2MQEA

Solution structure of escherichia coli outer membrane protein a c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
b'APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OmpA domain protein transmembrane region-containing protein
molecule tags Membrane protein
source organism Escherichia coli
publication title The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition.
pubmed doi rcsb
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2mqeA00
2K1SA 2L26A 2W8BC 5EAZA 3TD3A 3S03A 4RHAA 2ZVYA 2LBTA 4B5CA 4ZHVA 4G4WA 3S0WA 1OAPA 3TD4A 3S0YA 3WPXA 3CYQA 2AIZP 4G4ZA 5EB0A 3IMPA 2ZF8A 3OONA 4G88A 5EB1B 4ZHYB 4PWTA 3KHNA 4G4XA 2N48A 3WPWA 2LCAA 4ZHWA 2MQEA 4R40B 4B62A 4ERHA 3TD5A 2ZOVA 2HQSC 3CYPB 1R1MA 3S0HA 3S02A 4G4YA 3S06A 3LDTA 2KGWA 4G4VA 2ZVZA
chains in the Genus database with same CATH superfamily
1UI9A 3VYTC 4F6RB 3V4DA 5LYJB 4O4JB 1Z5WA 3RYCB 1VQ4F 1H7MA 5EYPB 1PF5A 5FNVA 3WJQA 1VQLF 3LWVC 3CCMF 2OZBA 3HKDB 5LOVA 3UT5B 3JATB 1U40A 1DT9A 1VH8A 3RYIB 3CMAF 3JARB 4ZOLA 4DRXA 5BMVA 3LDTA 4EI9A 3D01A 3GTZA 3PLAC 2OTMA 3HKCB 3CCVF 4I4TB 5GAPK 3HKBA 3LMEA 3WGJA 5JVDB 3MCAB 3I7TA 1W40A 3J7AR 2HRYA 2Q1YA 2JNBA 2UZHA 1GO0A 2HP0B 2Z01A 1KQSF 3GYQA 3CCEF 3CXCF 4ERHA 3CCRF 4X3MA 4FFBA 3BYQA 3NK6A 3WGNA 5J2TA 4I55A 1X7PA 2UYNB 2H8CA 3F0DA 3V3TA 1IV3A 4O2AB 2B33A 3S03A 3B6NA 1Z5VA 4DXDA 2CWJA 1U3PA 5JH7A 3I3FA 5G4UC 3C9TA 3WGLA 1OAPA 1W42A 3CYQA 3PAFA 5HY1A 3JATA 5EB0A 2FGYA 3CC2F 2AMTA 4I50B 2RHOA 2VAPA 5IYZB 4EI7A 1FSZA 1K8AH 1RLUA 3IKEA 1W3EX 3C9RA 3QTYA 2QI2A 1YJNF 5MN6A 1VQVA 3HKEB 1PXWA 2VXYA 2UYPA 3N4YA 1YJWF 3TD3A 2L26A 1N8RH 1VQ8F 4ZHQB 5ITZB 1W5EA 3VI6A 3JAMM 1YGYA 1SDSA 2HP0A 3TD4A 2BTOA 2F9ZC 3RYHB 1CLIA 4C8GA 4X1KB 2FC3A 1XHOA 2N48A 5LP6B 3DC2A 1JJ2F 4O2AA 3NMUC 4O2BA 2VAMA 3QUWA 1YIJF 1XV2A 4IHJB 3OW2F 5IJ9A 5HY2A 1VQKF 2R751 4O4LA 5CA0B 5JH7B 2LBXA 3CCUF 3CC4F 2ZAUA 1W5BA 2KG4A 2HRUA 3E22B 3F6MA 4G4WA 5EIBC 5CA1A 5HWEA 2HS4A 1X52A 5IT9M 2AIZP 4G4ZA 3FBAA 3V7QA 4ZHYB 4PWTA 5JQGA 1VQ5F 1M90H 2GZLA 4C81A 2MQEA 3ZOPA 1X7OA 4F6RA 3E20B 5ITZA 1R1MA 1JY8A 4RQOA 3SIVA 1W57A 4IIJB 3VO8A 3CCJF 5HY4A 2VAWA 1W2BF 5EYPA 3VTIC 2IG8A 1TVKA 3K14A 5DCVA 3KE1A 1QVFF 3F0FA 3WJRA 1RQ7A 4YJ3A 5LXTB 1T0AA 4ZI7A 5CB4B 1FFXB 2CVLA 4IHJA 4X20B 3WPWA 2NMUA 4O4LB 1W5AA 3JARA 4DRXB 4BVTA 4B62A 2PMPA 3CMEF 3S0HA 1IV1A 2HS3A 3CCQF 1JFFA 5JVDA 1CN7A 3LYBA 1U43A 4U3JA 3T80A 1UFYA 2GLZA 4M8IA 1QAHA 4ZOLB 3FFMA 3N2GB 4WBNB 4TV9B 2DYYA 5C8YA 3JAWB 2ZF8A 4EI8A 3KHNA 2AIFA 4X1YB 4TZZA 5EZYB 4EB6B 5HY0A 2CSLA 2Z1TA 3O85A 5JCOC 1SA0B 1W5FA 3N2KB 4X1IA 5GONB 5GIPC 2ZVYA 5J2TB 4ZHVA 3CCSF 4C4WC 1ONIA 2WALA 2CHTA 1YHQF 2PHNA 3JAKA 3JALA 3WPXA 3ESJA 2HVYD 3MDOA 2P6YA 1QVGF 1VQ9F 3LWQC 4HNAA 3J80M 2LCAA 4C82A 2VGMA 4TV8A 3JVHA 4BT2A 2YYEA 1Q8RA 3JCMM 5HP8A 1TUBB 2HQSC 4YJ2A 4I50A 3S02A 3WGKA 4O4JA 3KIZA 4O4IA 2QA4F 2QTPA 5KMGA 5J2UB 1Q82H 3HKEA 4NQ3A 3WJPA 1K9MH 3LFOA 3KJKA 4B45A 4TUYB 1K73H 3N4ZA 2BTQB 3I55F 3G6EF 3CPQA 5EIBD 5BMVB 2OTJF 3IKFA 1GZ0A 1M1KH 5KX5B 3ELCA 2H8EA 3J81M 1ZWZA 3LWRC 3HKDA 1Q86H 1U3LA 4BVRA 2W8BC 2RHJA 3E1YA 3HTNA 2LBTA 3I56F 2OTLF 1IPAA 4LNUB 4B5CA 1GX1A 3ON1A 5IJ0A 5JQGB 2ZODA 1Q7YH 3K2XA 3HKCA 3AGKA 3HJWC 4FFBB 5HXUA 2I6DA 3IEWA 3NVKE 1XRGA 2OHWA 5GIOC 4IIJA 3CB2A 2Z1UA 2RHHA 1JD1A 3RYFA 3R0PA 4O4IB 3ZP4A 3V7EA 1IV4A 1Q81H 3CC7F 3CYPB 1FNKA 4G4YA 2KGWA 3IEQA 5HXZA 2K1SA 1VQPF 3ERNA 2RB9A 1T0KB 2HS0A 3MQWA 4BT3A 4O4HA 4X20A 3HAXD 3U0OA 4E6EA 4NWOB 1OFUA 3S0YA 5LA6A 3M4SA 2LBWA 3CG6A 3GHZA 4LCKA 1RLGA 4X3LA 4C8IA 5LP6C 1JFFB 3M84A 1VQNF 1FFXA 3TD5A 2I6RA 4KWEA 3C9UA 5IYZA 3RYCA 3WXMB 4BVSA 3NK7A 3JAWA 3M1XA 5EAZA 3P10A 3JASA 5G4VC 5JCOA 2IAFA 2Q1XA 5LOVB 4O2BB 4U3JB 3K12A 3VIUA 2Z1FA 5LYJA 4WBNA 2UYJA 1SA0A 3N2KA 3ZP7A 1VHAA 5MN5A 3RYHA 2HP3A 4NUTA 5FNVB 4I4TA 4X1KA 3OBYA 2KTUA 3VMFB 2EWCA 5A2QM 4X1YA 1W59A 5EZYA 2VGNA 3UT5A 1DBFA 1VK3A 5LA6B 3L7QA 5IJ9B 2V9YA 3KJJA 5FJ4C 4HNAB 5GONA 3F0EA 3G4SF 3VCZA 1J7HA 3LWPC 5EWRA 1X25A 3IMPA 3E22A 1W581 1XBIA 4I55B 4C8EA 2GVIA 4BT6A 4BY9D 3Q8HA 1YITF 2CHSA 4R40B 2DT4A 1YQNA 3VOAA 5HP7A 5MN4A 4RHAA 3FPIA 3WGMA 4YJ2B 3P0ZA 4TUYA 2R6R1 5EO3A 2UYNA 4BT7A 1ODEA 3S0WA 3C9SA 1VQ6F 5GINC 5KMGB 1TVKB 1S72F 5J2UA 5KX5A 4U39A 3ZO8A 5EB1B 3QHDA 1YJ9F 5LXTA 1KC8H 4ZI7B 5CB4A 5GANK 2RHLA 3CCLF 3OBWA 4LNUA 2YXZA 3C8LA 3VOBA 4G4VA 2ZVZA 2KTVA 1KNJA 3RA5A 3SIUA 2QEXF 1KD1H 3VYUC 3VYSC 1NJIH 1W41A 1VQ7F 2G9IA 5B8FA 2BTUA 4ZHQA 2IQQA 4G88A 3D54A 2HX0A 3F0GA 5IJ0B 1RA4A 3N2GA 3G71F 2CW4A 3DDNA 2BO1A 4TV9A 5C8YB 1JN1A 1RQ2A 3D00A 4X1IB 5AVMA 1NQ3A 1CK2A 4ZHWA 3CPWF 1COMA 3RE3A 3NVIB 3IR9A 2ZOVA 1YI2F 2H6LA 5LP6A 3S06A 4EB6A 1GO1A 3MBMA 1IV2A 1H48A 3RYFB 3FD5A 3JAKB 3LWOC 3CD6F 4BT4A 2Z1EA 3RA6A 4ZK7A 3K0TA 3RYIA 1SZQA 3EORA 5CA0A 3FD6A 4TV8B 4XCQA 1VQMF 3HKBB 3OONA 1TUBA 4BW0B 4O4HB 2CZWA 3HWUA 4G4XA 5FLXM 1H47A 2ALEA 4BT5A 1NMUB 5CA1B 3JALB 1KNKA 4B46A 1VQOF 3P4EA 1FNJA 4BVQA 2UYKA 1QD9A 1QU9A 3MCQA 1E7KA 3JASB 1W55A 4YJ3B
chains in the Genus database with same CATH topology
2K1SA 2L26A 2W8BC 5EAZA 3TD3A 3S03A 4RHAA 2ZVYA 2LBTA 4B5CA 4ZHVA 4G4WA 3S0WA 1OAPA 3TD4A 3S0YA 3WPXA 3CYQA 2AIZP 4G4ZA 5EB0A 3IMPA 2ZF8A 3OONA 4G88A 5EB1B 4ZHYB 4PWTA 3KHNA 4G4XA 2N48A 3WPWA 2LCAA 4ZHWA 2MQEA 4R40B 4B62A 4ERHA 3TD5A 2ZOVA 2HQSC 3CYPB 1R1MA 3S0HA 3S02A 4G4YA 3S06A 3LDTA 2KGWA 4G4VA 2ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1S A;  2L26 A;  2W8B C;  5EAZ A;  3TD3 A;  3S03 A;  4RHA A;  2ZVY A;  2LBT A;  4B5C A;  4ZHV A;  4G4W A;  3S0W A;  1OAP A;  3TD4 A;  3S0Y A;  3WPX A;  3CYQ A;  2AIZ P;  4G4Z A;  5EB0 A;  3IMP A;  2ZF8 A;  3OON A;  4G88 A;  5EB1 B;  4ZHY B;  4PWT A;  3KHN A;  4G4X A;  2N48 A;  3WPW A;  2LCA A;  4ZHW A;  2MQE A;  4R40 B;  4B62 A;  4ERH A;  3TD5 A;  2ZOV A;  2HQS C;  3CYP B;  1R1M A;  3S0H A;  3S02 A;  4G4Y A;  3S06 A;  3LDT A;  2KGW A;  4G4V A;  2ZVZ A; 
#chains in the Genus database with same CATH topology
 1UI9 A;  3VYT C;  4F6R B;  3V4D A;  5LYJ B;  4O4J B;  1Z5W A;  3RYC B;  1VQ4 F;  1H7M A;  5EYP B;  1PF5 A;  5FNV A;  3WJQ A;  1VQL F;  3LWV C;  3CCM F;  2OZB A;  3HKD B;  5LOV A;  3UT5 B;  3JAT B;  1U40 A;  1DT9 A;  1VH8 A;  3RYI B;  3CMA F;  3JAR B;  4ZOL A;  4DRX A;  5BMV A;  3LDT A;  4EI9 A;  3D01 A;  3GTZ A;  3PLA C;  2OTM A;  3HKC B;  3CCV F;  4I4T B;  5GAP K;  3HKB A;  3LME A;  3WGJ A;  5JVD B;  3MCA B;  3I7T A;  1W40 A;  3J7A R;  2HRY A;  2Q1Y A;  2JNB A;  2UZH A;  1GO0 A;  2HP0 B;  2Z01 A;  1KQS F;  3GYQ A;  3CCE F;  3CXC F;  4ERH A;  3CCR F;  4X3M A;  4FFB A;  3BYQ A;  3NK6 A;  3WGN A;  5J2T A;  4I55 A;  1X7P A;  2UYN B;  2H8C A;  3F0D A;  3V3T A;  1IV3 A;  4O2A B;  2B33 A;  3S03 A;  3B6N A;  1Z5V A;  4DXD A;  2CWJ A;  1U3P A;  5JH7 A;  3I3F A;  5G4U C;  3C9T A;  3WGL A;  1OAP A;  1W42 A;  3CYQ A;  3PAF A;  5HY1 A;  3JAT A;  5EB0 A;  2FGY A;  3CC2 F;  2AMT A;  4I50 B;  2RHO A;  2VAP A;  5IYZ B;  4EI7 A;  1FSZ A;  1K8A H;  1RLU A;  3IKE A;  1W3E X;  3C9R A;  3QTY A;  2QI2 A;  1YJN F;  5MN6 A;  1VQV A;  3HKE B;  1PXW A;  2VXY A;  2UYP A;  3N4Y A;  1YJW F;  3TD3 A;  2L26 A;  1N8R H;  1VQ8 F;  4ZHQ B;  5ITZ B;  1W5E A;  3VI6 A;  3JAM M;  1YGY A;  1SDS A;  2HP0 A;  3TD4 A;  2BTO A;  2F9Z C;  3RYH B;  1CLI A;  4C8G A;  4X1K B;  2FC3 A;  1XHO A;  2N48 A;  5LP6 B;  3DC2 A;  1JJ2 F;  4O2A A;  3NMU C;  4O2B A;  2VAM A;  3QUW A;  1YIJ F;  1XV2 A;  4IHJ B;  3OW2 F;  5IJ9 A;  5HY2 A;  1VQK F;  2R75 1;  4O4L A;  5CA0 B;  5JH7 B;  2LBX A;  3CCU F;  3CC4 F;  2ZAU A;  1W5B A;  2KG4 A;  2HRU A;  3E22 B;  3F6M A;  4G4W A;  5EIB C;  5CA1 A;  5HWE A;  2HS4 A;  1X52 A;  5IT9 M;  2AIZ P;  4G4Z A;  3FBA A;  3V7Q A;  4ZHY B;  4PWT A;  5JQG A;  1VQ5 F;  1M90 H;  2GZL A;  4C81 A;  2MQE A;  3ZOP A;  1X7O A;  4F6R A;  3E20 B;  5ITZ A;  1R1M A;  1JY8 A;  4RQO A;  3SIV A;  1W57 A;  4IIJ B;  3VO8 A;  3CCJ F;  5HY4 A;  2VAW A;  1W2B F;  5EYP A;  3VTI C;  2IG8 A;  1TVK A;  3K14 A;  5DCV A;  3KE1 A;  1QVF F;  3F0F A;  3WJR A;  1RQ7 A;  4YJ3 A;  5LXT B;  1T0A A;  4ZI7 A;  5CB4 B;  1FFX B;  2CVL A;  4IHJ A;  4X20 B;  3WPW A;  2NMU A;  4O4L B;  1W5A A;  3JAR A;  4DRX B;  4BVT A;  4B62 A;  2PMP A;  3CME F;  3S0H A;  1IV1 A;  2HS3 A;  3CCQ F;  1JFF A;  5JVD A;  1CN7 A;  3LYB A;  1U43 A;  4U3J A;  3T80 A;  1UFY A;  2GLZ A;  4M8I A;  1QAH A;  4ZOL B;  3FFM A;  3N2G B;  4WBN B;  4TV9 B;  2DYY A;  5C8Y A;  3JAW B;  2ZF8 A;  4EI8 A;  3KHN A;  2AIF A;  4X1Y B;  4TZZ A;  5EZY B;  4EB6 B;  5HY0 A;  2CSL A;  2Z1T A;  3O85 A;  5JCO C;  1SA0 B;  1W5F A;  3N2K B;  4X1I A;  5GON B;  5GIP C;  2ZVY A;  5J2T B;  4ZHV A;  3CCS F;  4C4W C;  1ONI A;  2WAL A;  2CHT A;  1YHQ F;  2PHN A;  3JAK A;  3JAL A;  3WPX A;  3ESJ A;  2HVY D;  3MDO A;  2P6Y A;  1QVG F;  1VQ9 F;  3LWQ C;  4HNA A;  3J80 M;  2LCA A;  4C82 A;  2VGM A;  4TV8 A;  3JVH A;  4BT2 A;  2YYE A;  1Q8R A;  3JCM M;  5HP8 A;  1TUB B;  2HQS C;  4YJ2 A;  4I50 A;  3S02 A;  3WGK A;  4O4J A;  3KIZ A;  4O4I A;  2QA4 F;  2QTP A;  5KMG A;  5J2U B;  1Q82 H;  3HKE A;  4NQ3 A;  3WJP A;  1K9M H;  3LFO A;  3KJK A;  4B45 A;  4TUY B;  1K73 H;  3N4Z A;  2BTQ B;  3I55 F;  3G6E F;  3CPQ A;  5EIB D;  5BMV B;  2OTJ F;  3IKF A;  1GZ0 A;  1M1K H;  5KX5 B;  3ELC A;  2H8E A;  3J81 M;  1ZWZ A;  3LWR C;  3HKD A;  1Q86 H;  1U3L A;  4BVR A;  2W8B C;  2RHJ A;  3E1Y A;  3HTN A;  2LBT A;  3I56 F;  2OTL F;  1IPA A;  4LNU B;  4B5C A;  1GX1 A;  3ON1 A;  5IJ0 A;  5JQG B;  2ZOD A;  1Q7Y H;  3K2X A;  3HKC A;  3AGK A;  3HJW C;  4FFB B;  5HXU A;  2I6D A;  3IEW A;  3NVK E;  1XRG A;  2OHW A;  5GIO C;  4IIJ A;  3CB2 A;  2Z1U A;  2RHH A;  1JD1 A;  3RYF A;  3R0P A;  4O4I B;  3ZP4 A;  3V7E A;  1IV4 A;  1Q81 H;  3CC7 F;  3CYP B;  1FNK A;  4G4Y A;  2KGW A;  3IEQ A;  5HXZ A;  2K1S A;  1VQP F;  3ERN A;  2RB9 A;  1T0K B;  2HS0 A;  3MQW A;  4BT3 A;  4O4H A;  4X20 A;  3HAX D;  3U0O A;  4E6E A;  4NWO B;  1OFU A;  3S0Y A;  5LA6 A;  3M4S A;  2LBW A;  3CG6 A;  3GHZ A;  4LCK A;  1RLG A;  4X3L A;  4C8I A;  5LP6 C;  1JFF B;  3M84 A;  1VQN F;  1FFX A;  3TD5 A;  2I6R A;  4KWE A;  3C9U A;  5IYZ A;  3RYC A;  3WXM B;  4BVS A;  3NK7 A;  3JAW A;  3M1X A;  5EAZ A;  3P10 A;  3JAS A;  5G4V C;  5JCO A;  2IAF A;  2Q1X A;  5LOV B;  4O2B B;  4U3J B;  3K12 A;  3VIU A;  2Z1F A;  5LYJ A;  4WBN A;  2UYJ A;  1SA0 A;  3N2K A;  3ZP7 A;  1VHA A;  5MN5 A;  3RYH A;  2HP3 A;  4NUT A;  5FNV B;  4I4T A;  4X1K A;  3OBY A;  2KTU A;  3VMF B;  2EWC A;  5A2Q M;  4X1Y A;  1W59 A;  5EZY A;  2VGN A;  3UT5 A;  1DBF A;  1VK3 A;  5LA6 B;  3L7Q A;  5IJ9 B;  2V9Y A;  3KJJ A;  5FJ4 C;  4HNA B;  5GON A;  3F0E A;  3G4S F;  3VCZ A;  1J7H A;  3LWP C;  5EWR A;  1X25 A;  3IMP A;  3E22 A;  1W58 1;  1XBI A;  4I55 B;  4C8E A;  2GVI A;  4BT6 A;  4BY9 D;  3Q8H A;  1YIT F;  2CHS A;  4R40 B;  2DT4 A;  1YQN A;  3VOA A;  5HP7 A;  5MN4 A;  4RHA A;  3FPI A;  3WGM A;  4YJ2 B;  3P0Z A;  4TUY A;  2R6R 1;  5EO3 A;  2UYN A;  4BT7 A;  1ODE A;  3S0W A;  3C9S A;  1VQ6 F;  5GIN C;  5KMG B;  1TVK B;  1S72 F;  5J2U A;  5KX5 A;  4U39 A;  3ZO8 A;  5EB1 B;  3QHD A;  1YJ9 F;  5LXT A;  1KC8 H;  4ZI7 B;  5CB4 A;  5GAN K;  2RHL A;  3CCL F;  3OBW A;  4LNU A;  2YXZ A;  3C8L A;  3VOB A;  4G4V A;  2ZVZ A;  2KTV A;  1KNJ A;  3RA5 A;  3SIU A;  2QEX F;  1KD1 H;  3VYU C;  3VYS C;  1NJI H;  1W41 A;  1VQ7 F;  2G9I A;  5B8F A;  2BTU A;  4ZHQ A;  2IQQ A;  4G88 A;  3D54 A;  2HX0 A;  3F0G A;  5IJ0 B;  1RA4 A;  3N2G A;  3G71 F;  2CW4 A;  3DDN A;  2BO1 A;  4TV9 A;  5C8Y B;  1JN1 A;  1RQ2 A;  3D00 A;  4X1I B;  5AVM A;  1NQ3 A;  1CK2 A;  4ZHW A;  3CPW F;  1COM A;  3RE3 A;  3NVI B;  3IR9 A;  2ZOV A;  1YI2 F;  2H6L A;  5LP6 A;  3S06 A;  4EB6 A;  1GO1 A;  3MBM A;  1IV2 A;  1H48 A;  3RYF B;  3FD5 A;  3JAK B;  3LWO C;  3CD6 F;  4BT4 A;  2Z1E A;  3RA6 A;  4ZK7 A;  3K0T A;  3RYI A;  1SZQ A;  3EOR A;  5CA0 A;  3FD6 A;  4TV8 B;  4XCQ A;  1VQM F;  3HKB B;  3OON A;  1TUB A;  4BW0 B;  4O4H B;  2CZW A;  3HWU A;  4G4X A;  5FLX M;  1H47 A;  2ALE A;  4BT5 A;  1NMU B;  5CA1 B;  3JAL B;  1KNK A;  4B46 A;  1VQO F;  3P4E A;  1FNJ A;  4BVQ A;  2UYK A;  1QD9 A;  1QU9 A;  3MCQ A;  1E7K A;  3JAS B;  1W55 A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 2K1S A;  2L26 A;  2W8B C;  5EAZ A;  3TD3 A;  3S03 A;  4RHA A;  2ZVY A;  2LBT A;  4B5C A;  4ZHV A;  4G4W A;  3S0W A;  1OAP A;  3TD4 A;  3S0Y A;  3WPX A;  3CYQ A;  2AIZ P;  4G4Z A;  5EB0 A;  3IMP A;  2ZF8 A;  3OON A;  4G88 A;  5EB1 B;  4ZHY B;  4PWT A;  3KHN A;  4G4X A;  2N48 A;  3WPW A;  2LCA A;  4ZHW A;  2MQE A;  4R40 B;  4B62 A;  4ERH A;  3TD5 A;  2ZOV A;  2HQS C;  3CYP B;  1R1M A;  3S0H A;  3S02 A;  4G4Y A;  3S06 A;  3LDT A;  2KGW A;  4G4V A;  2ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...