9U A;  5LYJ B;  3CCM F;  2AIF A;  3J7A R;  3LDT A;  5J2T A;  5FJ4 C;  2AMT A;  1K8A H;  4I4T A;  3VYT C;  3ZO8 A;  1YQN A;  2LCA A;  5A2Q M;  2GVI A;  3L7Q A;  3JAT B;  3KE1 A;  3UT5 A;  5LP6 A;  1XBI A;  2FGY A;  5GAP K;  5LYJ A;  3CCJ F;  4KWE A;  5LOV B;  3S0Y A;  2MQE A;  5J2U A;  2CZW A;  2OTL F;  5DCV A;  4C81 A;  3S02 A;  2CSL A;  2YYE A;  1FNK A;  1VQ7 F;  2LBT A;  3VI6 A;  2HP3 A;  1GO1 A;  3RYC B;  4O2B B;  1VHA A;  4YJ2 B;  3RYH B;  2RHJ A;  3RYF A;  1X7P A;  3FFM A;  5EIB D;  3JAL A;  3N4Y A;  4X3M A;  4I4T B;  3I3F A;  2BTO A;  4PWT A;  4DRX A;  5C8Y B;  1VQV A;  4B62 A;  2ZVZ A;  1RQ2 A;  3WJP A;  3VCZ A;  3WPW A;  1VQO F;  3PAF A;  3C9R A;  3ON1 A;  1W40 A;  3S06 A;  3LYB A;  3GHZ A;  5CA1 B;  1X52 A;  2Q1X A;  4R40 B;  3JAS A;  2Z1T A;  3G6E F;  2OZB A;  2UYN B;  5EYP B;  1OFU A;  3HKC A;  4G4Z A;  3WGJ A;  3E1Y A;  1KC8 H;  4EB6 B;  4XCQ A;  1JY8 A;  1W41 A;  1YJ9 F;  2CW4 A;  3CB2 A;  5IJ9 B;  1RA4 A;  3TD5 A;  3BYQ A;  3HTN A;  3ZOP A;  2CWJ A;  2Z01 A;  3D01 A;  3HWU A;  1Q81 H;  4HNA A;  2V9Y A;  2Z1E A;  3MDO A;  4F6R B;  3V4D A;  3CPW F;  1JD1 A;  4LNU A;  4X20 B;  1VQP F;  3JAM M;  3CME F;  3FPI A;  2HVY D;  1VQ8 F;  1FNJ A;  1H48 A;  1NMU B;  5GIO C;  1Q82 H;  3HKE A;  3CPQ A;  1SZQ A;  3KJJ A;  2QEX F;  4ZHY B;  3V7E A;  4HNA B;  1UI9 A;  3N2K A;  1DT9 A;  5GON A;  3VOA A;  4ZK7 A;  1RLG A;  1RLU A;  4O2A B;  3DC2 A;  3KIZ A;  5HP7 A;  5JQG A;  4TV9 B;  4TV9 A;  5KX5 A;  1Q7Y H;  5IYZ B;  4TZZ A;  1ZWZ A;  1NJI H;  1PF5 A;  4B5C A;  3WJR A;  3RYI A;  3RYC A;  1VQ9 F;  2CVL A;  1SDS A;  1CK2 A;  1W5F A;  5MN4 A;  4O4L B;  1W5B A;  3PLA C;  3OBW A;  4IHJ B;  2IG8 A;  3CC4 F;  1TVK B;  1XV2 A;  3JCM M;  1VQ4 F;  3HKD B;  3F0D A;  3QTY A;  1R1M A;  3S0W A;  5J2U B;  3SIV A;  3IEW A;  3E20 B;  2BTU A;  5HY0 A;  3GYQ A;  1X25 A;  2EWC A;  2ALE A;  1W3E X;  1QAH A;  5LXT B;  5GAN K;  4O2B A;  4WBN A;  3SIU A;  3B6N A;  5MN5 A;  3NK7 A;  5EZY B;  4I50 B;  4I50 A;  3HJW C;  2IQQ A;  4U39 A;  2HS4 A;  2VGN A;  3EOR A;  4BVQ A;  3C9T A;  4X1I B;  1TVK A;  4O4H B;  3CXC F;  2RB9 A;  3WGM A;  4DXD A;  1Q86 H;  2UYJ A;  1OAP A;  5LXT A;  5FLX M;  3CCS F;  3HKC B;  2W8B C;  3CCR F;  4M8I A;  1VH8 A;  3CMA F;  4C82 A;  1W5E A;  1UFY A;  2NMU A;  3JAS B;  1RQ7 A;  1W58 1;  5HXU A;  4O4H A;  4EI9 A;  2CHS A;  3IKF A;  3N2G A;  1W57 A;  4YJ2 A;  5IT9 M;  3RA5 A;  1IV3 A;  1XRG A;  4FFB A;  2PHN A;  1JFF A;  4TV8 B;  1ODE A;  3DDN A;  4C8E A;  3HKB A;  4C8G A;  2QI2 A;  1QU9 A;  4DRX B;  3KJK A;  1IV2 A;  4G4X A;  1U43 A;  1E7K A;  5CA0 A;  4WBN B;  1VQ6 F;  3VMF B;  3RYH A;  1CLI A;  2R75 1;  3JAL B;  2HP0 A;  2VAP A;  2PMP A;  3F0F A;  4X1I A;  3S0H A;  1QVF F;  3IR9 A;  3LFO A;  2VGM A;  3CD6 F;  3JAR B;  5KMG A;  2BTQ B;  2F9Z C;  2QTP A;  5JVD B;  3P4E A;  1FFX A;  3TD3 A;  4O4J B;  3ZP7 A;  4G4W A;  4FFB B;  4O4J A;  5LOV A;  2AIZ P;  2KTU A;  1VQL F;  3ZP4 A;  4BT4 A;  3OON A;  5IJ9 A;  1YGY A;  4BT2 A;  4BW0 B;  3JAK B;  5CA0 B;  4B45 A;  1IV1 A;  4ZHV A;  3E22 B;  3HKD A;  4U3J A;  5B8F A;  2UYN A;  5EYP A;  4F6R A;  3M84 A;  5FNV A;  5AVM A;  1JFF B;  4TV8 A;  1N8R H;  4O2A A;  3VYS C;  4NQ3 A;  3LWR C;  4G4Y A;  2OTJ F;  3I55 F;  2FC3 A;  4B46 A;  3RYI B;  3OW2 F;  3FBA A;  1KD1 H;  4U3J B;  2R6R 1;  3M1X A;  1DBF A;  1KNJ A;  4X1Y A;  4ZHQ A;  3HKE B;  2HS3 A;  5FNV B;  4ERH A;  3JVH A;  4ZHQ B;  2RHH A;  3VYU C;  2JNB A;  1W2B F;  3P10 A;  4IIJ A;  3N2K B;  5JCO A;  2HRY A; 
#chains in the Genus database with same CATH homology
 3CYP B;  2W8B C;  1R1M A;  3S0W A;  3WPW A;  4G88 A;  3S0Y A;  2MQE A;  2ZOV A;  5EAZ A;  3WPX A;  3IMP A;  3S02 A;  5EB1 B;  3S0H A;  2ZVY A;  3S06 A;  4G4Y A;  2LBT A;  2KGW A;  4R40 B;  3KHN A;  3TD3 A;  4B5C A;  3S03 A;  2N48 A;  4G4W A;  3TD4 A;  2AIZ P;  4G4Z A;  2K1S A;  3LDT A;  3CYQ A;  4ERH A;  4RHA A;  3OON A;  5EB0 A;  4PWT A;  4ZHW A;  2LCA A;  4G4X A;  2HQS C;  3TD5 A;  4G4V A;  4ZHY B;  4B62 A;  2ZVZ A;  4ZHV A;  1OAP A;  2L26 A;  2ZF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...