1YITF

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome/antibiotic
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yitF00
2WALA 5GINC 1Q86H 4C4WC 2JNBA 1KD1H 3N4ZA 2KG4A 3WXMB 3VMFB 3LWOC 4X3LA 1VQ7F 4BY9D 1QVFF 3G4SF 1W3EX 2OZBA 3CCSF 2HVYD 1ZWZA 3RA5A 3NMUC 3CMEF 1NMUB 5GANK 1KC8H 2LBXA 1W2BF 1YIJF 1KQSF 2QEXF 3AGKA 5DCVA 1X7PA 1M1KH 1DT9A 3PLAC 3LWQC 3VI6A 3CXCF 3ON1A 1PXWA 1GO0A 3CCVF 2BO1A 3NK6A 2OTLF 1GO1A 3CPQA 1X52A 1VQOF 3HJWC 3I55F 1N8RH 3O85A 1S72F 3LFOA 5G4VC 2QI2A 2KTVA 3MCAB 3CPWF 5FJ4C 2VGNA 1CK2A 1RLGA 3G71F 1VQ9F 3G6EF 3NVKE 1CN7A 3CCLF 1Q82H 1RA4A 1VQMF 3OBWA 1JJ2F 1E7KA 1SDSA 3LWPC 2AIFA 3OBYA 1K9MH 3CCQF 3CD6F 3SIVA 3GYQA 2I6DA 2OTJF 1W42A 3IR9A 5FLXM 2LBWA 1W40A 4X3MA 1VQ8F 1VQ6F 5GIPC 5EWRA 2QA4F 1GZ0A 3JCMM 2OHWA 1Q81H 3FFMA 3V7QA 1YHQF 1YITF 5GIOC 1YJWF 1YJ9F 1IPAA 1W41A 1YJNF 3CMAF 1VQ5F 3J7AR 2CZWA 2KTUA 3HAXD 4LCKA 5IT9M 1M90H 2FC3A 3E1YA 3SIUA 3J81M 3CC2F 3CCJF 1VQNF 5G4UC 3CCMF 3CCEF 1T0KB 4NUTA 3LWRC 1YI2F 1Q7YH 3N4YA 2VGMA 3PAFA 5GAPK 3CCRF 3J80M 1NJIH 1VQKF 3CC7F 1K73H 3NK7A 3JAMM 1H7MA 3CC4F 4TZZA 3LWVC 5EO3A 3RA6A 3I56F 1K8AH 3OW2F 1XBIA 1VQ4F 3V7EA 3CG6A 3NVIB 1VQLF 2ALEA 1X7OA 3E20B 5A2QM 1VQPF 1QVGF 3CCUF 4BW0B
chains in the Genus database with same CATH superfamily
3JALA 2GLZA 4C4WC 4O4JB 4ZHYB 2JNBA 1KD1H 4X1IA 5J2TA 3M84A 2I6RA 3WXMB 3VMFB 3LWOC 4B46A 3JAWA 1U3PA 2RB9A 3B6NA 1W5BA 4X20A 1TUBB 3QHDA 4BVTA 3CCSF 1ZWZA 4YJ2B 5EIBC 1IV3A 3VYTC 1KC8H 2UYNA 1W2BF 5BMVA 2IAFA 3K14A 1KQSF 2QEXF 2AIZP 2HQSC 1IV2A 3WGMA 2L26A 3HKDB 4RHAA 3LWQC 4IIJA 3I7TA 4HNAA 3K2XA 4F6RA 3VO8A 2BO1A 3NK6A 2OTLF 1FNKA 1FSZA 3F0EA 2F9ZC 3V3TA 3LFOA 1XRGA 5G4VC 2KTVA 1JFFA 2VGNA 4ZOLA 3S0WA 4ZHQB 3WPXA 1VQ9F 3G6EF 3DC2A 2HS3A 3N2KB 3P0ZA 1UI9A 4C8GA 2HP3A 5IYZA 4G88A 3JAKA 1YGYA 2RHJA 1VQMF 3OBWA 1SDSA 1COMA 3EORA 5CA0B 4U3JA 3N2GA 2AIFA 3KE1A 4O4IA 5KMGA 3TD4A 3JASB 5CB4A 3S06A 3HKCA 1KNJA 4XCQA 1W40A 4O4JA 1VQ8F 5GIPC 1VQVA 2RHLA 4O4LB 3JCMM 2CSLA 3JARA 3MBMA 5AVMA 2G9IA 2IQQA 3V7QA 1YHQF 3HTNA 2EWCA 1IPAA 1YJ9F 1YJNF 1VQ5F 3HAXD 5HY4A 4YJ3B 3IEQA 4O4IB 5KMGB 2AMTA 3S03A 4LNUA 3CYPB 2HRYA 2NMUA 1YQNA 5FNVA 1T0KB 4G4ZA 4NUTA 1Q8RA 2N48A 4O4LA 3CCRF 5ITZA 1NJIH 4B5CA 1NQ3A 3RYFA 4DXDA 4ZI7B 4I4TB 4RQOA 4BVSA 3CYQA 5LP6C 3HKBB 1H7MA 3LWVC 1SA0A 1XBIA 3V7EA 5KX5B 5HP7A 1VQLF 3E20B 5A2QM 5LOVA 5J2UA 1VQPF 3N2KA 3M1XA 5HP8A 1Q86H 3WGLA 2KG4A 5CB4B 2DYYA 1RLUA 3BYQA 1QVFF 4I4TA 4WBNA 2OZBA 1VK3A 2RHHA 3S0YA 1X25A 4B62A 4EI7A 1YIJF 1R1MA 2CHTA 2VAWA 3AGKA 5DCVA 1DBFA 1X7PA 5LP6A 1M1KH 4DRXB 3TD3A 3MDOA 2W8BC 5LXTB 3VI6A 1XHOA 2Z1FA 1VH8A 3JASA 2UYKA 4I55A 3CCVF 1GO0A 3LMEA 3ELCA 3ERNA 3ZO8A 5JH7A 1VQOF 3HJWC 4WBNB 2UYJA 4EI9A 5LYJA 4C82A 3S0HA 1H47A 1W55A 3CPWF 5FJ4C 4C8IA 1T0AA 1W57A 3JALB 3NVKE 5LP6B 1VHAA 1FFXB 4KWEA 5JVDB 1JJ2F 1E7KA 4LNUB 3LWPC 3LDTA 3HKBA 3OONA 3ZP4A 3HKEB 3F0FA 3VTIC 3GYQA 2I6DA 3IR9A 5FLXM 3GTZA 4G4VA 2LBWA 1RQ2A 5EWRA 1W5AA 2GZLA 2VAPA 2R6R1 3KJKA 2OHWA 2ZVYA 3HKCB 1YITF 1U40A 3WGKA 3JVHA 1W41A 3C9UA 3CMAF 2HP0A 2CZWA 3K12A 2CVLA 2FC3A 3E1YA 4X1YB 2IG8A 1QAHA 4IIJB 3CCJF 3JARB 1PF5A 5JQGA 4X1IB 3CCMF 3JAKB 4BT2A 4DRXA 4EB6A 3N4YA 3PAFA 5GAPK 3FPIA 4FFBA 5C8YA 5MN6A 4TUYB 5EB1B 1Z5WA 5EYPA 5HY2A 3CC7F 1CLIA 1KNKA 5B8FA 3RYIA 3CC4F 3OW2F 3HKDA 5ITZB 3NVIB 1X7OA 2ZOVA 5LOVB 3CCUF 5IJ0B 4BT7A 2YYEA 5GINC 5BMVB 3N4ZA 2VXYA 1FNJA 3IMPA 3C9TA 4X3LA 1VQ7F 4BY9D 2YXZA 3G4SF 1W3EX 4B45A 3NMUC 2HVYD 3CMEF 3M4SA 4O2AA 1NMUB 3ZP7A 2LBXA 3F0GA 5IYZB 3CB2A 3QUWA 3VIUA 3WJRA 1DT9A 4NQ3A 3RYHB 1GX1A 2ZF8A 5JCOC 4TV8B 3FBAA 4X1YA 1QU9A 3D54A 5JCOA 4O2AB 3CPQA 1X52A 3I3FA 4BVQA 1S72F 4X20B 2HRUA 2QI2A 3GHZA 2VAMA 5LXTA 5C8YB 1CK2A 1RLGA 3P4EA 5IJ0A 3G71F 1ONIA 3RYHA 3ESJA 4IHJA 4ZHVA 3CCLF 4O2BB 2CHSA 1SA0B 3RYCA 2UYNB 2GVIA 2BTQB 3HKEA 4C81A 3OBYA 5MN5A 5IJ9A 1K9MH 3CCQF 1J7HA 3SIVA 2OTJF 2UYPA 3VOBA 5J2TB 3WGNA 3DDNA 1VQ6F 2H8EA 1JD1A 2QA4F 2KGWA 1RQ7A 1IV1A 4IHJB 3F0DA 3HWUA 3R0PA 5HY0A 3D00A 3V4DA 1JFFB 3K0TA 3KJJA 4BVRA 3S02A 1Q81H 5GIOC 2HS0A 3D01A 2BTOA 2ZODA 4LCKA 5HXUA 3L7QA 5CA0A 4I50A 3JAWB 4BT3A 1VQNF 3IKEA 2Q1YA 2Z1EA 5CA1B 4BT5A 1YI2F 4EB6B 4TV9A 3JATA 5EZYA 2ZAUA 3C8LA 3J80M 4PWTA 4G4XA 4ZOLB 1H48A 4NWOB 1VQKF 4ERHA 3F6MA 4U39A 4O4HB 5GONA 3JAMM 3C9RA 4HNAB 4TZZA 2HX0A 4F6RB 1K8AH 1VQ4F 3FD6A 2PMPA 4O2BA 3U0OA 2QTPA 1SZQA 2R751 4BW0B 4E6EA 2WALA 4BT6A 3Q8HA 5FNVB 2CW4A 2H8CA 5HWEA 2K1SA 2UZHA 2LCAA 2CWJA 5KX5A 2Q1XA 4O4HA 5GONB 3MQWA 3LYBA 4M8IA 3WJQA 5LYJB 5HXZA 3UT5A 4YJ2A 2V9YA 3RA5A 3RYFB 3WJPA 4I55B 5GANK 4TV9B 3FD5A 4FFBB 1JN1A 2Z1UA 3WGJA 1ODEA 5HY1A 3PLAC 3CXCF 1W59A 3ON1A 3RYIB 2B33A 4EI8A 1PXWA 3RE3A 3KIZA 1U3LA 1GO1A 4X1KA 4I50B 3UT5B 3I55F 1N8RH 3O85A 4YJ3A 3MCAB 5EAZA 5EYPB 2FGYA 4ZHWA 4G4WA 1CN7A 3JATB 5EZYB 1Q82H 1RA4A 1IV4A 2LBTA 3C9SA 3QTYA 4ZI7A 1TVKA 4U3JB 4BT4A 5IJ9B 3CD6F 3VYUC 2Z1TA 1W42A 3RYCB 4X3MA 1FFXA 5EIBD 3E22A 3KHNA 3VYSC 2MQEA 3ZOPA 1GZ0A 1W581 5J2UB 1OAPA 5JQGB 2HS4A 4ZHQA 3FFMA 5MN4A 3IEWA 1YJWF 3J7AR 2BTUA 3T80A 2KTUA 1Z5VA 1W5EA 2PHNA 5LA6A 5IT9M 4R40B 3P10A 1M90H 1TVKB 3SIUA 2ZVZA 3VCZA 5JVDA 3J81M 3CC2F 5G4UC 3IKFA 3CCEF 1UFYA 2P6YA 3E22B 3LWRC 2Z01A 1U43A 5CA1A 1Q7YH 2VGMA 1XV2A 3MCQA 1QD9A 2DT4A 4C8EA 4ZK7A 2H6LA 5EB0A 1W5FA 1K73H 4X1KB 3N2GB 3NK7A 3VOAA 1OFUA 5LA6B 5JH7B 2HP0B 3TD5A 1TUBA 5EO3A 3RA6A 3I56F 3WPWA 4TV8A 3CG6A 4TUYA 2ALEA 4G4YA 1JY8A 2OTMA 1QVGF 2RHOA
chains in the Genus database with same CATH topology
2WALA 2GLZA 5GINC 1Q86H 4C4WC 2JNBA 1KD1H 3N4ZA 2KG4A 5HWEA 3WXMB 3VMFB 3LWOC 4X3LA 1VQ7F 4BY9D 1QVFF 3G4SF 1W3EX 4BVTA 2OZBA 3CCSF 2HVYD 1ZWZA 3RA5A 3NMUC 3CMEF 1NMUB 5GANK 1KC8H 4EI7A 2LBXA 1W2BF 1YIJF 1KQSF 2QEXF 3AGKA 5DCVA 1X7PA 1M1KH 1DT9A 4NQ3A 5HY1A 3PLAC 3LWQC 3VI6A 3CXCF 3ON1A 4EI8A 1PXWA 1GO0A 3CCVF 2BO1A 3NK6A 2OTLF 1GO1A 3CPQA 1X52A 4BVQA 1VQOF 3I55F 3HJWC 1N8RH 3O85A 2F9ZC 1S72F 4EI9A 3V3TA 3LFOA 5G4VC 2QI2A 2KTVA 3MCAB 3CPWF 5FJ4C 2VGNA 2FGYA 1CK2A 1RLGA 3G71F 1VQ9F 3G6EF 3NVKE 1CN7A 3CCLF 1Q82H 1RA4A 1VQMF 3OBWA 1JJ2F 1E7KA 1SDSA 3LWPC 2AIFA 3OBYA 1K9MH 3CCQF 3CD6F 3SIVA 3GYQA 2I6DA 2OTJF 1W42A 3IR9A 5FLXM 4XCQA 2LBWA 1W40A 4X3MA 1VQ8F 1VQ6F 5GIPC 5EWRA 2QA4F 1GZ0A 3JCMM 5HY0A 2OHWA 3D00A 4BVRA 1Q81H 3FFMA 3V7QA 1YHQF 1YITF 5GIOC 1YJWF 1YJ9F 1IPAA 1W41A 1YJNF 3CMAF 1VQ5F 3J7AR 2CZWA 2KTUA 3HAXD 4LCKA 5HXUA 5IT9M 5HY4A 1M90H 2FC3A 3E1YA 3SIUA 3J81M 3CC2F 3CCJF 1VQNF 5G4UC 3CCMF 3CCEF 1T0KB 4NUTA 3LWRC 1YI2F 1Q7YH 3N4YA 2VGMA 3PAFA 5GAPK 3CCRF 3J80M 1NJIH 1VQKF 5HY2A 3CC7F 1K73H 3NK7A 4BVSA 3JAMM 1H7MA 3CC4F 4TZZA 3LWVC 5EO3A 3RA6A 3I56F 1K8AH 3OW2F 1XBIA 1VQ4F 3V7EA 3CG6A 3NVIB 1VQLF 2ALEA 1X7OA 3E20B 5A2QM 1VQPF 1QVGF 3CCUF 4BW0B 5HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAL A;  5GIN C;  1Q86 H;  4C4W C;  2JNB A;  1KD1 H;  3N4Z A;  2KG4 A;  3WXM B;  3VMF B;  3LWO C;  4X3L A;  1VQ7 F;  4BY9 D;  1QVF F;  3G4S F;  1W3E X;  2OZB A;  3CCS F;  2HVY D;  1ZWZ A;  3RA5 A;  3NMU C;  3CME F;  1NMU B;  5GAN K;  1KC8 H;  2LBX A;  1W2B F;  1YIJ F;  1KQS F;  2QEX F;  3AGK A;  5DCV A;  1X7P A;  1M1K H;  1DT9 A;  3PLA C;  3LWQ C;  3VI6 A;  3CXC F;  3ON1 A;  1PXW A;  1GO0 A;  3CCV F;  2BO1 A;  3NK6 A;  2OTL F;  1GO1 A;  3CPQ A;  1X52 A;  1VQO F;  3HJW C;  3I55 F;  1N8R H;  3O85 A;  1S72 F;  3LFO A;  5G4V C;  2QI2 A;  2KTV A;  3MCA B;  3CPW F;  5FJ4 C;  2VGN A;  1CK2 A;  1RLG A;  3G71 F;  1VQ9 F;  3G6E F;  3NVK E;  1CN7 A;  3CCL F;  1Q82 H;  1RA4 A;  1VQM F;  3OBW A;  1JJ2 F;  1E7K A;  1SDS A;  3LWP C;  2AIF A;  3OBY A;  1K9M H;  3CCQ F;  3CD6 F;  3SIV A;  3GYQ A;  2I6D A;  2OTJ F;  1W42 A;  3IR9 A;  5FLX M;  2LBW A;  1W40 A;  4X3M A;  1VQ8 F;  1VQ6 F;  5GIP C;  5EWR A;  2QA4 F;  1GZ0 A;  3JCM M;  2OHW A;  1Q81 H;  3FFM A;  3V7Q A;  1YHQ F;  1YIT F;  5GIO C;  1YJW F;  1YJ9 F;  1IPA A;  1W41 A;  1YJN F;  3CMA F;  1VQ5 F;  3J7A R;  2CZW A;  2KTU A;  3HAX D;  4LCK A;  5IT9 M;  1M90 H;  2FC3 A;  3E1Y A;  3SIU A;  3J81 M;  3CC2 F;  3CCJ F;  1VQN F;  5G4U C;  3CCM F;  3CCE F;  1T0K B;  4NUT A;  3LWR C;  1YI2 F;  1Q7Y H;  3N4Y A;  2VGM A;  3PAF A;  5GAP K;  3CCR F;  3J80 M;  1NJI H;  1VQK F;  3CC7 F;  1K73 H;  3NK7 A;  3JAM M;  1H7M A;  3CC4 F;  4TZZ A;  3LWV C;  5EO3 A;  3RA6 A;  3I56 F;  1K8A H;  3OW2 F;  1XBI A;  1VQ4 F;  3V7E A;  3CG6 A;  3NVI B;  1VQL F;  2ALE A;  1X7O A;  3E20 B;  5A2Q M;  1VQP F;  1QVG F;  3CCU F;  4BW0 B; 
#chains in the Genus database with same CATH topology
 3JAL A;  2GLZ A;  4C4W C;  4O4J B;  4ZHY B;  2JNB A;  1KD1 H;  4X1I A;  5J2T A;  3M84 A;  2I6R A;  3WXM B;  3VMF B;  3LWO C;  4B46 A;  3JAW A;  1U3P A;  2RB9 A;  3B6N A;  1W5B A;  4X20 A;  1TUB B;  3QHD A;  4BVT A;  3CCS F;  1ZWZ A;  4YJ2 B;  5EIB C;  1IV3 A;  3VYT C;  1KC8 H;  2UYN A;  1W2B F;  5BMV A;  2IAF A;  3K14 A;  1KQS F;  2QEX F;  2AIZ P;  2HQS C;  1IV2 A;  3WGM A;  2L26 A;  3HKD B;  4RHA A;  3LWQ C;  4IIJ A;  3I7T A;  4HNA A;  3K2X A;  4F6R A;  3VO8 A;  2BO1 A;  3NK6 A;  2OTL F;  1FNK A;  1FSZ A;  3F0E A;  2F9Z C;  3V3T A;  3LFO A;  1XRG A;  5G4V C;  2KTV A;  1JFF A;  2VGN A;  4ZOL A;  3S0W A;  4ZHQ B;  3WPX A;  1VQ9 F;  3G6E F;  3DC2 A;  2HS3 A;  3N2K B;  3P0Z A;  1UI9 A;  4C8G A;  2HP3 A;  5IYZ A;  4G88 A;  3JAK A;  1YGY A;  2RHJ A;  1VQM F;  3OBW A;  1SDS A;  1COM A;  3EOR A;  5CA0 B;  4U3J A;  3N2G A;  2AIF A;  3KE1 A;  4O4I A;  5KMG A;  3TD4 A;  3JAS B;  5CB4 A;  3S06 A;  3HKC A;  1KNJ A;  4XCQ A;  1W40 A;  4O4J A;  1VQ8 F;  5GIP C;  1VQV A;  2RHL A;  4O4L B;  3JCM M;  2CSL A;  3JAR A;  3MBM A;  5AVM A;  2G9I A;  2IQQ A;  3V7Q A;  1YHQ F;  3HTN A;  2EWC A;  1IPA A;  1YJ9 F;  1YJN F;  1VQ5 F;  3HAX D;  5HY4 A;  4YJ3 B;  3IEQ A;  4O4I B;  5KMG B;  2AMT A;  3S03 A;  4LNU A;  3CYP B;  2HRY A;  2NMU A;  1YQN A;  5FNV A;  1T0K B;  4G4Z A;  4NUT A;  1Q8R A;  2N48 A;  4O4L A;  3CCR F;  5ITZ A;  1NJI H;  4B5C A;  1NQ3 A;  3RYF A;  4DXD A;  4ZI7 B;  4I4T B;  4RQO A;  4BVS A;  3CYQ A;  5LP6 C;  3HKB B;  1H7M A;  3LWV C;  1SA0 A;  1XBI A;  3V7E A;  5KX5 B;  5HP7 A;  1VQL F;  3E20 B;  5A2Q M;  5LOV A;  5J2U A;  1VQP F;  3N2K A;  3M1X A;  5HP8 A;  1Q86 H;  3WGL A;  2KG4 A;  5CB4 B;  2DYY A;  1RLU A;  3BYQ A;  1QVF F;  4I4T A;  4WBN A;  2OZB A;  1VK3 A;  2RHH A;  3S0Y A;  1X25 A;  4B62 A;  4EI7 A;  1YIJ F;  1R1M A;  2CHT A;  2VAW A;  3AGK A;  5DCV A;  1DBF A;  1X7P A;  5LP6 A;  1M1K H;  4DRX B;  3TD3 A;  3MDO A;  2W8B C;  5LXT B;  3VI6 A;  1XHO A;  2Z1F A;  1VH8 A;  3JAS A;  2UYK A;  4I55 A;  3CCV F;  1GO0 A;  3LME A;  3ELC A;  3ERN A;  3ZO8 A;  5JH7 A;  1VQO F;  3HJW C;  4WBN B;  2UYJ A;  4EI9 A;  5LYJ A;  4C82 A;  3S0H A;  1H47 A;  1W55 A;  3CPW F;  5FJ4 C;  4C8I A;  1T0A A;  1W57 A;  3JAL B;  3NVK E;  5LP6 B;  1VHA A;  1FFX B;  4KWE A;  5JVD B;  1JJ2 F;  1E7K A;  4LNU B;  3LWP C;  3LDT A;  3HKB A;  3OON A;  3ZP4 A;  3HKE B;  3F0F A;  3VTI C;  3GYQ A;  2I6D A;  3IR9 A;  5FLX M;  3GTZ A;  4G4V A;  2LBW A;  1RQ2 A;  5EWR A;  1W5A A;  2GZL A;  2VAP A;  2R6R 1;  3KJK A;  2OHW A;  2ZVY A;  3HKC B;  1YIT F;  1U40 A;  3WGK A;  3JVH A;  1W41 A;  3C9U A;  3CMA F;  2HP0 A;  2CZW A;  3K12 A;  2CVL A;  2FC3 A;  3E1Y A;  4X1Y B;  2IG8 A;  1QAH A;  4IIJ B;  3CCJ F;  3JAR B;  1PF5 A;  5JQG A;  4X1I B;  3CCM F;  3JAK B;  4BT2 A;  4DRX A;  4EB6 A;  3N4Y A;  3PAF A;  5GAP K;  3FPI A;  4FFB A;  5C8Y A;  5MN6 A;  4TUY B;  5EB1 B;  1Z5W A;  5EYP A;  5HY2 A;  3CC7 F;  1CLI A;  1KNK A;  5B8F A;  3RYI A;  3CC4 F;  3OW2 F;  3HKD A;  5ITZ B;  3NVI B;  1X7O A;  2ZOV A;  5LOV B;  3CCU F;  5IJ0 B;  4BT7 A;  2YYE A;  5GIN C;  5BMV B;  3N4Z A;  2VXY A;  1FNJ A;  3IMP A;  3C9T A;  4X3L A;  1VQ7 F;  4BY9 D;  2YXZ A;  3G4S F;  1W3E X;  4B45 A;  3NMU C;  2HVY D;  3CME F;  3M4S A;  4O2A A;  1NMU B;  3ZP7 A;  2LBX A;  3F0G A;  5IYZ B;  3CB2 A;  3QUW A;  3VIU A;  3WJR A;  1DT9 A;  4NQ3 A;  3RYH B;  1GX1 A;  2ZF8 A;  5JCO C;  4TV8 B;  3FBA A;  4X1Y A;  1QU9 A;  3D54 A;  5JCO A;  4O2A B;  3CPQ A;  1X52 A;  3I3F A;  4BVQ A;  1S72 F;  4X20 B;  2HRU A;  2QI2 A;  3GHZ A;  2VAM A;  5LXT A;  5C8Y B;  1CK2 A;  1RLG A;  3P4E A;  5IJ0 A;  3G71 F;  1ONI A;  3RYH A;  3ESJ A;  4IHJ A;  4ZHV A;  3CCL F;  4O2B B;  2CHS A;  1SA0 B;  3RYC A;  2UYN B;  2GVI A;  2BTQ B;  3HKE A;  4C81 A;  3OBY A;  5MN5 A;  5IJ9 A;  1K9M H;  3CCQ F;  1J7H A;  3SIV A;  2OTJ F;  2UYP A;  3VOB A;  5J2T B;  3WGN A;  3DDN A;  1VQ6 F;  2H8E A;  1JD1 A;  2QA4 F;  2KGW A;  1RQ7 A;  1IV1 A;  4IHJ B;  3F0D A;  3HWU A;  3R0P A;  5HY0 A;  3D00 A;  3V4D A;  1JFF B;  3K0T A;  3KJJ A;  4BVR A;  3S02 A;  1Q81 H;  5GIO C;  2HS0 A;  3D01 A;  2BTO A;  2ZOD A;  4LCK A;  5HXU A;  3L7Q A;  5CA0 A;  4I50 A;  3JAW B;  4BT3 A;  1VQN F;  3IKE A;  2Q1Y A;  2Z1E A;  5CA1 B;  4BT5 A;  1YI2 F;  4EB6 B;  4TV9 A;  3JAT A;  5EZY A;  2ZAU A;  3C8L A;  3J80 M;  4PWT A;  4G4X A;  4ZOL B;  1H48 A;  4NWO B;  1VQK F;  4ERH A;  3F6M A;  4U39 A;  4O4H B;  5GON A;  3JAM M;  3C9R A;  4HNA B;  4TZZ A;  2HX0 A;  4F6R B;  1K8A H;  1VQ4 F;  3FD6 A;  2PMP A;  4O2B A;  3U0O A;  2QTP A;  1SZQ A;  2R75 1;  4BW0 B;  4E6E A;  2WAL A;  4BT6 A;  3Q8H A;  5FNV B;  2CW4 A;  2H8C A;  5HWE A;  2K1S A;  2UZH A;  2LCA A;  2CWJ A;  5KX5 A;  2Q1X A;  4O4H A;  5GON B;  3MQW A;  3LYB A;  4M8I A;  3WJQ A;  5LYJ B;  5HXZ A;  3UT5 A;  4YJ2 A;  2V9Y A;  3RA5 A;  3RYF B;  3WJP A;  4I55 B;  5GAN K;  4TV9 B;  3FD5 A;  4FFB B;  1JN1 A;  2Z1U A;  3WGJ A;  1ODE A;  5HY1 A;  3PLA C;  3CXC F;  1W59 A;  3ON1 A;  3RYI B;  2B33 A;  4EI8 A;  1PXW A;  3RE3 A;  3KIZ A;  1U3L A;  1GO1 A;  4X1K A;  4I50 B;  3UT5 B;  3I55 F;  1N8R H;  3O85 A;  4YJ3 A;  3MCA B;  5EAZ A;  5EYP B;  2FGY A;  4ZHW A;  4G4W A;  1CN7 A;  3JAT B;  5EZY B;  1Q82 H;  1RA4 A;  1IV4 A;  2LBT A;  3C9S A;  3QTY A;  4ZI7 A;  1TVK A;  4U3J B;  4BT4 A;  5IJ9 B;  3CD6 F;  3VYU C;  2Z1T A;  1W42 A;  3RYC B;  4X3M A;  1FFX A;  5EIB D;  3E22 A;  3KHN A;  3VYS C;  2MQE A;  3ZOP A;  1GZ0 A;  1W58 1;  5J2U B;  1OAP A;  5JQG B;  2HS4 A;  4ZHQ A;  3FFM A;  5MN4 A;  3IEW A;  1YJW F;  3J7A R;  2BTU A;  3T80 A;  2KTU A;  1Z5V A;  1W5E A;  2PHN A;  5LA6 A;  5IT9 M;  4R40 B;  3P10 A;  1M90 H;  1TVK B;  3SIU A;  2ZVZ A;  3VCZ A;  5JVD A;  3J81 M;  3CC2 F;  5G4U C;  3IKF A;  3CCE F;  1UFY A;  2P6Y A;  3E22 B;  3LWR C;  2Z01 A;  1U43 A;  5CA1 A;  1Q7Y H;  2VGM A;  1XV2 A;  3MCQ A;  1QD9 A;  2DT4 A;  4C8E A;  4ZK7 A;  2H6L A;  5EB0 A;  1W5F A;  1K73 H;  4X1K B;  3N2G B;  3NK7 A;  3VOA A;  1OFU A;  5LA6 B;  5JH7 B;  2HP0 B;  3TD5 A;  1TUB A;  5EO3 A;  3RA6 A;  3I56 F;  3WPW A;  4TV8 A;  3CG6 A;  4TUY A;  2ALE A;  4G4Y A;  1JY8 A;  2OTM A;  1QVG F;  2RHO A; 
#chains in the Genus database with same CATH homology
 2WAL A;  2GLZ A;  5GIN C;  1Q86 H;  4C4W C;  2JNB A;  1KD1 H;  3N4Z A;  2KG4 A;  5HWE A;  3WXM B;  3VMF B;  3LWO C;  4X3L A;  1VQ7 F;  4BY9 D;  1QVF F;  3G4S F;  1W3E X;  4BVT A;  2OZB A;  3CCS F;  2HVY D;  1ZWZ A;  3RA5 A;  3NMU C;  3CME F;  1NMU B;  5GAN K;  1KC8 H;  4EI7 A;  2LBX A;  1W2B F;  1YIJ F;  1KQS F;  2QEX F;  3AGK A;  5DCV A;  1X7P A;  1M1K H;  1DT9 A;  4NQ3 A;  5HY1 A;  3PLA C;  3LWQ C;  3VI6 A;  3CXC F;  3ON1 A;  4EI8 A;  1PXW A;  1GO0 A;  3CCV F;  2BO1 A;  3NK6 A;  2OTL F;  1GO1 A;  3CPQ A;  1X52 A;  4BVQ A;  1VQO F;  3I55 F;  3HJW C;  1N8R H;  3O85 A;  2F9Z C;  1S72 F;  4EI9 A;  3V3T A;  3LFO A;  5G4V C;  2QI2 A;  2KTV A;  3MCA B;  3CPW F;  5FJ4 C;  2VGN A;  2FGY A;  1CK2 A;  1RLG A;  3G71 F;  1VQ9 F;  3G6E F;  3NVK E;  1CN7 A;  3CCL F;  1Q82 H;  1RA4 A;  1VQM F;  3OBW A;  1JJ2 F;  1E7K A;  1SDS A;  3LWP C;  2AIF A;  3OBY A;  1K9M H;  3CCQ F;  3CD6 F;  3SIV A;  3GYQ A;  2I6D A;  2OTJ F;  1W42 A;  3IR9 A;  5FLX M;  4XCQ A;  2LBW A;  1W40 A;  4X3M A;  1VQ8 F;  1VQ6 F;  5GIP C;  5EWR A;  2QA4 F;  1GZ0 A;  3JCM M;  5HY0 A;  2OHW A;  3D00 A;  4BVR A;  1Q81 H;  3FFM A;  3V7Q A;  1YHQ F;  1YIT F;  5GIO C;  1YJW F;  1YJ9 F;  1IPA A;  1W41 A;  1YJN F;  3CMA F;  1VQ5 F;  3J7A R;  2CZW A;  2KTU A;  3HAX D;  4LCK A;  5HXU A;  5IT9 M;  5HY4 A;  1M90 H;  2FC3 A;  3E1Y A;  3SIU A;  3J81 M;  3CC2 F;  3CCJ F;  1VQN F;  5G4U C;  3CCM F;  3CCE F;  1T0K B;  4NUT A;  3LWR C;  1YI2 F;  1Q7Y H;  3N4Y A;  2VGM A;  3PAF A;  5GAP K;  3CCR F;  3J80 M;  1NJI H;  1VQK F;  5HY2 A;  3CC7 F;  1K73 H;  3NK7 A;  4BVS A;  3JAM M;  1H7M A;  3CC4 F;  4TZZ A;  3LWV C;  5EO3 A;  3RA6 A;  3I56 F;  1K8A H;  3OW2 F;  1XBI A;  1VQ4 F;  3V7E A;  3CG6 A;  3NVI B;  1VQL F;  2ALE A;  1X7O A;  3E20 B;  5A2Q M;  1VQP F;  1QVG F;  3CCU F;  4BW0 B;  5HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...