1YITF

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yitF00
1KC8H 3CC2F 1YHQF 2KTUA 2QEXF 5IT9M 3LWVC 5EO3A 1K8AH 1VQ7F 1M90H 5DCVA 1GO0A 1VQ4F 2FC3A 3PAFA 3JAMM 5GIPC 1Q82H 3V7EA 1GO1A 3J7AR 5A2QM 3O85A 2KG4A 1XBIA 4TZZA 3ON1A 1W40A 3CCEF 5G4UC 3FFMA 2QI2A 5GAPK 3CCVF 1X7PA 1VQ8F 4BW0B 3RA6A 1NMUB 1YIJF 1S72F 3LWQC 3CPWF 2AIFA 3LFOA 2VGNA 3CXCF 3SIVA 4C4WC 1RLGA 3N4ZA 3J81M 3GYQA 2LBXA 3V7QA 1W41A 3NVIB 1YJWF 1W3EX 5GANK 3RA5A 1YITF 3JCMM 3CCMF 3LWOC 1YI2F 2I6DA 4NUTA 3AGKA 3VI6A 3OBYA 1CN7A 1VQ9F 3CCLF 4BY9D 3LWPC 1NJIH 1N8RH 1YJ9F 1M1KH 1JJ2F 1Q86H 1ZWZA 3CCJF 3HJWC 1QVFF 1W2BF 1VQ6F 1YJNF 5EWRA 2KTVA 3CD6F 5FLXM 2HVYD 3NK6A 1KD1H 1VQPF 3IR9A 1PXWA 3E1YA 3OBWA 1X52A 4X3LA 3CC4F 1VQLF 1GZ0A 3NMUC 2OZBA 1QVGF 1E7KA 1SDSA 3J80M 1VQ5F 2WALA 5GIOC 4LCKA 3CCSF 1X7OA 3OW2F 3CCUF 3LWRC 3G6EF 3VMFB 4X3MA 3G71F 1VQNF 3SIUA 1VQOF 1RA4A 2CZWA 2JNBA 2BO1A 2OTLF 1Q81H 3HAXD 3PLAC 3G4SF 3CC7F 1DT9A 3E20B 2QA4F 1VQMF 1Q7YH 3CCQF 1KQSF 1VQKF 1K73H 5FJ4C 1W42A 3NK7A 3CMEF 3I55F 1CK2A 3NVKE 3WXMB 3I56F 2OHWA 1IPAA 1K9MH 3CPQA 3N4YA 1T0KB 3CCRF 3CMAF 2OTJF 5GINC 2LBWA 2VGMA 3MCAB 2ALEA 3CG6A 1H7MA 5G4VC
chains in the Genus database with same CATH superfamily
1YHQF 2KTUA 3VYUC 2QEXF 4I50B 5EO3A 4HNAA 5ITZA 3S03A 3N2KA 4O2AA 3MDOA 3DDNA 2FC3A 4O4LA 3C9RA 4ZHVA 3WGMA 4C8GA 1GO1A 5A2QM 3ON1A 2Z1EA 3CYQA 3WGLA 3WPXA 1VQ8F 1YIJF 1S72F 3F0DA 2IAFA 3LWQC 5LOVB 3LFOA 2H8EA 2P6YA 2W8BC 1ONIA 3FD5A 4C4WC 5LYJA 3GYQA 3RYFA 5CA1B 3KE1A 3FD6A 3RYCB 1GX1A 3VOBA 2H8CA 2RHLA 1IV2A 1SZQA 3QHDA 2RHJA 3HKBA 3JCMM 3CCMF 2ZVZA 3K12A 2I6RA 3C9SA 3CCLF 3JATA 2YXZA 4BVQA 1U3PA 5CA0B 4G4WA 1N8RH 4ERHA 1M1KH 4O4HA 4O4HB 4IIJA 3HJWC 2LBTA 3JASA 4C8IA 4B5CA 3V4DA 5EWRA 2Z1UA 4O4IA 1W57A 3F0EA 4C82A 3JAWA 3TD5A 1UI9A 1KD1H 3S0YA 5EYPA 4I4TA 4I4TB 1VQPF 4M8IA 3CC4F 1VQLF 1GZ0A 3C9UA 4G88A 4NQ3A 2MQEA 3KJJA 1KNKA 5BMVB 3JAKB 4I55B 2DT4A 3CYPB 4EB6A 4EB6B 3E22A 3E22B 4YJ3B 3OW2F 4G4VA 1X25A 1VQNF 5EIBC 3B6NA 5HXZA 4F6RA 3WGKA 2HS4A 4RHAA 3VTIC 5J2TA 2CHTA 5CB4A 1Q81H 1TUBA 1JFFB 3PLAC 3E20B 3CB2A 1W55A 1KQSF 2HX0A 2GVIA 3RYHA 3RYHB 4BVRA 4DRXA 1CK2A 4LNUA 3NVKE 2ZOVA 5JQGA 2CWJA 5LA6B 3S0HA 3CPQA 3WJPA 3F6MA 3M84A 1T0KB 3VOAA 1U40A 4IHJB 3LYBA 1IV1A 1KC8H 1SA0B 5EB1B 2UYPA 3OONA 1FFXB 4X1IA 1VQ7F 1TVKB 4X1YA 3S0WA 3ZP7A 1VQ4F 3HKDA 5JVDA 3JAMM 4ZI7B 4BT5A 4TZZA 2UYJA 3FBAA 3CCEF 1J7HA 5FNVB 2R6R1 5GAPK 1X7PA 5C8YB 3RA6A 4BT6A 3WJQA 2BTOA 3CPWF 3HTNA 4TUYB 2VAPA 2VXYA 1RLGA 4I50A 4X20B 4FFBA 1VK3A 4FFBB 3V7QA 1W3EX 3HKEB 5HP7A 1JY8A 4G4ZA 1QD9A 4YJ2B 3RA5A 3IEWA 3LWOC 2Z01A 2I6DA 3VI6A 1CN7A 3K0TA 4TV8B 1NJIH 1YJ9F 1JJ2F 5LOVA 2BTUA 3GTZA 1VQ6F 3JARA 3JARB 5EZYA 5EZYB 5LP6B 5LP6A 5JH7B 1YQNA 5CA1A 4RQOA 4XCQA 5GONB 1W5BA 3RYCA 4X3LA 3C8LA 1T0AA 3WPWA 3JALB 1SDSA 2Q1XA 1RQ7A 3C9TA 4LCKA 3CCSF 3EORA 4BT3A 3LWRC 5CA0A 1RA4A 4U39A 4BVSA 3MCQA 2BO1A 4BT4A 3HAXD 3IEQA 2CSLA 5LXTB 3G4SF 5IYZB 1VQKF 3CCQF 2N48A 3NK7A 4X1KB 4ZHWA 5JCOC 5KX5B 3K14A 3CMEF 3VIUA 4EI8A 1RLUA 2OHWA 5BMVA 3JAKA 4I55A 1K9MH 4YJ3A 2OTJF 5GINC 3DC2A 3MCAB 2B33A 1H7MA 4G4XA 5G4VC 1VQ5F 2NMUA 5EAZA 1XV2A 5MN6A 1W59A 5IT9M 4O4JB 1JFFA 2EWCA 1H48A 2HS3A 2DYYA 5DCVA 4B62A 3BYQA 3L7QA 3K2XA 1NQ3A 2YYEA 3PAFA 5GIPC 1Q82H 3V7EA 1OAPA 3O85A 2KG4A 2HS0A 5LA6A 5G4UC 3WGNA 1VQVA 2H6LA 4IHJA 3HKCB 3CXCF 4WBNB 1SA0A 2RB9A 3S02A 1XRGA 3N4ZA 1JN1A 1FFXA 3VYSC 2FGYA 3UT5B 2LBXA 1RQ2A 2AMTA 2HQSC 1W41A 2CVLA 2QTPA 1YJWF 4ZHQB 1TVKA 3FPIA 2PMPA 5GANK 1PF5A 2G9IA 4ZI7A 3Q8HA 2RHHA 4NUTA 5HXUA 3OBYA 4BY9D 2V9YA 5FNVA 4ZOLA 4ZOLB 3RYIB 4TV9B 5C8YA 5EB0A 3CCJF 1Q8RA 1CLIA 4ZHYB 1QVFF 1W2BF 5IJ9B 1YJNF 2UYNA 2UYNB 4TUYA 3CD6F 5FLXM 2HVYD 3D00A 4X20A 4U3JB 3IR9A 1PXWA 3OBWA 4DXDA 1X52A 3NMUC 3ZOPA 3HKEA 2CW4A 1QVGF 2HP0B 3ESJA 2R751 3ERNA 4YJ2A 3IKFA 2IG8A 4B46A 2Q1YA 2HRUA 5IJ0B 3D54A 3G6EF 4TV8A 3VMFB 4O2BA 4O2BB 2PHNA 1VQOF 3SIUA 1U43A 2CZWA 3S06A 2CHSA 3M4SA 3GHZA 1QAHA 2BTQB 2OTLF 4HNAB 4C8EA 5ITZB 1W581 3N2KB 4O2AB 3CC7F 1DT9A 1VHAA 3KHNA 1VQMF 1Q7YH 5JH7A 1W42A 5GONA 4O4LB 2F9ZC 3I55F 3JALA 1KNJA 3WXMB 1IV4A 2HRYA 3I56F 3MBMA 1W5FA 2UZHA 3WJRA 1R1MA 5HY1A 3CMAF 3T80A 2LBWA 4E6EA 2VGMA 3VYTC 3VCZA 3CC2F 3LMEA 4B45A 3LWVC 5LYJB 3RYFB 2IQQA 3V3TA 5LXTA 1K8AH 4EI9A 5IYZA 4BT2A 1M90H 1W5AA 1GO0A 5KX5A 4X1KA 5AVMA 3HKBB 4BVTA 2Z1TA 2VAWA 3J7AR 5HY0A 1XBIA 3M1XA 5HY2A 1W40A 3JATB 3QUWA 3F0GA 1JD1A 3FFMA 2QI2A 3CCVF 3MQWA 4BW0B 1FNJA 1NMUB 4IIJB 1COMA 3JASB 2AIFA 2VGNA 2VAMA 3D01A 4O4IB 3SIVA 2HP3A 3IKEA 4O4JA 3JAWB 3J81M 3ELCA 5EYPB 1IV3A 1U3LA 2GLZA 3NVIB 2GZLA 5HP8A 3JVHA 1H47A 4G4YA 1YITF 1XHOA 3KIZA 1ODEA 3P10A 1Z5VA 4ZK7A 1YI2F 1UFYA 3I7TA 3P4EA 3AGKA 4BT7A 5HWEA 1VQ9F 1Z5WA 4NWOB 1QU9A 3LWPC 5MN4A 4F6RB 2AIZP 1Q86H 1ZWZA 5J2TB 4R40B 3HKCA 3U0OA 5CB4B 3VO8A 1TUBB 5MN5A 3F0FA 3ZP4A 2KTVA 3IMPA 4WBNA 3WGJA 4C81A 3NK6A 2LCAA 3UT5A 1FNKA 2KGWA 2ZAUA 3E1YA 3TD3A 4DRXB 4ZHQA 4EI7A 2OZBA 4LNUB 1E7KA 4KWEA 1DBFA 3J80M 5JQGB 2OTMA 2WALA 3R0PA 1W5EA 5GIOC 1YGYA 3P0ZA 5KMGA 5KMGB 2RHOA 3RE3A 1X7OA 3CCUF 5JCOA 5LP6C 3QTYA 4X3MA 3G71F 3RYIA 1VH8A 4PWTA 4TV9A 2JNBA 3TD4A 3I3FA 2UYKA 3HWUA 3ZO8A 5B8FA 5IJ9A 4X1IB 1OFUA 2QA4F 3KJKA 5HY4A 1K73H 2ZF8A 5FJ4C 4X1YB 2Z1FA 4U3JA 3HKDB 3LDTA 5EIBD 5JVDB 1FSZA 2ZVYA 2HP0A 2K1SA 5J2UA 5J2UB 2L26A 1IPAA 3N4YA 3N2GA 3N2GB 2ZODA 3CCRF 5IJ0A 2ALEA 3CG6A
chains in the Genus database with same CATH topology
1KC8H 3CC2F 1YHQF 2KTUA 2QEXF 5IT9M 3LWVC 5EO3A 3V3TA 1K8AH 4EI9A 1VQ7F 1M90H 5DCVA 1GO0A 1VQ4F 2FC3A 3PAFA 4BVTA 3JAMM 5GIPC 1Q82H 3V7EA 1GO1A 3J7AR 5A2QM 3O85A 2KG4A 1XBIA 5HY0A 4TZZA 3ON1A 5HY2A 1W40A 3CCEF 5G4UC 3FFMA 2QI2A 5GAPK 3CCVF 1X7PA 1VQ8F 4BW0B 3RA6A 1NMUB 1YIJF 1S72F 3LWQC 3CPWF 2AIFA 3LFOA 2VGNA 3CXCF 3SIVA 4C4WC 1RLGA 3N4ZA 3J81M 3GYQA 2FGYA 2LBXA 3V7QA 1W41A 2GLZA 3NVIB 1YJWF 1W3EX 5GANK 3RA5A 1YITF 3JCMM 3CCMF 3LWOC 1YI2F 2I6DA 4NUTA 3AGKA 3VI6A 5HXUA 3OBYA 5HWEA 1CN7A 1VQ9F 3CCLF 4BY9D 3LWPC 4BVQA 1NJIH 1N8RH 1YJ9F 1M1KH 1JJ2F 1Q86H 1ZWZA 3CCJF 3HJWC 1QVFF 1W2BF 1VQ6F 1YJNF 5EWRA 2KTVA 3CD6F 5FLXM 2HVYD 3NK6A 3D00A 1KD1H 4XCQA 1VQPF 3IR9A 1PXWA 3E1YA 3OBWA 1X52A 4X3LA 3CC4F 1VQLF 1GZ0A 3NMUC 4EI7A 2OZBA 4NQ3A 1QVGF 1E7KA 1SDSA 3J80M 1VQ5F 2WALA 5GIOC 4LCKA 3CCSF 1X7OA 3OW2F 3CCUF 3LWRC 3G6EF 3VMFB 4X3MA 3G71F 1VQNF 3SIUA 1VQOF 5HXZA 1RA4A 2CZWA 2JNBA 4BVSA 2BO1A 2OTLF 1Q81H 3HAXD 3PLAC 3G4SF 3CC7F 1DT9A 3E20B 2QA4F 1VQMF 1Q7YH 3CCQF 1KQSF 5HY4A 1VQKF 1K73H 5FJ4C 1W42A 3NK7A 4BVRA 2F9ZC 3CMEF 3I55F 1CK2A 3NVKE 4EI8A 3WXMB 3I56F 2OHWA 1IPAA 1K9MH 3CPQA 3N4YA 1T0KB 5HY1A 3CCRF 3CMAF 2OTJF 5GINC 2LBWA 2VGMA 3MCAB 2ALEA 3CG6A 1H7MA 5G4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 H;  3CC2 F;  1YHQ F;  2KTU A;  2QEX F;  5IT9 M;  3LWV C;  5EO3 A;  1K8A H;  1VQ7 F;  1M90 H;  5DCV A;  1GO0 A;  1VQ4 F;  2FC3 A;  3PAF A;  3JAM M;  5GIP C;  1Q82 H;  3V7E A;  1GO1 A;  3J7A R;  5A2Q M;  3O85 A;  2KG4 A;  1XBI A;  4TZZ A;  3ON1 A;  1W40 A;  3CCE F;  5G4U C;  3FFM A;  2QI2 A;  5GAP K;  3CCV F;  1X7P A;  1VQ8 F;  4BW0 B;  3RA6 A;  1NMU B;  1YIJ F;  1S72 F;  3LWQ C;  3CPW F;  2AIF A;  3LFO A;  2VGN A;  3CXC F;  3SIV A;  4C4W C;  1RLG A;  3N4Z A;  3J81 M;  3GYQ A;  2LBX A;  3V7Q A;  1W41 A;  3NVI B;  1YJW F;  1W3E X;  5GAN K;  3RA5 A;  1YIT F;  3JCM M;  3CCM F;  3LWO C;  1YI2 F;  2I6D A;  4NUT A;  3AGK A;  3VI6 A;  3OBY A;  1CN7 A;  1VQ9 F;  3CCL F;  4BY9 D;  3LWP C;  1NJI H;  1N8R H;  1YJ9 F;  1M1K H;  1JJ2 F;  1Q86 H;  1ZWZ A;  3CCJ F;  3HJW C;  1QVF F;  1W2B F;  1VQ6 F;  1YJN F;  5EWR A;  2KTV A;  3CD6 F;  5FLX M;  2HVY D;  3NK6 A;  1KD1 H;  1VQP F;  3IR9 A;  1PXW A;  3E1Y A;  3OBW A;  1X52 A;  4X3L A;  3CC4 F;  1VQL F;  1GZ0 A;  3NMU C;  2OZB A;  1QVG F;  1E7K A;  1SDS A;  3J80 M;  1VQ5 F;  2WAL A;  5GIO C;  4LCK A;  3CCS F;  1X7O A;  3OW2 F;  3CCU F;  3LWR C;  3G6E F;  3VMF B;  4X3M A;  3G71 F;  1VQN F;  3SIU A;  1VQO F;  1RA4 A;  2CZW A;  2JNB A;  2BO1 A;  2OTL F;  1Q81 H;  3HAX D;  3PLA C;  3G4S F;  3CC7 F;  1DT9 A;  3E20 B;  2QA4 F;  1VQM F;  1Q7Y H;  3CCQ F;  1KQS F;  1VQK F;  1K73 H;  5FJ4 C;  1W42 A;  3NK7 A;  3CME F;  3I55 F;  1CK2 A;  3NVK E;  3WXM B;  3I56 F;  2OHW A;  1IPA A;  1K9M H;  3CPQ A;  3N4Y A;  1T0K B;  3CCR F;  3CMA F;  2OTJ F;  5GIN C;  2LBW A;  2VGM A;  3MCA B;  2ALE A;  3CG6 A;  1H7M A;  5G4V C; 
#chains in the Genus database with same CATH topology
 1YHQ F;  2KTU A;  3VYU C;  2QEX F;  4I50 B;  5EO3 A;  4HNA A;  5ITZ A;  3S03 A;  3N2K A;  4O2A A;  3MDO A;  3DDN A;  2FC3 A;  4O4L A;  3C9R A;  4ZHV A;  3WGM A;  4C8G A;  1GO1 A;  5A2Q M;  3ON1 A;  2Z1E A;  3CYQ A;  3WGL A;  3WPX A;  1VQ8 F;  1YIJ F;  1S72 F;  3F0D A;  2IAF A;  3LWQ C;  5LOV B;  3LFO A;  2H8E A;  2P6Y A;  2W8B C;  1ONI A;  3FD5 A;  4C4W C;  5LYJ A;  3GYQ A;  3RYF A;  5CA1 B;  3KE1 A;  3FD6 A;  3RYC B;  1GX1 A;  3VOB A;  2H8C A;  2RHL A;  1IV2 A;  1SZQ A;  3QHD A;  2RHJ A;  3HKB A;  3JCM M;  3CCM F;  2ZVZ A;  3K12 A;  2I6R A;  3C9S A;  3CCL F;  3JAT A;  2YXZ A;  4BVQ A;  1U3P A;  5CA0 B;  4G4W A;  1N8R H;  4ERH A;  1M1K H;  4O4H A;  4O4H B;  4IIJ A;  3HJW C;  2LBT A;  3JAS A;  4C8I A;  4B5C A;  3V4D A;  5EWR A;  2Z1U A;  4O4I A;  1W57 A;  3F0E A;  4C82 A;  3JAW A;  3TD5 A;  1UI9 A;  1KD1 H;  3S0Y A;  5EYP A;  4I4T A;  4I4T B;  1VQP F;  4M8I A;  3CC4 F;  1VQL F;  1GZ0 A;  3C9U A;  4G88 A;  4NQ3 A;  2MQE A;  3KJJ A;  1KNK A;  5BMV B;  3JAK B;  4I55 B;  2DT4 A;  3CYP B;  4EB6 A;  4EB6 B;  3E22 A;  3E22 B;  4YJ3 B;  3OW2 F;  4G4V A;  1X25 A;  1VQN F;  5EIB C;  3B6N A;  5HXZ A;  4F6R A;  3WGK A;  2HS4 A;  4RHA A;  3VTI C;  5J2T A;  2CHT A;  5CB4 A;  1Q81 H;  1TUB A;  1JFF B;  3PLA C;  3E20 B;  3CB2 A;  1W55 A;  1KQS F;  2HX0 A;  2GVI A;  3RYH A;  3RYH B;  4BVR A;  4DRX A;  1CK2 A;  4LNU A;  3NVK E;  2ZOV A;  5JQG A;  2CWJ A;  5LA6 B;  3S0H A;  3CPQ A;  3WJP A;  3F6M A;  3M84 A;  1T0K B;  3VOA A;  1U40 A;  4IHJ B;  3LYB A;  1IV1 A;  1KC8 H;  1SA0 B;  5EB1 B;  2UYP A;  3OON A;  1FFX B;  4X1I A;  1VQ7 F;  1TVK B;  4X1Y A;  3S0W A;  3ZP7 A;  1VQ4 F;  3HKD A;  5JVD A;  3JAM M;  4ZI7 B;  4BT5 A;  4TZZ A;  2UYJ A;  3FBA A;  3CCE F;  1J7H A;  5FNV B;  2R6R 1;  5GAP K;  1X7P A;  5C8Y B;  3RA6 A;  4BT6 A;  3WJQ A;  2BTO A;  3CPW F;  3HTN A;  4TUY B;  2VAP A;  2VXY A;  1RLG A;  4I50 A;  4X20 B;  4FFB A;  1VK3 A;  4FFB B;  3V7Q A;  1W3E X;  3HKE B;  5HP7 A;  1JY8 A;  4G4Z A;  1QD9 A;  4YJ2 B;  3RA5 A;  3IEW A;  3LWO C;  2Z01 A;  2I6D A;  3VI6 A;  1CN7 A;  3K0T A;  4TV8 B;  1NJI H;  1YJ9 F;  1JJ2 F;  5LOV A;  2BTU A;  3GTZ A;  1VQ6 F;  3JAR A;  3JAR B;  5EZY A;  5EZY B;  5LP6 B;  5LP6 A;  5JH7 B;  1YQN A;  5CA1 A;  4RQO A;  4XCQ A;  5GON B;  1W5B A;  3RYC A;  4X3L A;  3C8L A;  1T0A A;  3WPW A;  3JAL B;  1SDS A;  2Q1X A;  1RQ7 A;  3C9T A;  4LCK A;  3CCS F;  3EOR A;  4BT3 A;  3LWR C;  5CA0 A;  1RA4 A;  4U39 A;  4BVS A;  3MCQ A;  2BO1 A;  4BT4 A;  3HAX D;  3IEQ A;  2CSL A;  5LXT B;  3G4S F;  5IYZ B;  1VQK F;  3CCQ F;  2N48 A;  3NK7 A;  4X1K B;  4ZHW A;  5JCO C;  5KX5 B;  3K14 A;  3CME F;  3VIU A;  4EI8 A;  1RLU A;  2OHW A;  5BMV A;  3JAK A;  4I55 A;  1K9M H;  4YJ3 A;  2OTJ F;  5GIN C;  3DC2 A;  3MCA B;  2B33 A;  1H7M A;  4G4X A;  5G4V C;  1VQ5 F;  2NMU A;  5EAZ A;  1XV2 A;  5MN6 A;  1W59 A;  5IT9 M;  4O4J B;  1JFF A;  2EWC A;  1H48 A;  2HS3 A;  2DYY A;  5DCV A;  4B62 A;  3BYQ A;  3L7Q A;  3K2X A;  1NQ3 A;  2YYE A;  3PAF A;  5GIP C;  1Q82 H;  3V7E A;  1OAP A;  3O85 A;  2KG4 A;  2HS0 A;  5LA6 A;  5G4U C;  3WGN A;  1VQV A;  2H6L A;  4IHJ A;  3HKC B;  3CXC F;  4WBN B;  1SA0 A;  2RB9 A;  3S02 A;  1XRG A;  3N4Z A;  1JN1 A;  1FFX A;  3VYS C;  2FGY A;  3UT5 B;  2LBX A;  1RQ2 A;  2AMT A;  2HQS C;  1W41 A;  2CVL A;  2QTP A;  1YJW F;  4ZHQ B;  1TVK A;  3FPI A;  2PMP A;  5GAN K;  1PF5 A;  2G9I A;  4ZI7 A;  3Q8H A;  2RHH A;  4NUT A;  5HXU A;  3OBY A;  4BY9 D;  2V9Y A;  5FNV A;  4ZOL A;  4ZOL B;  3RYI B;  4TV9 B;  5C8Y A;  5EB0 A;  3CCJ F;  1Q8R A;  1CLI A;  4ZHY B;  1QVF F;  1W2B F;  5IJ9 B;  1YJN F;  2UYN A;  2UYN B;  4TUY A;  3CD6 F;  5FLX M;  2HVY D;  3D00 A;  4X20 A;  4U3J B;  3IR9 A;  1PXW A;  3OBW A;  4DXD A;  1X52 A;  3NMU C;  3ZOP A;  3HKE A;  2CW4 A;  1QVG F;  2HP0 B;  3ESJ A;  2R75 1;  3ERN A;  4YJ2 A;  3IKF A;  2IG8 A;  4B46 A;  2Q1Y A;  2HRU A;  5IJ0 B;  3D54 A;  3G6E F;  4TV8 A;  3VMF B;  4O2B A;  4O2B B;  2PHN A;  1VQO F;  3SIU A;  1U43 A;  2CZW A;  3S06 A;  2CHS A;  3M4S A;  3GHZ A;  1QAH A;  2BTQ B;  2OTL F;  4HNA B;  4C8E A;  5ITZ B;  1W58 1;  3N2K B;  4O2A B;  3CC7 F;  1DT9 A;  1VHA A;  3KHN A;  1VQM F;  1Q7Y H;  5JH7 A;  1W42 A;  5GON A;  4O4L B;  2F9Z C;  3I55 F;  3JAL A;  1KNJ A;  3WXM B;  1IV4 A;  2HRY A;  3I56 F;  3MBM A;  1W5F A;  2UZH A;  3WJR A;  1R1M A;  5HY1 A;  3CMA F;  3T80 A;  2LBW A;  4E6E A;  2VGM A;  3VYT C;  3VCZ A;  3CC2 F;  3LME A;  4B45 A;  3LWV C;  5LYJ B;  3RYF B;  2IQQ A;  3V3T A;  5LXT A;  1K8A H;  4EI9 A;  5IYZ A;  4BT2 A;  1M90 H;  1W5A A;  1GO0 A;  5KX5 A;  4X1K A;  5AVM A;  3HKB B;  4BVT A;  2Z1T A;  2VAW A;  3J7A R;  5HY0 A;  1XBI A;  3M1X A;  5HY2 A;  1W40 A;  3JAT B;  3QUW A;  3F0G A;  1JD1 A;  3FFM A;  2QI2 A;  3CCV F;  3MQW A;  4BW0 B;  1FNJ A;  1NMU B;  4IIJ B;  1COM A;  3JAS B;  2AIF A;  2VGN A;  2VAM A;  3D01 A;  4O4I B;  3SIV A;  2HP3 A;  3IKE A;  4O4J A;  3JAW B;  3J81 M;  3ELC A;  5EYP B;  1IV3 A;  1U3L A;  2GLZ A;  3NVI B;  2GZL A;  5HP8 A;  3JVH A;  1H47 A;  4G4Y A;  1YIT F;  1XHO A;  3KIZ A;  1ODE A;  3P10 A;  1Z5V A;  4ZK7 A;  1YI2 F;  1UFY A;  3I7T A;  3P4E A;  3AGK A;  4BT7 A;  5HWE A;  1VQ9 F;  1Z5W A;  4NWO B;  1QU9 A;  3LWP C;  5MN4 A;  4F6R B;  2AIZ P;  1Q86 H;  1ZWZ A;  5J2T B;  4R40 B;  3HKC A;  3U0O A;  5CB4 B;  3VO8 A;  1TUB B;  5MN5 A;  3F0F A;  3ZP4 A;  2KTV A;  3IMP A;  4WBN A;  3WGJ A;  4C81 A;  3NK6 A;  2LCA A;  3UT5 A;  1FNK A;  2KGW A;  2ZAU A;  3E1Y A;  3TD3 A;  4DRX B;  4ZHQ A;  4EI7 A;  2OZB A;  4LNU B;  1E7K A;  4KWE A;  1DBF A;  3J80 M;  5JQG B;  2OTM A;  2WAL A;  3R0P A;  1W5E A;  5GIO C;  1YGY A;  3P0Z A;  5KMG A;  5KMG B;  2RHO A;  3RE3 A;  1X7O A;  3CCU F;  5JCO A;  5LP6 C;  3QTY A;  4X3M A;  3G71 F;  3RYI A;  1VH8 A;  4PWT A;  4TV9 A;  2JNB A;  3TD4 A;  3I3F A;  2UYK A;  3HWU A;  3ZO8 A;  5B8F A;  5IJ9 A;  4X1I B;  1OFU A;  2QA4 F;  3KJK A;  5HY4 A;  1K73 H;  2ZF8 A;  5FJ4 C;  4X1Y B;  2Z1F A;  4U3J A;  3HKD B;  3LDT A;  5EIB D;  5JVD B;  1FSZ A;  2ZVY A;  2HP0 A;  2K1S A;  5J2U A;  5J2U B;  2L26 A;  1IPA A;  3N4Y A;  3N2G A;  3N2G B;  2ZOD A;  3CCR F;  5IJ0 A;  2ALE A;  3CG6 A; 
#chains in the Genus database with same CATH homology
 1KC8 H;  3CC2 F;  1YHQ F;  2KTU A;  2QEX F;  5IT9 M;  3LWV C;  5EO3 A;  3V3T A;  1K8A H;  4EI9 A;  1VQ7 F;  1M90 H;  5DCV A;  1GO0 A;  1VQ4 F;  2FC3 A;  3PAF A;  4BVT A;  3JAM M;  5GIP C;  1Q82 H;  3V7E A;  1GO1 A;  3J7A R;  5A2Q M;  3O85 A;  2KG4 A;  1XBI A;  5HY0 A;  4TZZ A;  3ON1 A;  5HY2 A;  1W40 A;  3CCE F;  5G4U C;  3FFM A;  2QI2 A;  5GAP K;  3CCV F;  1X7P A;  1VQ8 F;  4BW0 B;  3RA6 A;  1NMU B;  1YIJ F;  1S72 F;  3LWQ C;  3CPW F;  2AIF A;  3LFO A;  2VGN A;  3CXC F;  3SIV A;  4C4W C;  1RLG A;  3N4Z A;  3J81 M;  3GYQ A;  2FGY A;  2LBX A;  3V7Q A;  1W41 A;  2GLZ A;  3NVI B;  1YJW F;  1W3E X;  5GAN K;  3RA5 A;  1YIT F;  3JCM M;  3CCM F;  3LWO C;  1YI2 F;  2I6D A;  4NUT A;  3AGK A;  3VI6 A;  5HXU A;  3OBY A;  5HWE A;  1CN7 A;  1VQ9 F;  3CCL F;  4BY9 D;  3LWP C;  4BVQ A;  1NJI H;  1N8R H;  1YJ9 F;  1M1K H;  1JJ2 F;  1Q86 H;  1ZWZ A;  3CCJ F;  3HJW C;  1QVF F;  1W2B F;  1VQ6 F;  1YJN F;  5EWR A;  2KTV A;  3CD6 F;  5FLX M;  2HVY D;  3NK6 A;  3D00 A;  1KD1 H;  4XCQ A;  1VQP F;  3IR9 A;  1PXW A;  3E1Y A;  3OBW A;  1X52 A;  4X3L A;  3CC4 F;  1VQL F;  1GZ0 A;  3NMU C;  4EI7 A;  2OZB A;  4NQ3 A;  1QVG F;  1E7K A;  1SDS A;  3J80 M;  1VQ5 F;  2WAL A;  5GIO C;  4LCK A;  3CCS F;  1X7O A;  3OW2 F;  3CCU F;  3LWR C;  3G6E F;  3VMF B;  4X3M A;  3G71 F;  1VQN F;  3SIU A;  1VQO F;  5HXZ A;  1RA4 A;  2CZW A;  2JNB A;  4BVS A;  2BO1 A;  2OTL F;  1Q81 H;  3HAX D;  3PLA C;  3G4S F;  3CC7 F;  1DT9 A;  3E20 B;  2QA4 F;  1VQM F;  1Q7Y H;  3CCQ F;  1KQS F;  5HY4 A;  1VQK F;  1K73 H;  5FJ4 C;  1W42 A;  3NK7 A;  4BVR A;  2F9Z C;  3CME F;  3I55 F;  1CK2 A;  3NVK E;  4EI8 A;  3WXM B;  3I56 F;  2OHW A;  1IPA A;  1K9M H;  3CPQ A;  3N4Y A;  1T0K B;  5HY1 A;  3CCR F;  3CMA F;  2OTJ F;  5GIN C;  2LBW A;  2VGM A;  3MCA B;  2ALE A;  3CG6 A;  1H7M A;  5G4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...