1YITF

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yitF00
1ZWZA 2CZWA 3CCUF 3CCVF 2I6DA 1K73H 1YJWF 1IPAA 2OZBA 1QVGF 2OTLF 4BY9D 3CC4F 4NUTA 1W40A 3AGKA 3V7QA 1W42A 3CPQA 5GIPC 3OBYA 3NVKE 1JJ2F 4X3MA 1H7MA 3GYQA 3CCSF 3CD6F 1M90H 1YITF 1T0KB 5FJ4C 1YI2F 1E7KA 1W3EX 1K9MH 3LWRC 3J7AR 3E20B 3LWOC 1VQPF 3FFMA 1VQ8F 3RA6A 3O85A 3MCAB 2QA4F 1VQNF 3CCMF 1RA4A 1SDSA 5GIOC 1X7PA 5FLXM 3I56F 3LWQC 5EWRA 1Q81H 2FC3A 3E1YA 2BO1A 3J80M 3CCEF 1YHQF 1N8RH 1VQ9F 3JCMM 4BW0B 1KQSF 1W2BF 3G4SF 5A2QM 5G4UC 1KC8H 2OTJF 1CK2A 3N4ZA 3G71F 1VQ5F 2HVYD 3V7EA 2LBWA 2LBXA 3CCRF 1YJ9F 1YJNF 1VQKF 1NJIH 3RA5A 2OHWA 3SIUA 1X7OA 1M1KH 1VQ6F 3PLAC 1VQ7F 1VQ4F 3LFOA 3CC7F 5GANK 3JAMM 1GO0A 3CG6A 1DT9A 3HAXD 3CCQF 3VMFB 2QI2A 1NMUB 3N4YA 1Q86H 3IR9A 3G6EF 1Q82H 1KD1H 4C4WC 3NMUC 2VGMA 2KG4A 1RLGA 1Q7YH 1VQMF 3I55F 3CCJF 1X52A 1YIJF 2VGNA 3LWPC 2WALA 3VI6A 1GZ0A 3SIVA 3NVIB 3LWVC 4TZZA 3J81M 4X3LA 3PAFA 1K8AH 3ON1A 3CXCF 1VQLF 2AIFA 1CN7A 3HJWC 1PXWA 4LCKA 1VQOF 2KTVA 1XBIA 2QEXF 2ALEA 5GINC 5GAPK 5G4VC 3CMEF 3CPWF 3CCLF 3NK6A 5IT9M 3WXMB 2JNBA 1QVFF 2KTUA 1W41A 3OW2F 3CC2F 5EO3A 5DCVA 3CMAF 3NK7A 1S72F 1GO1A 3OBWA
chains in the Genus database with same CATH superfamily
3QUWA 2NMUA 3HKBA 3M1XA 5CB4A 3IMPA 1U3PA 1QVGF 4ZK7A 3VOBA 2HP0B 4NUTA 1W40A 4HNAA 5JQGB 5EB1B 3RYIB 2H6LA 4O2AB 2RB9A 3ZP4A 3NVKE 4BT6A 5EYPB 3CCSF 3S02A 3KIZA 4I4TB 4B5CA 2I6RA 2HP3A 4EI9A 1T0KB 5LP6C 1YI2F 1W3EX 1K9MH 3C8LA 4C8IA 3E20B 1VQPF 3FFMA 3WJQA 1VQ8F 1YGYA 3RA6A 5EIBC 3EORA 2QTPA 3CCMF 1R1MA 2UYJA 1SDSA 3E22A 4I55B 3RE3A 3QHDA 4YJ3A 5EWRA 3FBAA 4G4YA 2AIZP 3CCEF 1YHQF 1VQ9F 5LOVB 3F6MA 4FFBB 2IG8A 1KQSF 3MDOA 4BT4A 3CYQA 1W2BF 3G4SF 4IIJB 5A2QM 5G4UC 4O2BB 4WBNA 3MQWA 3CCRF 1OFUA 1NJIH 2OHWA 2CVLA 3CYPB 4O4IB 4O2BA 1VQ4F 5JH7B 1COMA 3HAXD 1DT9A 3CCQF 1IV4A 2CHSA 2QI2A 1NMUB 3VYSC 1IV1A 1VQVA 3IR9A 3G6EF 1Q82H 4C4WC 2HRYA 2VGMA 2RHLA 1RLGA 1U3LA 3VCZA 1Q7YH 3I55F 2UYNB 1PF5A 2BTUA 3WJPA 1X52A 1YIJF 3VI6A 4XCQA 5LA6A 5IJ9A 2VAPA 3SIVA 3HKDB 2UZHA 5HXUA 4U3JA 3RYCB 1VQLF 5EZYB 1PXWA 5IJ9B 5FNVA 2KTVA 2FGYA 3DC2A 4ZHVA 3CCLF 4ZOLB 2YYEA 3NK6A 2Z1FA 2KGWA 3OW2F 2HX0A 1SA0B 1W581 4KWEA 5EO3A 5HY1A 4X1KB 5J2TB 3OBWA 1ZWZA 2Z1TA 3CCUF 4LNUA 1TVKA 1IPAA 3GTZA 1SZQA 4NQ3A 3ELCA 1Z5VA 2CW4A 3V7QA 1QD9A 3CPQA 1KNJA 2F9ZC 1JJ2F 3VOAA 4BVRA 2RHOA 1H7MA 3IKFA 2Z01A 3D54A 5IJ0A 3JALB 5AVMA 1W57A 5FJ4C 1E7KA 4O4IA 1VK3A 4WBNB 4R40B 3MBMA 1U43A 1JN1A 4RQOA 2VXYA 4X1YB 2BTQB 4EI7A 1X7PA 2CSLA 3LMEA 3LWQC 2R751 1QU9A 3IKEA 4B45A 1Q81H 3J80M 1N8RH 3JCMM 2VAWA 4YJ3B 4BW0B 4BT2A 5HP8A 4C81A 3JASA 2VAMA 1KC8H 1TVKB 1W5EA 3N4ZA 5KX5A 1IV2A 1VQ5F 3V7EA 4U3JB 3RYCA 4HNAB 5LOVA 1M1KH 3SIUA 3ZOPA 3PLAC 1W5AA 3M4SA 5LA6B 4I4TA 4TUYA 5GONA 4YJ2A 3M84A 3VMFB 3N4YA 3V4DA 3CB2A 3WPXA 3NMUC 3TD5A 5HY0A 3D01A 1FNKA 1FSZA 3U0OA 3N2GB 2GZLA 3CCJF 5JVDA 4BVQA 3WGJA 3RYFB 1GZ0A 1H47A 4O4LA 3PAFA 3JAWB 1K8AH 5IYZB 3F0EA 4ZHQB 2HS4A 3N2KA 4O2AA 2DT4A 3V3TA 2GVIA 3VYUC 3K2XA 4IIJA 5JCOC 3JVHA 1XBIA 5GINC 3N2GA 3CPWF 4O4JB 2JNBA 5KX5B 3N2KB 1RLUA 1VH8A 4X20B 5CA0B 3D00A 3VIUA 5IYZA 4DRXA 2CZWA 1DBFA 2I6DA 1FFXB 4TUYB 3S0HA 4TV8B 2B33A 5HY4A 1OAPA 2OZBA 2H8CA 2ZVZA 3WGNA 2OTLF 2H8EA 3CC4F 4BVSA 3AGKA 5BMVA 4C82A 4G4VA 1W42A 3FPIA 3WGLA 3F0DA 1T0AA 3OONA 3F0FA 5KMGB 5LYJA 5FNVB 3CD6F 4M8IA 5C8YA 1VHAA 2YXZA 4B46A 5MN4A 1YITF 1W59A 1M90H 3JATA 3DDNA 1TUBB 4IHJB 4BT7A 3LWRC 1W5BA 1W5FA 3WGKA 3LWOC 3BYQA 2OTMA 4EB6A 3JASB 3KJJA 5JH7A 2CWJA 3MCAB 2QA4F 5JCOA 2Z1EA 1GX1A 4ZOLA 3UT5A 2ZAUA 5GIOC 2P6YA 1QAHA 3ESJA 4EB6B 4TV9B 1JY8A 3S0WA 2IQQA 4BT3A 5EB0A 3WPWA 3KHNA 2LBTA 4C8GA 3K12A 4RHAA 1CK2A 4TV8A 4F6RB 5LP6A 2HVYD 4TV9A 3WGMA 2L26A 3C9RA 5J2UA 1VQKF 3RA5A 1X7OA 3FD6A 3VYTC 1XHOA 5HWEA 2HQSC 1YQNA 4G88A 1VQ7F 2HS0A 2UYKA 5GANK 3JAMM 3JALA 1JFFA 2R6R1 4O4HA 1SA0A 1Q86H 2ZVYA 3VO8A 5C8YB 5MN6A 3JATB 2ZOVA 5CA1A 2KG4A 1XRGA 3HKBB 4I55A 3L7QA 2ZF8A 2VGNA 2WALA 4LNUB 4ZHYB 2RHHA 4BVTA 4U39A 3LWVC 2Q1YA 3J81M 4X3LA 2GLZA 3P4EA 4X1IB 1RQ2A 3CXCF 1JFFB 2AIFA 2BTOA 3P0ZA 3JAWA 3C9SA 4I50B 3VTIC 3JARB 2ALEA 3S03A 5GAPK 5G4VC 3CMEF 3HKCB 5J2UB 1W55A 3KE1A 2KTUA 5GONB 1W41A 2ZODA 5DCVA 2HP0A 3QTYA 3IEQA 2V9YA 1RQ7A 4O4JA 1GO1A 4G4ZA 3LDTA 3CCVF 3GHZA 4PWTA 3KJKA 3S0YA 1K73H 1YJWF 3HKEA 2Q1XA 4BY9D 3R0PA 5MN5A 3C9TA 4O4LB 3RYHB 1KNKA 3Q8HA 5EZYA 2LCAA 3S06A 5GIPC 3OBYA 5JVDB 1H48A 4X3MA 3MCQA 3GYQA 4NWOB 1UI9A 4ZHQA 4DXDA 5LYJB 3E22B 3J7AR 1IV3A 3HWUA 4YJ2B 4I50A 4F6RA 5LP6B 4X20A 2W8BC 3WJRA 3O85A 3T80A 1ODEA 5HP7A 1VQNF 2EWCA 3LYBA 1RA4A 1U40A 4FFBA 1TUBA 3F0GA 1CLIA 5FLXM 3K0TA 3I56F 2Z1UA 3B6NA 3HTNA 2FC3A 3E1YA 2BO1A 2UYPA 5B8FA 4DRXB 5EYPA 3UT5B 3ZO8A 2IAFA 5CA1B 2RHJA 5EIBD 3RYFA 5IJ0B 2OTJF 3I3FA 5BMVB 3G71F 2HRUA 2LBXA 5EAZA 2LBWA 1YJ9F 1YJNF 4G4XA 4B62A 3TD3A 4X1KA 5J2TA 1VQ6F 3ERNA 3RYHA 2K1SA 5ITZB 3LFOA 4G4WA 3CC7F 4EI8A 3FD5A 1GO0A 3CG6A 4ZI7A 1XV2A 3HKCA 5KMGA 1Z5WA 5CA0A 2PHNA 4BT5A 2DYYA 1ONIA 3C9UA 1KD1H 5HXZA 3JAKB 3IEWA 5ITZA 3TD4A 5LXTA 1VQMF 3RYIA 2AMTA 1J7HA 4O4HB 4E6EA 3HKDA 3LWPC 1FFXA 4ERHA 3JAKA 3NVIB 3ZP7A 1NQ3A 4ZHWA 2CHTA 4TZZA 4C8EA 3K14A 3ON1A 3P10A 1JD1A 1CN7A 3HKEB 3HJWC 4LCKA 1VQOF 2PMPA 3I7TA 4X1IA 5JQGA 1X25A 2QEXF 5IT9M 1Q8RA 2HS3A 5LXTB 3WXMB 4IHJA 1QVFF 1UFYA 4X1YA 5CB4B 2MQEA 2G9IA 3CC2F 2N48A 5HY2A 3CMAF 1FNJA 3JARA 3NK7A 2UYNA 1S72F 4ZI7B
chains in the Genus database with same CATH topology
1ZWZA 2CZWA 3CCUF 3CCVF 2I6DA 5HY4A 1YJWF 1IPAA 1K73H 2OZBA 1QVGF 2OTLF 4BY9D 4NQ3A 3CC4F 4NUTA 1W40A 4BVSA 3AGKA 3V7QA 1W42A 3CPQA 2F9ZC 5GIPC 3OBYA 3NVKE 1JJ2F 4BVRA 4X3MA 1H7MA 3GYQA 3CCSF 3CD6F 1M90H 1YITF 4EI9A 1T0KB 5FJ4C 1YI2F 1E7KA 1W3EX 1K9MH 3LWRC 3J7AR 3E20B 3LWOC 1VQPF 3FFMA 1VQ8F 3RA6A 3O85A 3MCAB 2QA4F 1VQNF 3CCMF 1RA4A 1SDSA 4EI7A 5GIOC 1X7PA 5FLXM 3I56F 3LWQC 5EWRA 1Q81H 2FC3A 3E1YA 2BO1A 3J80M 3CCEF 1YHQF 1N8RH 1VQ9F 3JCMM 4BW0B 1KQSF 1W2BF 3G4SF 5A2QM 5G4UC 1KC8H 2OTJF 1CK2A 3N4ZA 3G71F 1VQ5F 2HVYD 3V7EA 2LBWA 2LBXA 3CCRF 1YJ9F 1YJNF 1VQKF 1NJIH 3RA5A 2OHWA 3SIUA 1X7OA 1M1KH 1VQ6F 5HWEA 3PLAC 1VQ7F 1VQ4F 3LFOA 3CC7F 4EI8A 5GANK 3JAMM 1GO0A 3CG6A 1DT9A 3HAXD 3CCQF 3VMFB 2QI2A 1NMUB 3N4YA 1Q86H 3IR9A 3G6EF 1Q82H 1KD1H 4C4WC 5HXZA 3NMUC 2VGMA 2KG4A 1RLGA 1Q7YH 1VQMF 5HY0A 3I55F 3CCJF 1X52A 1YIJF 2VGNA 2WALA 3VI6A 3LWPC 4XCQA 4BVQA 1GZ0A 4BVTA 3SIVA 3NVIB 3LWVC 4TZZA 3J81M 4X3LA 3PAFA 5HXUA 2GLZA 1K8AH 3ON1A 3CXCF 1VQLF 2AIFA 1CN7A 3HJWC 1PXWA 3V3TA 4LCKA 1VQOF 2KTVA 2FGYA 1XBIA 2QEXF 2ALEA 5GINC 5GAPK 5G4VC 3CMEF 3CPWF 3CCLF 3NK6A 5IT9M 3WXMB 2JNBA 1QVFF 2KTUA 1W41A 3OW2F 3CC2F 3D00A 5EO3A 5HY1A 5DCVA 5HY2A 3CMAF 3NK7A 1S72F 1GO1A 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  2CZW A;  3CCU F;  3CCV F;  2I6D A;  1K73 H;  1YJW F;  1IPA A;  2OZB A;  1QVG F;  2OTL F;  4BY9 D;  3CC4 F;  4NUT A;  1W40 A;  3AGK A;  3V7Q A;  1W42 A;  3CPQ A;  5GIP C;  3OBY A;  3NVK E;  1JJ2 F;  4X3M A;  1H7M A;  3GYQ A;  3CCS F;  3CD6 F;  1M90 H;  1YIT F;  1T0K B;  5FJ4 C;  1YI2 F;  1E7K A;  1W3E X;  1K9M H;  3LWR C;  3J7A R;  3E20 B;  3LWO C;  1VQP F;  3FFM A;  1VQ8 F;  3RA6 A;  3O85 A;  3MCA B;  2QA4 F;  1VQN F;  3CCM F;  1RA4 A;  1SDS A;  5GIO C;  1X7P A;  5FLX M;  3I56 F;  3LWQ C;  5EWR A;  1Q81 H;  2FC3 A;  3E1Y A;  2BO1 A;  3J80 M;  3CCE F;  1YHQ F;  1N8R H;  1VQ9 F;  3JCM M;  4BW0 B;  1KQS F;  1W2B F;  3G4S F;  5A2Q M;  5G4U C;  1KC8 H;  2OTJ F;  1CK2 A;  3N4Z A;  3G71 F;  1VQ5 F;  2HVY D;  3V7E A;  2LBW A;  2LBX A;  3CCR F;  1YJ9 F;  1YJN F;  1VQK F;  1NJI H;  3RA5 A;  2OHW A;  3SIU A;  1X7O A;  1M1K H;  1VQ6 F;  3PLA C;  1VQ7 F;  1VQ4 F;  3LFO A;  3CC7 F;  5GAN K;  3JAM M;  1GO0 A;  3CG6 A;  1DT9 A;  3HAX D;  3CCQ F;  3VMF B;  2QI2 A;  1NMU B;  3N4Y A;  1Q86 H;  3IR9 A;  3G6E F;  1Q82 H;  1KD1 H;  4C4W C;  3NMU C;  2VGM A;  2KG4 A;  1RLG A;  1Q7Y H;  1VQM F;  3I55 F;  3CCJ F;  1X52 A;  1YIJ F;  2VGN A;  3LWP C;  2WAL A;  3VI6 A;  1GZ0 A;  3SIV A;  3NVI B;  3LWV C;  4TZZ A;  3J81 M;  4X3L A;  3PAF A;  1K8A H;  3ON1 A;  3CXC F;  1VQL F;  2AIF A;  1CN7 A;  3HJW C;  1PXW A;  4LCK A;  1VQO F;  2KTV A;  1XBI A;  2QEX F;  2ALE A;  5GIN C;  5GAP K;  5G4V C;  3CME F;  3CPW F;  3CCL F;  3NK6 A;  5IT9 M;  3WXM B;  2JNB A;  1QVF F;  2KTU A;  1W41 A;  3OW2 F;  3CC2 F;  5EO3 A;  5DCV A;  3CMA F;  3NK7 A;  1S72 F;  1GO1 A;  3OBW A; 
#chains in the Genus database with same CATH topology
 3QUW A;  2NMU A;  3HKB A;  3M1X A;  5CB4 A;  3IMP A;  1U3P A;  1QVG F;  4ZK7 A;  3VOB A;  2HP0 B;  4NUT A;  1W40 A;  4HNA A;  5JQG B;  5EB1 B;  3RYI B;  2H6L A;  4O2A B;  2RB9 A;  3ZP4 A;  3NVK E;  4BT6 A;  5EYP B;  3CCS F;  3S02 A;  3KIZ A;  4I4T B;  4B5C A;  2I6R A;  2HP3 A;  4EI9 A;  1T0K B;  5LP6 C;  1YI2 F;  1W3E X;  1K9M H;  3C8L A;  4C8I A;  3E20 B;  1VQP F;  3FFM A;  3WJQ A;  1VQ8 F;  1YGY A;  3RA6 A;  5EIB C;  3EOR A;  2QTP A;  3CCM F;  1R1M A;  2UYJ A;  1SDS A;  3E22 A;  4I55 B;  3RE3 A;  3QHD A;  4YJ3 A;  5EWR A;  3FBA A;  4G4Y A;  2AIZ P;  3CCE F;  1YHQ F;  1VQ9 F;  5LOV B;  3F6M A;  4FFB B;  2IG8 A;  1KQS F;  3MDO A;  4BT4 A;  3CYQ A;  1W2B F;  3G4S F;  4IIJ B;  5A2Q M;  5G4U C;  4O2B B;  4WBN A;  3MQW A;  3CCR F;  1OFU A;  1NJI H;  2OHW A;  2CVL A;  3CYP B;  4O4I B;  4O2B A;  1VQ4 F;  5JH7 B;  1COM A;  3HAX D;  1DT9 A;  3CCQ F;  1IV4 A;  2CHS A;  2QI2 A;  1NMU B;  3VYS C;  1IV1 A;  1VQV A;  3IR9 A;  3G6E F;  1Q82 H;  4C4W C;  2HRY A;  2VGM A;  2RHL A;  1RLG A;  1U3L A;  3VCZ A;  1Q7Y H;  3I55 F;  2UYN B;  1PF5 A;  2BTU A;  3WJP A;  1X52 A;  1YIJ F;  3VI6 A;  4XCQ A;  5LA6 A;  5IJ9 A;  2VAP A;  3SIV A;  3HKD B;  2UZH A;  5HXU A;  4U3J A;  3RYC B;  1VQL F;  5EZY B;  1PXW A;  5IJ9 B;  5FNV A;  2KTV A;  2FGY A;  3DC2 A;  4ZHV A;  3CCL F;  4ZOL B;  2YYE A;  3NK6 A;  2Z1F A;  2KGW A;  3OW2 F;  2HX0 A;  1SA0 B;  1W58 1;  4KWE A;  5EO3 A;  5HY1 A;  4X1K B;  5J2T B;  3OBW A;  1ZWZ A;  2Z1T A;  3CCU F;  4LNU A;  1TVK A;  1IPA A;  3GTZ A;  1SZQ A;  4NQ3 A;  3ELC A;  1Z5V A;  2CW4 A;  3V7Q A;  1QD9 A;  3CPQ A;  1KNJ A;  2F9Z C;  1JJ2 F;  3VOA A;  4BVR A;  2RHO A;  1H7M A;  3IKF A;  2Z01 A;  3D54 A;  5IJ0 A;  3JAL B;  5AVM A;  1W57 A;  5FJ4 C;  1E7K A;  4O4I A;  1VK3 A;  4WBN B;  4R40 B;  3MBM A;  1U43 A;  1JN1 A;  4RQO A;  2VXY A;  4X1Y B;  2BTQ B;  4EI7 A;  1X7P A;  2CSL A;  3LME A;  3LWQ C;  2R75 1;  1QU9 A;  3IKE A;  4B45 A;  1Q81 H;  3J80 M;  1N8R H;  3JCM M;  2VAW A;  4YJ3 B;  4BW0 B;  4BT2 A;  5HP8 A;  4C81 A;  3JAS A;  2VAM A;  1KC8 H;  1TVK B;  1W5E A;  3N4Z A;  5KX5 A;  1IV2 A;  1VQ5 F;  3V7E A;  4U3J B;  3RYC A;  4HNA B;  5LOV A;  1M1K H;  3SIU A;  3ZOP A;  3PLA C;  1W5A A;  3M4S A;  5LA6 B;  4I4T A;  4TUY A;  5GON A;  4YJ2 A;  3M84 A;  3VMF B;  3N4Y A;  3V4D A;  3CB2 A;  3WPX A;  3NMU C;  3TD5 A;  5HY0 A;  3D01 A;  1FNK A;  1FSZ A;  3U0O A;  3N2G B;  2GZL A;  3CCJ F;  5JVD A;  4BVQ A;  3WGJ A;  3RYF B;  1GZ0 A;  1H47 A;  4O4L A;  3PAF A;  3JAW B;  1K8A H;  5IYZ B;  3F0E A;  4ZHQ B;  2HS4 A;  3N2K A;  4O2A A;  2DT4 A;  3V3T A;  2GVI A;  3VYU C;  3K2X A;  4IIJ A;  5JCO C;  3JVH A;  1XBI A;  5GIN C;  3N2G A;  3CPW F;  4O4J B;  2JNB A;  5KX5 B;  3N2K B;  1RLU A;  1VH8 A;  4X20 B;  5CA0 B;  3D00 A;  3VIU A;  5IYZ A;  4DRX A;  2CZW A;  1DBF A;  2I6D A;  1FFX B;  4TUY B;  3S0H A;  4TV8 B;  2B33 A;  5HY4 A;  1OAP A;  2OZB A;  2H8C A;  2ZVZ A;  3WGN A;  2OTL F;  2H8E A;  3CC4 F;  4BVS A;  3AGK A;  5BMV A;  4C82 A;  4G4V A;  1W42 A;  3FPI A;  3WGL A;  3F0D A;  1T0A A;  3OON A;  3F0F A;  5KMG B;  5LYJ A;  5FNV B;  3CD6 F;  4M8I A;  5C8Y A;  1VHA A;  2YXZ A;  4B46 A;  5MN4 A;  1YIT F;  1W59 A;  1M90 H;  3JAT A;  3DDN A;  1TUB B;  4IHJ B;  4BT7 A;  3LWR C;  1W5B A;  1W5F A;  3WGK A;  3LWO C;  3BYQ A;  2OTM A;  4EB6 A;  3JAS B;  3KJJ A;  5JH7 A;  2CWJ A;  3MCA B;  2QA4 F;  5JCO A;  2Z1E A;  1GX1 A;  4ZOL A;  3UT5 A;  2ZAU A;  5GIO C;  2P6Y A;  1QAH A;  3ESJ A;  4EB6 B;  4TV9 B;  1JY8 A;  3S0W A;  2IQQ A;  4BT3 A;  5EB0 A;  3WPW A;  3KHN A;  2LBT A;  4C8G A;  3K12 A;  4RHA A;  1CK2 A;  4TV8 A;  4F6R B;  5LP6 A;  2HVY D;  4TV9 A;  3WGM A;  2L26 A;  3C9R A;  5J2U A;  1VQK F;  3RA5 A;  1X7O A;  3FD6 A;  3VYT C;  1XHO A;  5HWE A;  2HQS C;  1YQN A;  4G88 A;  1VQ7 F;  2HS0 A;  2UYK A;  5GAN K;  3JAM M;  3JAL A;  1JFF A;  2R6R 1;  4O4H A;  1SA0 A;  1Q86 H;  2ZVY A;  3VO8 A;  5C8Y B;  5MN6 A;  3JAT B;  2ZOV A;  5CA1 A;  2KG4 A;  1XRG A;  3HKB B;  4I55 A;  3L7Q A;  2ZF8 A;  2VGN A;  2WAL A;  4LNU B;  4ZHY B;  2RHH A;  4BVT A;  4U39 A;  3LWV C;  2Q1Y A;  3J81 M;  4X3L A;  2GLZ A;  3P4E A;  4X1I B;  1RQ2 A;  3CXC F;  1JFF B;  2AIF A;  2BTO A;  3P0Z A;  3JAW A;  3C9S A;  4I50 B;  3VTI C;  3JAR B;  2ALE A;  3S03 A;  5GAP K;  5G4V C;  3CME F;  3HKC B;  5J2U B;  1W55 A;  3KE1 A;  2KTU A;  5GON B;  1W41 A;  2ZOD A;  5DCV A;  2HP0 A;  3QTY A;  3IEQ A;  2V9Y A;  1RQ7 A;  4O4J A;  1GO1 A;  4G4Z A;  3LDT A;  3CCV F;  3GHZ A;  4PWT A;  3KJK A;  3S0Y A;  1K73 H;  1YJW F;  3HKE A;  2Q1X A;  4BY9 D;  3R0P A;  5MN5 A;  3C9T A;  4O4L B;  3RYH B;  1KNK A;  3Q8H A;  5EZY A;  2LCA A;  3S06 A;  5GIP C;  3OBY A;  5JVD B;  1H48 A;  4X3M A;  3MCQ A;  3GYQ A;  4NWO B;  1UI9 A;  4ZHQ A;  4DXD A;  5LYJ B;  3E22 B;  3J7A R;  1IV3 A;  3HWU A;  4YJ2 B;  4I50 A;  4F6R A;  5LP6 B;  4X20 A;  2W8B C;  3WJR A;  3O85 A;  3T80 A;  1ODE A;  5HP7 A;  1VQN F;  2EWC A;  3LYB A;  1RA4 A;  1U40 A;  4FFB A;  1TUB A;  3F0G A;  1CLI A;  5FLX M;  3K0T A;  3I56 F;  2Z1U A;  3B6N A;  3HTN A;  2FC3 A;  3E1Y A;  2BO1 A;  2UYP A;  5B8F A;  4DRX B;  5EYP A;  3UT5 B;  3ZO8 A;  2IAF A;  5CA1 B;  2RHJ A;  5EIB D;  3RYF A;  5IJ0 B;  2OTJ F;  3I3F A;  5BMV B;  3G71 F;  2HRU A;  2LBX A;  5EAZ A;  2LBW A;  1YJ9 F;  1YJN F;  4G4X A;  4B62 A;  3TD3 A;  4X1K A;  5J2T A;  1VQ6 F;  3ERN A;  3RYH A;  2K1S A;  5ITZ B;  3LFO A;  4G4W A;  3CC7 F;  4EI8 A;  3FD5 A;  1GO0 A;  3CG6 A;  4ZI7 A;  1XV2 A;  3HKC A;  5KMG A;  1Z5W A;  5CA0 A;  2PHN A;  4BT5 A;  2DYY A;  1ONI A;  3C9U A;  1KD1 H;  5HXZ A;  3JAK B;  3IEW A;  5ITZ A;  3TD4 A;  5LXT A;  1VQM F;  3RYI A;  2AMT A;  1J7H A;  4O4H B;  4E6E A;  3HKD A;  3LWP C;  1FFX A;  4ERH A;  3JAK A;  3NVI B;  3ZP7 A;  1NQ3 A;  4ZHW A;  2CHT A;  4TZZ A;  4C8E A;  3K14 A;  3ON1 A;  3P10 A;  1JD1 A;  1CN7 A;  3HKE B;  3HJW C;  4LCK A;  1VQO F;  2PMP A;  3I7T A;  4X1I A;  5JQG A;  1X25 A;  2QEX F;  5IT9 M;  1Q8R A;  2HS3 A;  5LXT B;  3WXM B;  4IHJ A;  1QVF F;  1UFY A;  4X1Y A;  5CB4 B;  2MQE A;  2G9I A;  3CC2 F;  2N48 A;  5HY2 A;  3CMA F;  1FNJ A;  3JAR A;  3NK7 A;  2UYN A;  1S72 F;  4ZI7 B; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  2CZW A;  3CCU F;  3CCV F;  2I6D A;  5HY4 A;  1YJW F;  1IPA A;  1K73 H;  2OZB A;  1QVG F;  2OTL F;  4BY9 D;  4NQ3 A;  3CC4 F;  4NUT A;  1W40 A;  4BVS A;  3AGK A;  3V7Q A;  1W42 A;  3CPQ A;  2F9Z C;  5GIP C;  3OBY A;  3NVK E;  1JJ2 F;  4BVR A;  4X3M A;  1H7M A;  3GYQ A;  3CCS F;  3CD6 F;  1M90 H;  1YIT F;  4EI9 A;  1T0K B;  5FJ4 C;  1YI2 F;  1E7K A;  1W3E X;  1K9M H;  3LWR C;  3J7A R;  3E20 B;  3LWO C;  1VQP F;  3FFM A;  1VQ8 F;  3RA6 A;  3O85 A;  3MCA B;  2QA4 F;  1VQN F;  3CCM F;  1RA4 A;  1SDS A;  4EI7 A;  5GIO C;  1X7P A;  5FLX M;  3I56 F;  3LWQ C;  5EWR A;  1Q81 H;  2FC3 A;  3E1Y A;  2BO1 A;  3J80 M;  3CCE F;  1YHQ F;  1N8R H;  1VQ9 F;  3JCM M;  4BW0 B;  1KQS F;  1W2B F;  3G4S F;  5A2Q M;  5G4U C;  1KC8 H;  2OTJ F;  1CK2 A;  3N4Z A;  3G71 F;  1VQ5 F;  2HVY D;  3V7E A;  2LBW A;  2LBX A;  3CCR F;  1YJ9 F;  1YJN F;  1VQK F;  1NJI H;  3RA5 A;  2OHW A;  3SIU A;  1X7O A;  1M1K H;  1VQ6 F;  5HWE A;  3PLA C;  1VQ7 F;  1VQ4 F;  3LFO A;  3CC7 F;  4EI8 A;  5GAN K;  3JAM M;  1GO0 A;  3CG6 A;  1DT9 A;  3HAX D;  3CCQ F;  3VMF B;  2QI2 A;  1NMU B;  3N4Y A;  1Q86 H;  3IR9 A;  3G6E F;  1Q82 H;  1KD1 H;  4C4W C;  5HXZ A;  3NMU C;  2VGM A;  2KG4 A;  1RLG A;  1Q7Y H;  1VQM F;  5HY0 A;  3I55 F;  3CCJ F;  1X52 A;  1YIJ F;  2VGN A;  2WAL A;  3VI6 A;  3LWP C;  4XCQ A;  4BVQ A;  1GZ0 A;  4BVT A;  3SIV A;  3NVI B;  3LWV C;  4TZZ A;  3J81 M;  4X3L A;  3PAF A;  5HXU A;  2GLZ A;  1K8A H;  3ON1 A;  3CXC F;  1VQL F;  2AIF A;  1CN7 A;  3HJW C;  1PXW A;  3V3T A;  4LCK A;  1VQO F;  2KTV A;  2FGY A;  1XBI A;  2QEX F;  2ALE A;  5GIN C;  5GAP K;  5G4V C;  3CME F;  3CPW F;  3CCL F;  3NK6 A;  5IT9 M;  3WXM B;  2JNB A;  1QVF F;  2KTU A;  1W41 A;  3OW2 F;  3CC2 F;  3D00 A;  5EO3 A;  5HY1 A;  5DCV A;  5HY2 A;  3CMA F;  3NK7 A;  1S72 F;  1GO1 A;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...