2MQEA

Solution structure of escherichia coli outer membrane protein a c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OmpA domain protein transmembrane region-containing protein
publication title The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2mqeA00
2K1SA 3IMPA 2ZF8A 4PWTA 2LBTA 4B5CA 4ZHYB 4ZHWA 2MQEA 3CYQA 1R1MA 3TD5A 1OAPA 4G4ZA 4RHAA 3CYPB 2ZVZA 3OONA 3S02A 2KGWA 3S03A 4G88A 3WPXA 3S0YA 4G4XA 4B62A 4R40B 2AIZP 5EB1B 5EAZA 2ZOVA 4G4YA 4G4VA 3S0WA 3S06A 2L26A 2ZVYA 5EB0A 2W8BC 3LDTA 3TD3A 3TD4A 4G4WA 3WPWA 2N48A 4ERHA 2LCAA 2HQSC 3KHNA 4ZHVA 3S0HA
chains in the Genus database with same CATH superfamily
2RHOA 3VYUC 2VAWA 3CCVF 1VQOF 5HY1A 4KWEA 3CCJF 4DRXB 2VGMA 5J2UA 1KNKA 1VQ5F 1UI9A 3S0YA 3HKEA 1FFXA 4X1IA 3GTZA 1IPAA 1SDSA 1JFFB 1CLIA 4C8EA 1CN7A 1UFYA 2VXYA 3M4SA 3I7TA 3RE3A 5KX5B 1VQ7F 1J7HA 1VQLF 2BTUA 3KHNA 3N2GB 5JCOC 1RLGA 1CK2A 1TUBA 4TV8A 3AGKA 4O2AA 5BMVB 5EYPA 3HAXD 3JAKA 4IIJA 1VQ6F 5JQGB 2R751 4X3MA 4M8IA 3RYIB 1DBFA 3ESJA 4O4HB 2H6LA 3N4ZA 5JH7B 1VQ9F 5CA1A 4ZOLA 1DT9A 1RQ2A 4U3JA 4ERHA 3LWPC 2PHNA 3CC4F 3D54A 2K1SA 3D01A 5KMGA 2OTJF 2LBXA 3J80M 3HTNA 3CYPB 5EIBC 4ZI7A 4EI8A 3VYTC 3FFMA 3RA5A 4BT4A 2GZLA 1M1KH 5J2UB 4HNAB 2Q1YA 2EWCA 5CB4B 5MN5A 3F0EA 3HKEB 4X1IB 3NK7A 5B8FA 1VQ4F 4XCQA 4BT5A 5JVDA 3CCUF 3RYFA 2N48A 3IKFA 3RYHB 3VCZA 4DXDA 1H7MA 4BVTA 4B5CA 4ZHYB 2HX0A 1U3LA 3JAMM 1KNJA 2Z01A 2GVIA 2IG8A 4BT3A 2BO1A 2HP0A 4C82A 1Q8RA 2LBWA 1QD9A 1U3PA 4NWOB 3IEQA 5EYPB 3JAKB 1H48A 3HKCB 2AIFA 3LYBA 4TV9B 4YJ3B 1YJWF 3CC7F 5ITZA 3J81M 1W2BF 1NMUB 3WGLA 4C4WC 4I55A 1ONIA 3SIUA 1Z5VA 3M1XA 5CA1B 4ZOLB 5LYJB 3I56F 1Q86H 2KTVA 1W57A 3ZOPA 1W55A 5LXTA 3OBYA 2LBTA 2ZF8A 2V9YA 3CB2A 5HP8A 4BVSA 4RHAA 2OHWA 3MDOA 1W3EX 5FNVA 5KMGB 4O4JA 3VYSC 4LNUB 1FNJA 1YQNA 3DC2A 3K14A 2AIZP 1KD1H 1IV2A 2WALA 1YJNF 3WGMA 2CZWA 2HRYA 3C8LA 3ZP4A 5GIPC 3N2KB 2OZBA 3IKEA 3T80A 4BVQA 3FBAA 3WPWA 5JVDB 2Q1XA 3L7QA 4WBNA 2CWJA 1KQSF 3CG6A 4I4TA 4C8IA 2OTLF 2VAMA 3JARA 3UT5B 3CC2F 5IYZA 3E20B 1Z5WA 3QUWA 4TZZA 1RQ7A 1YIJF 3WGNA 4X1KB 2P6YA 4B62A 1U43A 5IJ9A 5HY0A 4X1YA 3KJJA 2UZHA 3F0FA 4ZK7A 5EB0A 2F9ZC 2ZODA 3CXCF 5HY4A 5ITZB 5CA0A 1ZWZA 2HVYD 3IMPA 1YI2F 1W581 4O4LA 3LWOC 5C8YA 3JASA 1JY8A 4FFBB 3RYCA 5J2TA 5LP6B 1RLUA 1OAPA 3CMAF 4G4ZA 1Q81H 4ZHQB 5A2QM 2I6DA 3F0GA 3WGKA 5LOVB 3JCMM 4O4JB 3VOAA 4BVRA 4G4YA 1K9MH 5JCOA 2KTUA 3MBMA 3P0ZA 1VQMF 2NMUA 3JATA 3E1YA 3NVIB 2W8BC 5LA6B 4EI9A 5DCVA 3JAWA 2R6R1 4X20A 1VQKF 3N4YA 1GO1A 2HQSC 3V7QA 3ERNA 4PWTA 1QAHA 1SA0A 3CYQA 2Z1EA 4WBNB 2HP3A 1E7KA 1VHAA 4U39A 1COMA 1W40A 2DYYA 3HKBA 1YGYA 5IYZB 2YXZA 4G4XA 3MCQA 3WJPA 3G4SF 1Q82H 3VIUA 2G9IA 1FFXB 1JN1A 1FSZA 5EZYA 5IJ0A 3QHDA 3JALA 2HRUA 4O4IA 4ZHWA 1JD1A 1R1MA 2RB9A 2UYKA 3RA6A 5HWEA 2BTOA 2HS4A 3LWVC 5C8YB 1TUBB 3K2XA 4TV8B 3DDNA 4LCKA 3WPXA 4O2AB 2HS3A 1T0AA 3HWUA 1W59A 4IIJB 3V7EA 2ZOVA 3E22A 3CCLF 2FC3A 4I50A 3LDTA 4O2BA 5MN4A 4F6RA 1VK3A 3V4DA 3TD4A 3WJQA 1PF5A 3JATB 3CCSF 1T0KB 1PXWA 1W41A 2UYPA 4DRXA 3C9TA 3C9SA 2FGYA 2RHJA 3KIZA 3CCRF 2GLZA 3KE1A 4U3JB 2VAPA 1FNKA 1XRGA 2Z1TA 3M84A 3ZO8A 1SA0B 1XBIA 5LP6C 3HJWC 5IT9M 1JFFA 3CPWF 2KGWA 1K73H 3LMEA 4ZI7B 2RHLA 3KJKA 4TUYA 5GAPK 3JVHA 2QTPA 3HKDA 5EWRA 3LWRC 5G4VC 4ZHVA 4BW0B 3RYFB 5IJ0B 3VOBA 1QU9A 5JQGA 3K12A 3R0PA 2CHSA 1H47A 3OONA 3I55F 3RYIA 3V3TA 3FD5A 2Z1FA 2HP0B 1VQNF 1QVFF 5GINC 3F6MA 4BT7A 2HS0A 2OTMA 2CHTA 3G6EF 3VO8A 3TD3A 3VMFB 2ALEA 4O2BB 3B6NA 4F6RB 3PAFA 4I55B 5HXUA 3SIVA 2PMPA 3WJRA 3CCMF 3MCAB 5LXTB 3FD6A 4HNAA 1S72F 3GYQA 3GHZA 5CB4A 2CSLA 3S02A 1VQPF 1W5AA 3I3FA 5FNVB 3RYHA 4E6EA 2AMTA 5MN6A 2I6RA 4TUYB 1U40A 3NVKE 3HKDB 5GONA 3NMUC 3K0TA 4NUTA 4B45A 1Q7YH 1YHQF 3IR9A 5HP7A 2Z1UA 3Q8HA 1XV2A 4C81A 1QVGF 3OBWA 3ELCA 1X25A 1VQVA 4I4TB 3FPIA 3HKCA 3WGJA 4YJ3A 4TV9A 3CCQF 4G88A 3JARB 1VQ8F 5HXZA 5EO3A 2VGNA 1W5FA 5LYJA 4G4VA 1IV4A 2UYNA 2RHHA 1TVKA 5IJ9B 4EI7A 1W5BA 4X1YB 4C8GA 3J7AR 3VI6A 1OFUA 1W5EA 3NK6A 2KG4A 5CA0B 1K8AH 3BYQA 4LNUA 3WXMB 4YJ2A 1IV3A 4O4LB 3JASB 4IHJA 3RYCB 5J2TB 5GIOC 1GZ0A 4EB6A 3CD6F 3F0DA 1KC8H 2BTQB 2JNBA 1JJ2F 3N2KA 1YITF 2L26A 2QA4F 3C9RA 3CPQA 1ODEA 4BT6A 3IEWA 1N8RH 1M90H 1GO0A 3G71F 4G4WA 2LCAA 3MQWA 3UT5A 3JAWB 1SZQA 4X20B 1VH8A 4BT2A 3CCEF 5GONB 5G4UC 2MQEA 4X1KA 2UYJA 2H8CA 4RQOA 5GANK 3EORA 3O85A 3S03A 1RA4A 1XHOA 3OW2F 2CVLA 4BY9D 4R40B 2CW4A 5EB1B 5FLXM 1YJ9F 3HKBB 3LFOA 3S0WA 5KX5A 2H8EA 2B33A 3S06A 1NJIH 2ZVYA 3QTYA 3N2GA 3D00A 5FJ4C 2QEXF 3U0OA 1X7PA 2UYNB 4FFBA 1TVKB 5LP6A 3S0HA 4ZHQA 1X52A 5EIBD 5BMVA 3ZP7A 3LWQC 2IQQA 4NQ3A 2ZAUA 5EZYB 2YYEA 3TD5A 3C9UA 1IV1A 5LOVA 3JALB 2ZVZA 3P4EA 4O4IB 1X7OA 3ON1A 5AVMA 5JH7A 3PLAC 4O4HA 4YJ2B 3VTIC 1W42A 5LA6A 2IAFA 4IHJB 4X3LA 3CMEF 5EAZA 4EB6B 2DT4A 4B46A 1NQ3A 3E22B 5HY2A 2QI2A 4I50B 1GX1A 3P10A
chains in the Genus database with same CATH topology
2K1SA 3IMPA 2ZF8A 4PWTA 2LBTA 4B5CA 4ZHYB 4ZHWA 2MQEA 3CYQA 1R1MA 3TD5A 1OAPA 4G4ZA 4RHAA 3CYPB 2ZVZA 3OONA 3S02A 2KGWA 3S03A 4G88A 3WPXA 3S0YA 4G4XA 4B62A 4R40B 2AIZP 5EB1B 5EAZA 2ZOVA 4G4YA 4G4VA 3S0WA 3S06A 2L26A 2ZVYA 5EB0A 2W8BC 3LDTA 3TD3A 3TD4A 4G4WA 3WPWA 2N48A 4ERHA 2LCAA 2HQSC 3KHNA 4ZHVA 3S0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1S A;  3IMP A;  2ZF8 A;  4PWT A;  2LBT A;  4B5C A;  4ZHY B;  4ZHW A;  2MQE A;  3CYQ A;  1R1M A;  3TD5 A;  1OAP A;  4G4Z A;  4RHA A;  3CYP B;  2ZVZ A;  3OON A;  3S02 A;  2KGW A;  3S03 A;  4G88 A;  3WPX A;  3S0Y A;  4G4X A;  4B62 A;  4R40 B;  2AIZ P;  5EB1 B;  5EAZ A;  2ZOV A;  4G4Y A;  4G4V A;  3S0W A;  3S06 A;  2L26 A;  2ZVY A;  5EB0 A;  2W8B C;  3LDT A;  3TD3 A;  3TD4 A;  4G4W A;  3WPW A;  2N48 A;  4ERH A;  2LCA A;  2HQS C;  3KHN A;  4ZHV A;  3S0H A; 
#chains in the Genus database with same CATH topology
 2RHO A;  3VYU C;  2VAW A;  3CCV F;  1VQO F;  5HY1 A;  4KWE A;  3CCJ F;  4DRX B;  2VGM A;  5J2U A;  1KNK A;  1VQ5 F;  1UI9 A;  3S0Y A;  3HKE A;  1FFX A;  4X1I A;  3GTZ A;  1IPA A;  1SDS A;  1JFF B;  1CLI A;  4C8E A;  1CN7 A;  1UFY A;  2VXY A;  3M4S A;  3I7T A;  3RE3 A;  5KX5 B;  1VQ7 F;  1J7H A;  1VQL F;  2BTU A;  3KHN A;  3N2G B;  5JCO C;  1RLG A;  1CK2 A;  1TUB A;  4TV8 A;  3AGK A;  4O2A A;  5BMV B;  5EYP A;  3HAX D;  3JAK A;  4IIJ A;  1VQ6 F;  5JQG B;  2R75 1;  4X3M A;  4M8I A;  3RYI B;  1DBF A;  3ESJ A;  4O4H B;  2H6L A;  3N4Z A;  5JH7 B;  1VQ9 F;  5CA1 A;  4ZOL A;  1DT9 A;  1RQ2 A;  4U3J A;  4ERH A;  3LWP C;  2PHN A;  3CC4 F;  3D54 A;  2K1S A;  3D01 A;  5KMG A;  2OTJ F;  2LBX A;  3J80 M;  3HTN A;  3CYP B;  5EIB C;  4ZI7 A;  4EI8 A;  3VYT C;  3FFM A;  3RA5 A;  4BT4 A;  2GZL A;  1M1K H;  5J2U B;  4HNA B;  2Q1Y A;  2EWC A;  5CB4 B;  5MN5 A;  3F0E A;  3HKE B;  4X1I B;  3NK7 A;  5B8F A;  1VQ4 F;  4XCQ A;  4BT5 A;  5JVD A;  3CCU F;  3RYF A;  2N48 A;  3IKF A;  3RYH B;  3VCZ A;  4DXD A;  1H7M A;  4BVT A;  4B5C A;  4ZHY B;  2HX0 A;  1U3L A;  3JAM M;  1KNJ A;  2Z01 A;  2GVI A;  2IG8 A;  4BT3 A;  2BO1 A;  2HP0 A;  4C82 A;  1Q8R A;  2LBW A;  1QD9 A;  1U3P A;  4NWO B;  3IEQ A;  5EYP B;  3JAK B;  1H48 A;  3HKC B;  2AIF A;  3LYB A;  4TV9 B;  4YJ3 B;  1YJW F;  3CC7 F;  5ITZ A;  3J81 M;  1W2B F;  1NMU B;  3WGL A;  4C4W C;  4I55 A;  1ONI A;  3SIU A;  1Z5V A;  3M1X A;  5CA1 B;  4ZOL B;  5LYJ B;  3I56 F;  1Q86 H;  2KTV A;  1W57 A;  3ZOP A;  1W55 A;  5LXT A;  3OBY A;  2LBT A;  2ZF8 A;  2V9Y A;  3CB2 A;  5HP8 A;  4BVS A;  4RHA A;  2OHW A;  3MDO A;  1W3E X;  5FNV A;  5KMG B;  4O4J A;  3VYS C;  4LNU B;  1FNJ A;  1YQN A;  3DC2 A;  3K14 A;  2AIZ P;  1KD1 H;  1IV2 A;  2WAL A;  1YJN F;  3WGM A;  2CZW A;  2HRY A;  3C8L A;  3ZP4 A;  5GIP C;  3N2K B;  2OZB A;  3IKE A;  3T80 A;  4BVQ A;  3FBA A;  3WPW A;  5JVD B;  2Q1X A;  3L7Q A;  4WBN A;  2CWJ A;  1KQS F;  3CG6 A;  4I4T A;  4C8I A;  2OTL F;  2VAM A;  3JAR A;  3UT5 B;  3CC2 F;  5IYZ A;  3E20 B;  1Z5W A;  3QUW A;  4TZZ A;  1RQ7 A;  1YIJ F;  3WGN A;  4X1K B;  2P6Y A;  4B62 A;  1U43 A;  5IJ9 A;  5HY0 A;  4X1Y A;  3KJJ A;  2UZH A;  3F0F A;  4ZK7 A;  5EB0 A;  2F9Z C;  2ZOD A;  3CXC F;  5HY4 A;  5ITZ B;  5CA0 A;  1ZWZ A;  2HVY D;  3IMP A;  1YI2 F;  1W58 1;  4O4L A;  3LWO C;  5C8Y A;  3JAS A;  1JY8 A;  4FFB B;  3RYC A;  5J2T A;  5LP6 B;  1RLU A;  1OAP A;  3CMA F;  4G4Z A;  1Q81 H;  4ZHQ B;  5A2Q M;  2I6D A;  3F0G A;  3WGK A;  5LOV B;  3JCM M;  4O4J B;  3VOA A;  4BVR A;  4G4Y A;  1K9M H;  5JCO A;  2KTU A;  3MBM A;  3P0Z A;  1VQM F;  2NMU A;  3JAT A;  3E1Y A;  3NVI B;  2W8B C;  5LA6 B;  4EI9 A;  5DCV A;  3JAW A;  2R6R 1;  4X20 A;  1VQK F;  3N4Y A;  1GO1 A;  2HQS C;  3V7Q A;  3ERN A;  4PWT A;  1QAH A;  1SA0 A;  3CYQ A;  2Z1E A;  4WBN B;  2HP3 A;  1E7K A;  1VHA A;  4U39 A;  1COM A;  1W40 A;  2DYY A;  3HKB A;  1YGY A;  5IYZ B;  2YXZ A;  4G4X A;  3MCQ A;  3WJP A;  3G4S F;  1Q82 H;  3VIU A;  2G9I A;  1FFX B;  1JN1 A;  1FSZ A;  5EZY A;  5IJ0 A;  3QHD A;  3JAL A;  2HRU A;  4O4I A;  4ZHW A;  1JD1 A;  1R1M A;  2RB9 A;  2UYK A;  3RA6 A;  5HWE A;  2BTO A;  2HS4 A;  3LWV C;  5C8Y B;  1TUB B;  3K2X A;  4TV8 B;  3DDN A;  4LCK A;  3WPX A;  4O2A B;  2HS3 A;  1T0A A;  3HWU A;  1W59 A;  4IIJ B;  3V7E A;  2ZOV A;  3E22 A;  3CCL F;  2FC3 A;  4I50 A;  3LDT A;  4O2B A;  5MN4 A;  4F6R A;  1VK3 A;  3V4D A;  3TD4 A;  3WJQ A;  1PF5 A;  3JAT B;  3CCS F;  1T0K B;  1PXW A;  1W41 A;  2UYP A;  4DRX A;  3C9T A;  3C9S A;  2FGY A;  2RHJ A;  3KIZ A;  3CCR F;  2GLZ A;  3KE1 A;  4U3J B;  2VAP A;  1FNK A;  1XRG A;  2Z1T A;  3M84 A;  3ZO8 A;  1SA0 B;  1XBI A;  5LP6 C;  3HJW C;  5IT9 M;  1JFF A;  3CPW F;  2KGW A;  1K73 H;  3LME A;  4ZI7 B;  2RHL A;  3KJK A;  4TUY A;  5GAP K;  3JVH A;  2QTP A;  3HKD A;  5EWR A;  3LWR C;  5G4V C;  4ZHV A;  4BW0 B;  3RYF B;  5IJ0 B;  3VOB A;  1QU9 A;  5JQG A;  3K12 A;  3R0P A;  2CHS A;  1H47 A;  3OON A;  3I55 F;  3RYI A;  3V3T A;  3FD5 A;  2Z1F A;  2HP0 B;  1VQN F;  1QVF F;  5GIN C;  3F6M A;  4BT7 A;  2HS0 A;  2OTM A;  2CHT A;  3G6E F;  3VO8 A;  3TD3 A;  3VMF B;  2ALE A;  4O2B B;  3B6N A;  4F6R B;  3PAF A;  4I55 B;  5HXU A;  3SIV A;  2PMP A;  3WJR A;  3CCM F;  3MCA B;  5LXT B;  3FD6 A;  4HNA A;  1S72 F;  3GYQ A;  3GHZ A;  5CB4 A;  2CSL A;  3S02 A;  1VQP F;  1W5A A;  3I3F A;  5FNV B;  3RYH A;  4E6E A;  2AMT A;  5MN6 A;  2I6R A;  4TUY B;  1U40 A;  3NVK E;  3HKD B;  5GON A;  3NMU C;  3K0T A;  4NUT A;  4B45 A;  1Q7Y H;  1YHQ F;  3IR9 A;  5HP7 A;  2Z1U A;  3Q8H A;  1XV2 A;  4C81 A;  1QVG F;  3OBW A;  3ELC A;  1X25 A;  1VQV A;  4I4T B;  3FPI A;  3HKC A;  3WGJ A;  4YJ3 A;  4TV9 A;  3CCQ F;  4G88 A;  3JAR B;  1VQ8 F;  5HXZ A;  5EO3 A;  2VGN A;  1W5F A;  5LYJ A;  4G4V A;  1IV4 A;  2UYN A;  2RHH A;  1TVK A;  5IJ9 B;  4EI7 A;  1W5B A;  4X1Y B;  4C8G A;  3J7A R;  3VI6 A;  1OFU A;  1W5E A;  3NK6 A;  2KG4 A;  5CA0 B;  1K8A H;  3BYQ A;  4LNU A;  3WXM B;  4YJ2 A;  1IV3 A;  4O4L B;  3JAS B;  4IHJ A;  3RYC B;  5J2T B;  5GIO C;  1GZ0 A;  4EB6 A;  3CD6 F;  3F0D A;  1KC8 H;  2BTQ B;  2JNB A;  1JJ2 F;  3N2K A;  1YIT F;  2L26 A;  2QA4 F;  3C9R A;  3CPQ A;  1ODE A;  4BT6 A;  3IEW A;  1N8R H;  1M90 H;  1GO0 A;  3G71 F;  4G4W A;  2LCA A;  3MQW A;  3UT5 A;  3JAW B;  1SZQ A;  4X20 B;  1VH8 A;  4BT2 A;  3CCE F;  5GON B;  5G4U C;  2MQE A;  4X1K A;  2UYJ A;  2H8C A;  4RQO A;  5GAN K;  3EOR A;  3O85 A;  3S03 A;  1RA4 A;  1XHO A;  3OW2 F;  2CVL A;  4BY9 D;  4R40 B;  2CW4 A;  5EB1 B;  5FLX M;  1YJ9 F;  3HKB B;  3LFO A;  3S0W A;  5KX5 A;  2H8E A;  2B33 A;  3S06 A;  1NJI H;  2ZVY A;  3QTY A;  3N2G A;  3D00 A;  5FJ4 C;  2QEX F;  3U0O A;  1X7P A;  2UYN B;  4FFB A;  1TVK B;  5LP6 A;  3S0H A;  4ZHQ A;  1X52 A;  5EIB D;  5BMV A;  3ZP7 A;  3LWQ C;  2IQQ A;  4NQ3 A;  2ZAU A;  5EZY B;  2YYE A;  3TD5 A;  3C9U A;  1IV1 A;  5LOV A;  3JAL B;  2ZVZ A;  3P4E A;  4O4I B;  1X7O A;  3ON1 A;  5AVM A;  5JH7 A;  3PLA C;  4O4H A;  4YJ2 B;  3VTI C;  1W42 A;  5LA6 A;  2IAF A;  4IHJ B;  4X3L A;  3CME F;  5EAZ A;  4EB6 B;  2DT4 A;  4B46 A;  1NQ3 A;  3E22 B;  5HY2 A;  2QI2 A;  4I50 B;  1GX1 A;  3P10 A; 
#chains in the Genus database with same CATH homology
 2K1S A;  3IMP A;  2ZF8 A;  4PWT A;  2LBT A;  4B5C A;  4ZHY B;  4ZHW A;  2MQE A;  3CYQ A;  1R1M A;  3TD5 A;  1OAP A;  4G4Z A;  4RHA A;  3CYP B;  2ZVZ A;  3OON A;  3S02 A;  2KGW A;  3S03 A;  4G88 A;  3WPX A;  3S0Y A;  4G4X A;  4B62 A;  4R40 B;  2AIZ P;  5EB1 B;  5EAZ A;  2ZOV A;  4G4Y A;  4G4V A;  3S0W A;  3S06 A;  2L26 A;  2ZVY A;  5EB0 A;  2W8B C;  3LDT A;  3TD3 A;  3TD4 A;  4G4W A;  3WPW A;  2N48 A;  4ERH A;  2LCA A;  2HQS C;  3KHN A;  4ZHV A;  3S0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...