2GZLA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for Ispf, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2gzlA00
1JY8A 1W55A 3F0DA 1YQNA 3IEQA 3F6MA 3QHDA 1H47A 2AMTA 4C8GA 1GX1A 3ESJA 1U43A 3B6NA 3P10A 3JVHA 4C8EA 1IV4A 2PMPA 3P0ZA 3ERNA 3F0EA 3K14A 3IEWA 3EORA 1JN1A 2UZHA 3IKEA 1KNKA 3FBAA 3KE1A 3Q8HA 3T80A 4C8IA 4C82A 1IV1A 1U40A 1U3PA 1U3LA 1W57A 3RE3A 2GZLA 5B8FA 3FPIA 1H48A 3MBMA 3IKFA 1KNJA 3K2XA 1VH8A 3F0GA 1IV2A 3GHZA 1VHAA 4C81A 3ELCA 3F0FA 1T0AA 1IV3A
chains in the Genus database with same CATH superfamily
3HKCB 4FFBB 3CCUF 1RA4A 1Q7YH 2LBTA 4G4VA 4ZHWA 2RHHA 1W42A 2CHSA 4I50B 4E6EA 3BYQA 3B6NA 1VQLF 1DBFA 3K0TA 5LYJA 5CB4A 3CPWF 3CCEF 4ZOLA 1JFFA 2K1SA 3CCMF 3G71F 2EWCA 3N2KA 3CMEF 3PLAC 2CVLA 5J2TB 3JARA 2HVYD 2NMUA 1COMA 1YGYA 3QUWA 3GHZA 1VHAA 2P6YA 3F0FA 2I6RA 5FNVA 5DCVA 5LP6A 4X1YB 3ZP7A 3KHNA 4LNUA 3WPWA 5JVDB 2R751 2VGNA 2ZVZA 3L7QA 1VQ7F 4TZZA 3F0EA 3S03A 3EORA 5HXUA 3WJPA 3V3TA 2BTQB 5EIBD 2Z01A 2Z1EA 3VTIC 5EAZA 5MN4A 5IYZB 3ERNA 3F0DA 3C9SA 3C9UA 3HKDA 5CA0B 5HY1A 1J7HA 4U3JB 1VK3A 2CW4A 2OHWA 4BVRA 2HS4A 3IKEA 4X20A 3UT5B 3HWUA 5KX5A 4R40B 3TD3A 4X1KA 3K12A 5BMVB 2HP0B 4X1IA 4YJ3B 2AIZP 1N8RH 1IV2A 3WGKA 3KIZA 3K2XA 2UYNA 2Z1UA 3J80M 5GAPK 1H47A 4I55B 4X3LA 3WGMA 1RLGA 2VAWA 2JNBA 4IHJA 4O2AA 4PWTA 3TD4A 5CA1B 5GINC 3SIUA 5LA6A 4BT4A 2ZF8A 3IEWA 3JALA 3LYBA 5LYJB 1Q81H 1GZ0A 4O4JA 3OONA 5EYPB 4EI7A 4TUYB 3LWVC 3JATB 3WXMB 2HRYA 3JAWA 3JARB 4EB6A 5FJ4C 2Q1YA 3CCRF 3P4EA 1X25A 1W55A 2ZODA 5FNVB 1YQNA 3LMEA 4BT3A 3CC4F 3VI6A 3KJJA 3FD6A 4O2BA 4F6RA 5MN6A 3NK6A 4ZI7B 3CB2A 3N4YA 5J2UA 1KQSF 3QTYA 2IQQA 3JAMM 1VQ4F 3OBYA 2BTOA 3T80A 2RB9A 1X7OA 5LOVA 1IV1A 1IPAA 5GONA 5G4UC 4YJ2A 4XCQA 2FC3A 1YHQF 1VQNF 5B8FA 3N2GA 1SDSA 5EZYB 3VYSC 3RYCA 3TD5A 4BVQA 2YYEA 3O85A 4EI9A 3HTNA 2HX0A 1YJ9F 3HKDB 3P10A 1UFYA 3JASA 3NK7A 5EO3A 3CCSF 3CYQA 3MCAB 4G4ZA 3DC2A 5JCOC 1TUBB 1TVKA 5C8YB 5IJ9A 5KX5B 4X1KB 1GO0A 1CN7A 1W5FA 3E1YA 3MQWA 4TV9A 2RHJA 4C4WC 3D00A 3VOBA 3D01A 5AVMA 1CK2A 4I4TB 3RYHA 1T0AA 1OAPA 3E22A 4NWOB 1DT9A 5LXTA 1QAHA 2AMTA 4B46A 4O4HA 2CWJA 2F9ZC 1VQ9F 1JD1A 1SZQA 2PMPA 3IMPA 4NUTA 1SA0B 3RA5A 2ZOVA 1PF5A 3VMFB 4B45A 3JALB 5IT9M 2UYPA 3VIUA 4O4JB 5IJ0A 5JCOA 1U3LA 2KTVA 3ZP4A 3GYQA 4DRXB 1NMUB 3PAFA 1VQ6F 1Q86H 3JAWB 1FNJA 4HNAA 4EB6B 1ONIA 3LWRC 5HXZA 5ITZA 1RQ7A 4BT5A 3QHDA 1VQPF 3M4SA 5KMGA 5JH7B 1GX1A 2FGYA 4ZHQA 4O2BB 4F6RB 5EB0A 3CC2F 5J2UB 1YJWF 1OFUA 4O4LA 3S0WA 3FFMA 3LDTA 3HAXD 1YJNF 5LOVB 2UYJA 5GONB 1W57A 1W5EA 4YJ2B 1W59A 1Q8RA 4BVTA 3DDNA 3CYPB 3RYCB 3HKBB 3RYIB 3S0YA 4WBNB 3FBAA 3J81M 1JY8A 2OTLF 4I50A 2L26A 3JVHA 3WPXA 3HKEA 1IV4A 3JASB 3VO8A 2OTMA 1JN1A 1W5BA 5CB4B 4ZOLB 1JFFB 3WJRA 1Q82H 3WJQA 5J2TA 3VOAA 2Z1FA 3I3FA 1TVKB 4O4IA 3RE3A 2RHOA 5IJ9B 3N2KB 2GZLA 3V7QA 5EB1B 3IKFA 1KNJA 3ON1A 1M1KH 4G4YA 4TV9B 1XV2A 3OW2F 1K9MH 4RHAA 4X1YA 3RYHB 4BW0B 1R1MA 1QVGF 3JAKA 3MDOA 5EIBC 5LXTB 5LP6B 1XRGA 1W581 2BO1A 1PXWA 4LNUB 1JJ2F 3CC7F 2H6LA 3V4DA 3NMUC 3S06A 2HP3A 1T0KB 1U40A 4ZHVA 1QU9A 5GIPC 1K8AH 2LBXA 3CG6A 2B33A 4X3MA 4G88A 1W41A 4NQ3A 1X7PA 3CCJF 3HJWC 1UI9A 4IIJA 2PHNA 2H8EA 4HNAB 2QTPA 3IEQA 5CA0A 2HQSC 1VQKF 2ALEA 3I55F 2HS0A 5ITZB 1QVFF 1Z5VA 5KMGB 4ZHQB 1FNKA 3UT5A 3N4ZA 2ZVYA 3C9RA 3KE1A 2N48A 3Q8HA 1VQOF 1VQVA 4M8IA 4X20B 2I6DA 3M1XA 1U3PA 2KGWA 2RHLA 2LCAA 5BMVA 3ZO8A 1FFXA 1M90H 4YJ3A 2BTUA 2VXYA 1YITF 2CHTA 4X1IB 3D54A 3RYFA 4RQOA 1IV3A 4I55A 3ZOPA 4EI8A 5CA1A 3CCQF 1YI2F 2OZBA 2UYNB 1U43A 2Z1TA 2QA4F 4IHJB 4O2AB 3RA6A 1NQ3A 1QD9A 3HKEB 4G4XA 3C8LA 2H8CA 1KNKA 2VAPA 4C8IA 2Q1XA 5LA6B 3SIVA 5EYPA 4TUYA 4ZHYB 3NVKE 3JATA 5HY2A 5JQGA 4O4IB 3WGNA 2KTUA 3KJKA 3FPIA 4LCKA 1H48A 2IG8A 4BT2A 2W8BC 3LWQC 5GIOC 2CZWA 5GANK 2KG4A 2VAMA 4ZI7A 4BT6A 2GVIA 1E7KA 3JAKB 4C8GA 2VGMA 3CPQA 1CLIA 2HS3A 3P0ZA 4U39A 5HP8A 5G4VC 2WALA 1XHOA 3CCVF 2HRUA 4TV8A 2QEXF 4ERHA 2QI2A 2DYYA 1K73H 1NJIH 5EZYA 3CCLF 2LBWA 3JCMM 3VCZA 3N2GB 3F0GA 1GO1A 4ZK7A 4IIJB 4C81A 3ELCA 3HKCA 3GTZA 4FFBA 1KD1H 2V9YA 3F6MA 2CSLA 1YIJF 1RQ2A 3I56F 3VYUC 4B5CA 1RLUA 5HP7A 4BY9D 3U0OA 4DXDA 5MN5A 3G6EF 1TUBA 2UZHA 1XBIA 5C8YA 5HY4A 1Z5WA 1H7MA 4G4WA 3LFOA 3M84A 2YXZA 4B62A 3WGJA 1FFXB 1ZWZA 4KWEA 5HY0A 3S02A 3MBMA 4I4TA 2AIFA 3FD5A 5EWRA 1ODEA 3RYFB 2ZAUA 3CMAF 3G4SF 3E22B 5JVDA 1W40A 3C9TA 1X52A 1W5AA 4C8EA 1SA0A 4O4HB 3K14A 1W3EX 5HWEA 3NVIB 4C82A 3LWPC 3IR9A 1KC8H 2UYKA 3I7TA 4DRXA 2IAFA 3VYTC 5FLXM 5IJ0B 5JQGB 1VQ8F 4BVSA 5IYZA 5A2QM 1FSZA 1VH8A 3CD6F 3OBWA 4BT7A 1W2BF 2MQEA 5JH7A 2OTJF 3S0HA 4U3JA 3ESJA 3R0PA 3AGKA 3V7EA 1VQMF 3WGLA 3LWOC 3J7AR 4O4LB 4TV8B 2G9IA 2R6R1 1S72F 1VQ5F 2HP0A 2DT4A 3HKBA 3RYIA 3E20B 4WBNA 2GLZA 3CXCF 3MCQA 5LP6C
chains in the Genus database with same CATH topology
1JY8A 1W55A 3F0DA 1YQNA 3IEQA 3F6MA 3QHDA 1H47A 2AMTA 4C8GA 1GX1A 3ESJA 1U43A 3B6NA 3P10A 3JVHA 4C8EA 1IV4A 2PMPA 3P0ZA 3ERNA 3F0EA 3K14A 3IEWA 3EORA 1JN1A 2UZHA 3IKEA 1KNKA 3FBAA 3KE1A 3Q8HA 3T80A 4C8IA 4C82A 1IV1A 1U40A 1U3PA 1U3LA 1W57A 3RE3A 2GZLA 5B8FA 3FPIA 1H48A 3MBMA 3IKFA 1KNJA 3K2XA 1VH8A 3F0GA 1IV2A 3GHZA 1VHAA 4C81A 3ELCA 3F0FA 1T0AA 1IV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  1W55 A;  3F0D A;  1YQN A;  3IEQ A;  3F6M A;  3QHD A;  1H47 A;  2AMT A;  4C8G A;  1GX1 A;  3ESJ A;  1U43 A;  3B6N A;  3P10 A;  3JVH A;  4C8E A;  1IV4 A;  2PMP A;  3P0Z A;  3ERN A;  3F0E A;  3K14 A;  3IEW A;  3EOR A;  1JN1 A;  2UZH A;  3IKE A;  1KNK A;  3FBA A;  3KE1 A;  3Q8H A;  3T80 A;  4C8I A;  4C82 A;  1IV1 A;  1U40 A;  1U3P A;  1U3L A;  1W57 A;  3RE3 A;  2GZL A;  5B8F A;  3FPI A;  1H48 A;  3MBM A;  3IKF A;  1KNJ A;  3K2X A;  1VH8 A;  3F0G A;  1IV2 A;  3GHZ A;  1VHA A;  4C81 A;  3ELC A;  3F0F A;  1T0A A;  1IV3 A; 
#chains in the Genus database with same CATH topology
 3HKC B;  4FFB B;  3CCU F;  1RA4 A;  1Q7Y H;  2LBT A;  4G4V A;  4ZHW A;  2RHH A;  1W42 A;  2CHS A;  4I50 B;  4E6E A;  3BYQ A;  3B6N A;  1VQL F;  1DBF A;  3K0T A;  5LYJ A;  5CB4 A;  3CPW F;  3CCE F;  4ZOL A;  1JFF A;  2K1S A;  3CCM F;  3G71 F;  2EWC A;  3N2K A;  3CME F;  3PLA C;  2CVL A;  5J2T B;  3JAR A;  2HVY D;  2NMU A;  1COM A;  1YGY A;  3QUW A;  3GHZ A;  1VHA A;  2P6Y A;  3F0F A;  2I6R A;  5FNV A;  5DCV A;  5LP6 A;  4X1Y B;  3ZP7 A;  3KHN A;  4LNU A;  3WPW A;  5JVD B;  2R75 1;  2VGN A;  2ZVZ A;  3L7Q A;  1VQ7 F;  4TZZ A;  3F0E A;  3S03 A;  3EOR A;  5HXU A;  3WJP A;  3V3T A;  2BTQ B;  5EIB D;  2Z01 A;  2Z1E A;  3VTI C;  5EAZ A;  5MN4 A;  5IYZ B;  3ERN A;  3F0D A;  3C9S A;  3C9U A;  3HKD A;  5CA0 B;  5HY1 A;  1J7H A;  4U3J B;  1VK3 A;  2CW4 A;  2OHW A;  4BVR A;  2HS4 A;  3IKE A;  4X20 A;  3UT5 B;  3HWU A;  5KX5 A;  4R40 B;  3TD3 A;  4X1K A;  3K12 A;  5BMV B;  2HP0 B;  4X1I A;  4YJ3 B;  2AIZ P;  1N8R H;  1IV2 A;  3WGK A;  3KIZ A;  3K2X A;  2UYN A;  2Z1U A;  3J80 M;  5GAP K;  1H47 A;  4I55 B;  4X3L A;  3WGM A;  1RLG A;  2VAW A;  2JNB A;  4IHJ A;  4O2A A;  4PWT A;  3TD4 A;  5CA1 B;  5GIN C;  3SIU A;  5LA6 A;  4BT4 A;  2ZF8 A;  3IEW A;  3JAL A;  3LYB A;  5LYJ B;  1Q81 H;  1GZ0 A;  4O4J A;  3OON A;  5EYP B;  4EI7 A;  4TUY B;  3LWV C;  3JAT B;  3WXM B;  2HRY A;  3JAW A;  3JAR B;  4EB6 A;  5FJ4 C;  2Q1Y A;  3CCR F;  3P4E A;  1X25 A;  1W55 A;  2ZOD A;  5FNV B;  1YQN A;  3LME A;  4BT3 A;  3CC4 F;  3VI6 A;  3KJJ A;  3FD6 A;  4O2B A;  4F6R A;  5MN6 A;  3NK6 A;  4ZI7 B;  3CB2 A;  3N4Y A;  5J2U A;  1KQS F;  3QTY A;  2IQQ A;  3JAM M;  1VQ4 F;  3OBY A;  2BTO A;  3T80 A;  2RB9 A;  1X7O A;  5LOV A;  1IV1 A;  1IPA A;  5GON A;  5G4U C;  4YJ2 A;  4XCQ A;  2FC3 A;  1YHQ F;  1VQN F;  5B8F A;  3N2G A;  1SDS A;  5EZY B;  3VYS C;  3RYC A;  3TD5 A;  4BVQ A;  2YYE A;  3O85 A;  4EI9 A;  3HTN A;  2HX0 A;  1YJ9 F;  3HKD B;  3P10 A;  1UFY A;  3JAS A;  3NK7 A;  5EO3 A;  3CCS F;  3CYQ A;  3MCA B;  4G4Z A;  3DC2 A;  5JCO C;  1TUB B;  1TVK A;  5C8Y B;  5IJ9 A;  5KX5 B;  4X1K B;  1GO0 A;  1CN7 A;  1W5F A;  3E1Y A;  3MQW A;  4TV9 A;  2RHJ A;  4C4W C;  3D00 A;  3VOB A;  3D01 A;  5AVM A;  1CK2 A;  4I4T B;  3RYH A;  1T0A A;  1OAP A;  3E22 A;  4NWO B;  1DT9 A;  5LXT A;  1QAH A;  2AMT A;  4B46 A;  4O4H A;  2CWJ A;  2F9Z C;  1VQ9 F;  1JD1 A;  1SZQ A;  2PMP A;  3IMP A;  4NUT A;  1SA0 B;  3RA5 A;  2ZOV A;  1PF5 A;  3VMF B;  4B45 A;  3JAL B;  5IT9 M;  2UYP A;  3VIU A;  4O4J B;  5IJ0 A;  5JCO A;  1U3L A;  2KTV A;  3ZP4 A;  3GYQ A;  4DRX B;  1NMU B;  3PAF A;  1VQ6 F;  1Q86 H;  3JAW B;  1FNJ A;  4HNA A;  4EB6 B;  1ONI A;  3LWR C;  5HXZ A;  5ITZ A;  1RQ7 A;  4BT5 A;  3QHD A;  1VQP F;  3M4S A;  5KMG A;  5JH7 B;  1GX1 A;  2FGY A;  4ZHQ A;  4O2B B;  4F6R B;  5EB0 A;  3CC2 F;  5J2U B;  1YJW F;  1OFU A;  4O4L A;  3S0W A;  3FFM A;  3LDT A;  3HAX D;  1YJN F;  5LOV B;  2UYJ A;  5GON B;  1W57 A;  1W5E A;  4YJ2 B;  1W59 A;  1Q8R A;  4BVT A;  3DDN A;  3CYP B;  3RYC B;  3HKB B;  3RYI B;  3S0Y A;  4WBN B;  3FBA A;  3J81 M;  1JY8 A;  2OTL F;  4I50 A;  2L26 A;  3JVH A;  3WPX A;  3HKE A;  1IV4 A;  3JAS B;  3VO8 A;  2OTM A;  1JN1 A;  1W5B A;  5CB4 B;  4ZOL B;  1JFF B;  3WJR A;  1Q82 H;  3WJQ A;  5J2T A;  3VOA A;  2Z1F A;  3I3F A;  1TVK B;  4O4I A;  3RE3 A;  2RHO A;  5IJ9 B;  3N2K B;  2GZL A;  3V7Q A;  5EB1 B;  3IKF A;  1KNJ A;  3ON1 A;  1M1K H;  4G4Y A;  4TV9 B;  1XV2 A;  3OW2 F;  1K9M H;  4RHA A;  4X1Y A;  3RYH B;  4BW0 B;  1R1M A;  1QVG F;  3JAK A;  3MDO A;  5EIB C;  5LXT B;  5LP6 B;  1XRG A;  1W58 1;  2BO1 A;  1PXW A;  4LNU B;  1JJ2 F;  3CC7 F;  2H6L A;  3V4D A;  3NMU C;  3S06 A;  2HP3 A;  1T0K B;  1U40 A;  4ZHV A;  1QU9 A;  5GIP C;  1K8A H;  2LBX A;  3CG6 A;  2B33 A;  4X3M A;  4G88 A;  1W41 A;  4NQ3 A;  1X7P A;  3CCJ F;  3HJW C;  1UI9 A;  4IIJ A;  2PHN A;  2H8E A;  4HNA B;  2QTP A;  3IEQ A;  5CA0 A;  2HQS C;  1VQK F;  2ALE A;  3I55 F;  2HS0 A;  5ITZ B;  1QVF F;  1Z5V A;  5KMG B;  4ZHQ B;  1FNK A;  3UT5 A;  3N4Z A;  2ZVY A;  3C9R A;  3KE1 A;  2N48 A;  3Q8H A;  1VQO F;  1VQV A;  4M8I A;  4X20 B;  2I6D A;  3M1X A;  1U3P A;  2KGW A;  2RHL A;  2LCA A;  5BMV A;  3ZO8 A;  1FFX A;  1M90 H;  4YJ3 A;  2BTU A;  2VXY A;  1YIT F;  2CHT A;  4X1I B;  3D54 A;  3RYF A;  4RQO A;  1IV3 A;  4I55 A;  3ZOP A;  4EI8 A;  5CA1 A;  3CCQ F;  1YI2 F;  2OZB A;  2UYN B;  1U43 A;  2Z1T A;  2QA4 F;  4IHJ B;  4O2A B;  3RA6 A;  1NQ3 A;  1QD9 A;  3HKE B;  4G4X A;  3C8L A;  2H8C A;  1KNK A;  2VAP A;  4C8I A;  2Q1X A;  5LA6 B;  3SIV A;  5EYP A;  4TUY A;  4ZHY B;  3NVK E;  3JAT A;  5HY2 A;  5JQG A;  4O4I B;  3WGN A;  2KTU A;  3KJK A;  3FPI A;  4LCK A;  1H48 A;  2IG8 A;  4BT2 A;  2W8B C;  3LWQ C;  5GIO C;  2CZW A;  5GAN K;  2KG4 A;  2VAM A;  4ZI7 A;  4BT6 A;  2GVI A;  1E7K A;  3JAK B;  4C8G A;  2VGM A;  3CPQ A;  1CLI A;  2HS3 A;  3P0Z A;  4U39 A;  5HP8 A;  5G4V C;  2WAL A;  1XHO A;  3CCV F;  2HRU A;  4TV8 A;  2QEX F;  4ERH A;  2QI2 A;  2DYY A;  1K73 H;  1NJI H;  5EZY A;  3CCL F;  2LBW A;  3JCM M;  3VCZ A;  3N2G B;  3F0G A;  1GO1 A;  4ZK7 A;  4IIJ B;  4C81 A;  3ELC A;  3HKC A;  3GTZ A;  4FFB A;  1KD1 H;  2V9Y A;  3F6M A;  2CSL A;  1YIJ F;  1RQ2 A;  3I56 F;  3VYU C;  4B5C A;  1RLU A;  5HP7 A;  4BY9 D;  3U0O A;  4DXD A;  5MN5 A;  3G6E F;  1TUB A;  2UZH A;  1XBI A;  5C8Y A;  5HY4 A;  1Z5W A;  1H7M A;  4G4W A;  3LFO A;  3M84 A;  2YXZ A;  4B62 A;  3WGJ A;  1FFX B;  1ZWZ A;  4KWE A;  5HY0 A;  3S02 A;  3MBM A;  4I4T A;  2AIF A;  3FD5 A;  5EWR A;  1ODE A;  3RYF B;  2ZAU A;  3CMA F;  3G4S F;  3E22 B;  5JVD A;  1W40 A;  3C9T A;  1X52 A;  1W5A A;  4C8E A;  1SA0 A;  4O4H B;  3K14 A;  1W3E X;  5HWE A;  3NVI B;  4C82 A;  3LWP C;  3IR9 A;  1KC8 H;  2UYK A;  3I7T A;  4DRX A;  2IAF A;  3VYT C;  5FLX M;  5IJ0 B;  5JQG B;  1VQ8 F;  4BVS A;  5IYZ A;  5A2Q M;  1FSZ A;  1VH8 A;  3CD6 F;  3OBW A;  4BT7 A;  1W2B F;  2MQE A;  5JH7 A;  2OTJ F;  3S0H A;  4U3J A;  3ESJ A;  3R0P A;  3AGK A;  3V7E A;  1VQM F;  3WGL A;  3LWO C;  3J7A R;  4O4L B;  4TV8 B;  2G9I A;  2R6R 1;  1S72 F;  1VQ5 F;  2HP0 A;  2DT4 A;  3HKB A;  3RYI A;  3E20 B;  4WBN A;  2GLZ A;  3CXC F;  3MCQ A;  5LP6 C; 
#chains in the Genus database with same CATH homology
 1JY8 A;  1W55 A;  3F0D A;  1YQN A;  3IEQ A;  3F6M A;  3QHD A;  1H47 A;  2AMT A;  4C8G A;  1GX1 A;  3ESJ A;  1U43 A;  3B6N A;  3P10 A;  3JVH A;  4C8E A;  1IV4 A;  2PMP A;  3P0Z A;  3ERN A;  3F0E A;  3K14 A;  3IEW A;  3EOR A;  1JN1 A;  2UZH A;  3IKE A;  1KNK A;  3FBA A;  3KE1 A;  3Q8H A;  3T80 A;  4C8I A;  4C82 A;  1IV1 A;  1U40 A;  1U3P A;  1U3L A;  1W57 A;  3RE3 A;  2GZL A;  5B8F A;  3FPI A;  1H48 A;  3MBM A;  3IKF A;  1KNJ A;  3K2X A;  1VH8 A;  3F0G A;  1IV2 A;  3GHZ A;  1VHA A;  4C81 A;  3ELC A;  3F0F A;  1T0A A;  1IV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...