2MQEA

Solution structure of escherichia coli outer membrane protein a c-terminal domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OmpA domain protein transmembrane region-containing protein
publication title The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2mqeA00
4G88A 4G4YA 2W8BC 3S02A 3S0YA 2K1SA 3CYPB 3TD5A 3KHNA 1OAPA 3TD3A 3WPXA 2LCAA 3OONA 4ZHYB 2MQEA 4G4XA 4B5CA 2KGWA 5EB0A 1R1MA 2AIZP 2ZVZA 2LBTA 4R40B 5EB1B 3S0HA 3TD4A 2N48A 3CYQA 2ZF8A 3S06A 4G4ZA 5EAZA 3S0WA 3WPWA 4ERHA 4RHAA 4ZHWA 4ZHVA 2ZVYA 3IMPA 3LDTA 4PWTA 3S03A 2HQSC 2ZOVA 2L26A 4G4VA 4G4WA 4B62A
chains in the Genus database with same CATH superfamily
2GLZA 3EORA 3P0ZA 5EWRA 1CN7A 5LP6A 5DCVA 3VCZA 4C8IA 1VQOF 2HVYD 3N2KB 1FNKA 2CHTA 5JCOC 4B5CA 4O2AA 3NVIB 1R1MA 5CA1B 3C9UA 3J7AR 1E7KA 2RHOA 3MCQA 5CB4A 3HKDB 5C8YA 1VQVA 4NQ3A 3HKBB 4I50A 1VQ5F 3RYFA 3TD4A 1SDSA 5LOVB 3JARB 3O85A 5B8FA 1JFFA 3WXMB 5JQGA 3CC4F 1W5FA 3S0YA 2ZODA 3HAXD 3HWUA 3SIUA 4LNUA 3WGMA 2LCAA 2AIZP 2R751 3RYHA 2DYYA 1OFUA 1XHOA 3IEQA 1W5AA 2BTQB 4KWEA 1VQPF 1UI9A 5GAPK 3R0PA 4WBNA 4ZHQB 5LA6A 4O4LA 1YJNF 2ALEA 3JAWA 3CG6A 5LXTA 1Q7YH 1VQ8F 3WJRA 4DXDA 2RHLA 2L26A 5HY2A 2HP0B 1U3LA 3CC7F 4TZZA 3C9SA 2HS0A 2FC3A 3C9TA 1M90H 2Z01A 4IHJB 1K9MH 5EO3A 3FBAA 1YJWF 2HRUA 3JALB 5CA1A 1IPAA 3I3FA 3T80A 3CCEF 4I55B 3J81M 3CYQA 1FFXB 1Q81H 2UYNB 3HKBA 2JNBA 2OTJF 5HY1A 3D00A 4X3MA 3HJWC 5FJ4C 3FD5A 3IR9A 3SIVA 5LP6C 3CB2A 2IAFA 3MDOA 1NJIH 3JARA 2CWJA 4U39A 3I55F 5BMVB 3P10A 2H6LA 3E1YA 1U40A 1X25A 3NVKE 3QTYA 3GYQA 1W5EA 3N4ZA 4O4IB 3D01A 4C8GA 1W59A 3JAKB 4F6RB 3RYIB 4BVRA 2YXZA 5JVDA 3FD6A 2P6YA 3CCUF 3S0WA 1QAHA 4ZHQA 1SA0B 4HNAA 1XBIA 2WALA 2HP0A 3TD5A 3CCRF 2PHNA 1VQLF 2BTUA 1SZQA 1ZWZA 2CHSA 1W57A 3LYBA 4IHJA 1TUBB 2LBTA 1W55A 5IJ0B 2VAWA 3CPWF 1KD1H 2YYEA 3L7QA 2GZLA 3JALA 3VMFB 2HX0A 3RE3A 1IV3A 4ZI7B 3WGNA 4G4ZA 5KX5B 3AGKA 3CMEF 1FFXA 1W42A 2UYNA 2R6R1 4TUYB 5HXZA 5HP8A 1Q86H 4I4TB 3VYTC 3TD3A 3CCLF 2UYJA 3M1XA 3N2GB 4IIJA 5BMVA 5G4VC 1YI2F 3PLAC 2AMTA 2CZWA 4YJ2B 4BVQA 2LBWA 5EB1B 4O4IA 2LBXA 2RB9A 1YITF 4O4JB 2CVLA 3JAKA 4F6RA 2H8EA 5MN4A 3ELCA 1JJ2F 4RQOA 1W581 3S02A 1XV2A 2QA4F 3WJQA 1J7HA 1YGYA 1SA0A 1VQMF 1S72F 4X1YA 3I56F 5EIBC 4M8IA 2BTOA 3KJJA 3DC2A 1DBFA 3JATB 3JCMM 5IYZB 5FLXM 1RLUA 3PAFA 5GANK 3LWVC 1YQNA 1Z5WA 1TUBA 3MCAB 3QHDA 5ITZB 3GTZA 1QVGF 2ZF8A 3P4EA 1IV1A 1W3EX 1H48A 4DRXB 4ZI7A 1W2BF 2ZOVA 4TV8B 4B62A 5KX5A 1RQ2A 3IKEA 3DDNA 4TUYA 2VAPA 4I4TA 2Q1XA 4BT7A 3WGKA 3CXCF 5CA0B 3UT5B 5HP7A 4ZHYB 2KGWA 3JASB 3VOAA 5G4UC 3BYQA 3ZP4A 3N2KA 1VQ4F 3WJPA 4C4WC 1U43A 3WGLA 3VI6A 5GIOC 2RHJA 3OW2F 5KMGB 3RYCB 3HKDA 3V4DA 5IT9M 5MN5A 3K12A 3WPWA 3JAMM 2ZVYA 4BT3A 2NMUA 3JVHA 4O4JA 3ZP7A 2F9ZC 2HQSC 3FFMA 3HKCB 4R40B 1KNJA 5LOVA 3LMEA 4X1IB 3N4YA 4C81A 1KC8H 5J2UB 2KTVA 3GHZA 1QVFF 3K0TA 5JH7B 5GINC 3M4SA 4O2BB 3ERNA 2OZBA 2HS4A 3MBMA 3HKEB 1PF5A 2N48A 3S06A 1GZ0A 2CW4A 3FPIA 2QTPA 3CCVF 2H8CA 1ODEA 4G88A 2EWCA 3K14A 3F0FA 1RA4A 4O2AB 1JD1A 4BT5A 3D54A 5AVMA 1TVKB 4BW0B 3Q8HA 5CA0A 3UT5A 5HY0A 2Q1YA 3LWOC 2Z1EA 2HRYA 4TV9B 2IQQA 4EI9A 1VQ9F 1W40A 4ERHA 1PXWA 5KMGA 3MQWA 4I55A 5JQGB 2I6RA 5EIBD 3CPQA 2VXYA 3VO8A 4XCQA 2UYPA 3V3TA 2VGMA 5EYPB 4BT2A 1H47A 3E22B 2K1SA 4X1IA 4X20B 2ZAUA 1XRGA 5EZYB 3LFOA 3CCMF 3CCSF 3V7EA 5J2UA 2HS3A 5LA6B 4O4LB 5JH7A 2RHHA 3NK6A 4NUTA 3CC2F 2I6DA 3RA5A 4ZOLB 4O2BA 5EAZA 4ZK7A 3HKEA 3RYIA 4ZHVA 1YIJF 1VQ7F 2GVIA 1K8AH 5MN6A 4G4YA 2UZHA 1RQ7A 4BY9D 2BO1A 1KNKA 5LYJB 3F6MA 1Z5VA 3VOBA 1JY8A 3WPXA 3LWRC 2MQEA 3HTNA 4EI7A 4O4HB 1TVKA 3CCJF 1GO1A 3CCQF 1VH8A 3U0OA 4C8EA 4TV9A 4EB6B 1X7PA 5IJ0A 2KTUA 2Z1UA 3VIUA 4PWTA 2QI2A 4BVSA 5J2TB 1RLGA 3G71F 1DT9A 4B46A 2VAMA 3M84A 4NWOB 4U3JB 4YJ3B 3NMUC 3C9RA 3KJKA 1FNJA 5EYPA 3E22A 3OONA 4B45A 1M1KH 4X20A 3VTIC 4X3LA 3LWQC 3OBYA 5HXUA 4E6EA 3E20B 2ZVZA 1GX1A 3N2GA 5EZYA 5JVDB 3OBWA 1X52A 1QU9A 4X1KB 3IEWA 4YJ2A 2IG8A 3K2XA 1VQKF 1COMA 1Q82H 1VQ6F 3F0EA 2V9YA 4RHAA 1Q8RA 3IMPA 4BT4A 4ZOLA 4HNAB 1W5BA 3V7QA 2HP3A 2G9IA 3ZO8A 4FFBB 5HY4A 5HWEA 5GONB 2DT4A 1W41A 3VYUC 3B6NA 1UFYA 3RA6A 2OHWA 4BT6A 4G4XA 5LYJA 2Z1TA 3IKFA 5JCOA 3F0GA 3CMAF 2QEXF 1NMUB 1QD9A 1IV4A 3JATA 4O4HA 5IYZA 2KG4A 1U3PA 3J80M 1T0AA 2CSLA 5FNVB 1VQNF 5IJ9B 1T0KB 1GO0A 3CD6F 3LDTA 3VYSC 2B33A 3S03A 3KE1A 5ITZA 5LP6B 5GIPC 1N8RH 4EB6A 3QUWA 4G4VA 5J2TA 4IIJB 2W8BC 4DRXA 2OTMA 1CLIA 4TV8A 1VHAA 2Z1FA 1JN1A 4U3JA 1YJ9F 1KQSF 2UYKA 4YJ3A 5CB4B 5EB0A 3ZOPA 5C8YB 4I50B 5A2QM 3RYFB 3JASA 2VGNA 4BVTA 1YHQF 4X1KA 1H7MA 2FGYA 3C8LA 3G6EF 1JFFB 1ONIA 3RYCA 4X1YB 3ON1A 3G4SF 4LNUB 1VK3A 3LWPC 4LCKA 3HKCA 3CYPB 4FFBA 1OAPA 3KHNA 3F0DA 3RYHB 5GONA 1K73H 3KIZA 1CK2A 4EI8A 2AIFA 4WBNB 1FSZA 3S0HA 3JAWB 5LXTB 1NQ3A 3I7TA 1IV2A 3WGJA 2OTLF 3NK7A 4ZHWA 2PMPA 5FNVA 5IJ9A 1X7OA 4C82A 3ESJA 4G4WA
chains in the Genus database with same CATH topology
4G88A 4G4YA 2W8BC 3S02A 3S0YA 2K1SA 3CYPB 3TD5A 3KHNA 1OAPA 3TD3A 3WPXA 2LCAA 3OONA 4ZHYB 2MQEA 4G4XA 4B5CA 2KGWA 5EB0A 1R1MA 2AIZP 2ZVZA 2LBTA 4R40B 5EB1B 3S0HA 3TD4A 2N48A 3CYQA 2ZF8A 3S06A 4G4ZA 5EAZA 3S0WA 3WPWA 4ERHA 4RHAA 4ZHWA 4ZHVA 2ZVYA 3IMPA 3LDTA 4PWTA 3S03A 2HQSC 2ZOVA 2L26A 4G4VA 4G4WA 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G88 A;  4G4Y A;  2W8B C;  3S02 A;  3S0Y A;  2K1S A;  3CYP B;  3TD5 A;  3KHN A;  1OAP A;  3TD3 A;  3WPX A;  2LCA A;  3OON A;  4ZHY B;  2MQE A;  4G4X A;  4B5C A;  2KGW A;  5EB0 A;  1R1M A;  2AIZ P;  2ZVZ A;  2LBT A;  4R40 B;  5EB1 B;  3S0H A;  3TD4 A;  2N48 A;  3CYQ A;  2ZF8 A;  3S06 A;  4G4Z A;  5EAZ A;  3S0W A;  3WPW A;  4ERH A;  4RHA A;  4ZHW A;  4ZHV A;  2ZVY A;  3IMP A;  3LDT A;  4PWT A;  3S03 A;  2HQS C;  2ZOV A;  2L26 A;  4G4V A;  4G4W A;  4B62 A; 
#chains in the Genus database with same CATH topology
 2GLZ A;  3EOR A;  3P0Z A;  5EWR A;  1CN7 A;  5LP6 A;  5DCV A;  3VCZ A;  4C8I A;  1VQO F;  2HVY D;  3N2K B;  1FNK A;  2CHT A;  5JCO C;  4B5C A;  4O2A A;  3NVI B;  1R1M A;  5CA1 B;  3C9U A;  3J7A R;  1E7K A;  2RHO A;  3MCQ A;  5CB4 A;  3HKD B;  5C8Y A;  1VQV A;  4NQ3 A;  3HKB B;  4I50 A;  1VQ5 F;  3RYF A;  3TD4 A;  1SDS A;  5LOV B;  3JAR B;  3O85 A;  5B8F A;  1JFF A;  3WXM B;  5JQG A;  3CC4 F;  1W5F A;  3S0Y A;  2ZOD A;  3HAX D;  3HWU A;  3SIU A;  4LNU A;  3WGM A;  2LCA A;  2AIZ P;  2R75 1;  3RYH A;  2DYY A;  1OFU A;  1XHO A;  3IEQ A;  1W5A A;  2BTQ B;  4KWE A;  1VQP F;  1UI9 A;  5GAP K;  3R0P A;  4WBN A;  4ZHQ B;  5LA6 A;  4O4L A;  1YJN F;  2ALE A;  3JAW A;  3CG6 A;  5LXT A;  1Q7Y H;  1VQ8 F;  3WJR A;  4DXD A;  2RHL A;  2L26 A;  5HY2 A;  2HP0 B;  1U3L A;  3CC7 F;  4TZZ A;  3C9S A;  2HS0 A;  2FC3 A;  3C9T A;  1M90 H;  2Z01 A;  4IHJ B;  1K9M H;  5EO3 A;  3FBA A;  1YJW F;  2HRU A;  3JAL B;  5CA1 A;  1IPA A;  3I3F A;  3T80 A;  3CCE F;  4I55 B;  3J81 M;  3CYQ A;  1FFX B;  1Q81 H;  2UYN B;  3HKB A;  2JNB A;  2OTJ F;  5HY1 A;  3D00 A;  4X3M A;  3HJW C;  5FJ4 C;  3FD5 A;  3IR9 A;  3SIV A;  5LP6 C;  3CB2 A;  2IAF A;  3MDO A;  1NJI H;  3JAR A;  2CWJ A;  4U39 A;  3I55 F;  5BMV B;  3P10 A;  2H6L A;  3E1Y A;  1U40 A;  1X25 A;  3NVK E;  3QTY A;  3GYQ A;  1W5E A;  3N4Z A;  4O4I B;  3D01 A;  4C8G A;  1W59 A;  3JAK B;  4F6R B;  3RYI B;  4BVR A;  2YXZ A;  5JVD A;  3FD6 A;  2P6Y A;  3CCU F;  3S0W A;  1QAH A;  4ZHQ A;  1SA0 B;  4HNA A;  1XBI A;  2WAL A;  2HP0 A;  3TD5 A;  3CCR F;  2PHN A;  1VQL F;  2BTU A;  1SZQ A;  1ZWZ A;  2CHS A;  1W57 A;  3LYB A;  4IHJ A;  1TUB B;  2LBT A;  1W55 A;  5IJ0 B;  2VAW A;  3CPW F;  1KD1 H;  2YYE A;  3L7Q A;  2GZL A;  3JAL A;  3VMF B;  2HX0 A;  3RE3 A;  1IV3 A;  4ZI7 B;  3WGN A;  4G4Z A;  5KX5 B;  3AGK A;  3CME F;  1FFX A;  1W42 A;  2UYN A;  2R6R 1;  4TUY B;  5HXZ A;  5HP8 A;  1Q86 H;  4I4T B;  3VYT C;  3TD3 A;  3CCL F;  2UYJ A;  3M1X A;  3N2G B;  4IIJ A;  5BMV A;  5G4V C;  1YI2 F;  3PLA C;  2AMT A;  2CZW A;  4YJ2 B;  4BVQ A;  2LBW A;  5EB1 B;  4O4I A;  2LBX A;  2RB9 A;  1YIT F;  4O4J B;  2CVL A;  3JAK A;  4F6R A;  2H8E A;  5MN4 A;  3ELC A;  1JJ2 F;  4RQO A;  1W58 1;  3S02 A;  1XV2 A;  2QA4 F;  3WJQ A;  1J7H A;  1YGY A;  1SA0 A;  1VQM F;  1S72 F;  4X1Y A;  3I56 F;  5EIB C;  4M8I A;  2BTO A;  3KJJ A;  3DC2 A;  1DBF A;  3JAT B;  3JCM M;  5IYZ B;  5FLX M;  1RLU A;  3PAF A;  5GAN K;  3LWV C;  1YQN A;  1Z5W A;  1TUB A;  3MCA B;  3QHD A;  5ITZ B;  3GTZ A;  1QVG F;  2ZF8 A;  3P4E A;  1IV1 A;  1W3E X;  1H48 A;  4DRX B;  4ZI7 A;  1W2B F;  2ZOV A;  4TV8 B;  4B62 A;  5KX5 A;  1RQ2 A;  3IKE A;  3DDN A;  4TUY A;  2VAP A;  4I4T A;  2Q1X A;  4BT7 A;  3WGK A;  3CXC F;  5CA0 B;  3UT5 B;  5HP7 A;  4ZHY B;  2KGW A;  3JAS B;  3VOA A;  5G4U C;  3BYQ A;  3ZP4 A;  3N2K A;  1VQ4 F;  3WJP A;  4C4W C;  1U43 A;  3WGL A;  3VI6 A;  5GIO C;  2RHJ A;  3OW2 F;  5KMG B;  3RYC B;  3HKD A;  3V4D A;  5IT9 M;  5MN5 A;  3K12 A;  3WPW A;  3JAM M;  2ZVY A;  4BT3 A;  2NMU A;  3JVH A;  4O4J A;  3ZP7 A;  2F9Z C;  2HQS C;  3FFM A;  3HKC B;  4R40 B;  1KNJ A;  5LOV A;  3LME A;  4X1I B;  3N4Y A;  4C81 A;  1KC8 H;  5J2U B;  2KTV A;  3GHZ A;  1QVF F;  3K0T A;  5JH7 B;  5GIN C;  3M4S A;  4O2B B;  3ERN A;  2OZB A;  2HS4 A;  3MBM A;  3HKE B;  1PF5 A;  2N48 A;  3S06 A;  1GZ0 A;  2CW4 A;  3FPI A;  2QTP A;  3CCV F;  2H8C A;  1ODE A;  4G88 A;  2EWC A;  3K14 A;  3F0F A;  1RA4 A;  4O2A B;  1JD1 A;  4BT5 A;  3D54 A;  5AVM A;  1TVK B;  4BW0 B;  3Q8H A;  5CA0 A;  3UT5 A;  5HY0 A;  2Q1Y A;  3LWO C;  2Z1E A;  2HRY A;  4TV9 B;  2IQQ A;  4EI9 A;  1VQ9 F;  1W40 A;  4ERH A;  1PXW A;  5KMG A;  3MQW A;  4I55 A;  5JQG B;  2I6R A;  5EIB D;  3CPQ A;  2VXY A;  3VO8 A;  4XCQ A;  2UYP A;  3V3T A;  2VGM A;  5EYP B;  4BT2 A;  1H47 A;  3E22 B;  2K1S A;  4X1I A;  4X20 B;  2ZAU A;  1XRG A;  5EZY B;  3LFO A;  3CCM F;  3CCS F;  3V7E A;  5J2U A;  2HS3 A;  5LA6 B;  4O4L B;  5JH7 A;  2RHH A;  3NK6 A;  4NUT A;  3CC2 F;  2I6D A;  3RA5 A;  4ZOL B;  4O2B A;  5EAZ A;  4ZK7 A;  3HKE A;  3RYI A;  4ZHV A;  1YIJ F;  1VQ7 F;  2GVI A;  1K8A H;  5MN6 A;  4G4Y A;  2UZH A;  1RQ7 A;  4BY9 D;  2BO1 A;  1KNK A;  5LYJ B;  3F6M A;  1Z5V A;  3VOB A;  1JY8 A;  3WPX A;  3LWR C;  2MQE A;  3HTN A;  4EI7 A;  4O4H B;  1TVK A;  3CCJ F;  1GO1 A;  3CCQ F;  1VH8 A;  3U0O A;  4C8E A;  4TV9 A;  4EB6 B;  1X7P A;  5IJ0 A;  2KTU A;  2Z1U A;  3VIU A;  4PWT A;  2QI2 A;  4BVS A;  5J2T B;  1RLG A;  3G71 F;  1DT9 A;  4B46 A;  2VAM A;  3M84 A;  4NWO B;  4U3J B;  4YJ3 B;  3NMU C;  3C9R A;  3KJK A;  1FNJ A;  5EYP A;  3E22 A;  3OON A;  4B45 A;  1M1K H;  4X20 A;  3VTI C;  4X3L A;  3LWQ C;  3OBY A;  5HXU A;  4E6E A;  3E20 B;  2ZVZ A;  1GX1 A;  3N2G A;  5EZY A;  5JVD B;  3OBW A;  1X52 A;  1QU9 A;  4X1K B;  3IEW A;  4YJ2 A;  2IG8 A;  3K2X A;  1VQK F;  1COM A;  1Q82 H;  1VQ6 F;  3F0E A;  2V9Y A;  4RHA A;  1Q8R A;  3IMP A;  4BT4 A;  4ZOL A;  4HNA B;  1W5B A;  3V7Q A;  2HP3 A;  2G9I A;  3ZO8 A;  4FFB B;  5HY4 A;  5HWE A;  5GON B;  2DT4 A;  1W41 A;  3VYU C;  3B6N A;  1UFY A;  3RA6 A;  2OHW A;  4BT6 A;  4G4X A;  5LYJ A;  2Z1T A;  3IKF A;  5JCO A;  3F0G A;  3CMA F;  2QEX F;  1NMU B;  1QD9 A;  1IV4 A;  3JAT A;  4O4H A;  5IYZ A;  2KG4 A;  1U3P A;  3J80 M;  1T0A A;  2CSL A;  5FNV B;  1VQN F;  5IJ9 B;  1T0K B;  1GO0 A;  3CD6 F;  3LDT A;  3VYS C;  2B33 A;  3S03 A;  3KE1 A;  5ITZ A;  5LP6 B;  5GIP C;  1N8R H;  4EB6 A;  3QUW A;  4G4V A;  5J2T A;  4IIJ B;  2W8B C;  4DRX A;  2OTM A;  1CLI A;  4TV8 A;  1VHA A;  2Z1F A;  1JN1 A;  4U3J A;  1YJ9 F;  1KQS F;  2UYK A;  4YJ3 A;  5CB4 B;  5EB0 A;  3ZOP A;  5C8Y B;  4I50 B;  5A2Q M;  3RYF B;  3JAS A;  2VGN A;  4BVT A;  1YHQ F;  4X1K A;  1H7M A;  2FGY A;  3C8L A;  3G6E F;  1JFF B;  1ONI A;  3RYC A;  4X1Y B;  3ON1 A;  3G4S F;  4LNU B;  1VK3 A;  3LWP C;  4LCK A;  3HKC A;  3CYP B;  4FFB A;  1OAP A;  3KHN A;  3F0D A;  3RYH B;  5GON A;  1K73 H;  3KIZ A;  1CK2 A;  4EI8 A;  2AIF A;  4WBN B;  1FSZ A;  3S0H A;  3JAW B;  5LXT B;  1NQ3 A;  3I7T A;  1IV2 A;  3WGJ A;  2OTL F;  3NK7 A;  4ZHW A;  2PMP A;  5FNV A;  5IJ9 A;  1X7O A;  4C82 A;  3ESJ A;  4G4W A; 
#chains in the Genus database with same CATH homology
 4G88 A;  4G4Y A;  2W8B C;  3S02 A;  3S0Y A;  2K1S A;  3CYP B;  3TD5 A;  3KHN A;  1OAP A;  3TD3 A;  3WPX A;  2LCA A;  3OON A;  4ZHY B;  2MQE A;  4G4X A;  4B5C A;  2KGW A;  5EB0 A;  1R1M A;  2AIZ P;  2ZVZ A;  2LBT A;  4R40 B;  5EB1 B;  3S0H A;  3TD4 A;  2N48 A;  3CYQ A;  2ZF8 A;  3S06 A;  4G4Z A;  5EAZ A;  3S0W A;  3WPW A;  4ERH A;  4RHA A;  4ZHW A;  4ZHV A;  2ZVY A;  3IMP A;  3LDT A;  4PWT A;  3S03 A;  2HQS C;  2ZOV A;  2L26 A;  4G4V A;  4G4W A;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...