2GZLA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for Ispf, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2gzlA00
3Q8HA 1GX1A 1KNKA 3F6MA 3FPIA 3F0EA 4C8EA 3ERNA 4C8GA 3MBMA 1VH8A 1VHAA 3F0GA 2AMTA 2PMPA 3F0FA 1W55A 3P0ZA 3K2XA 3IKFA 4C81A 3RE3A 3IEWA 1JY8A 2GZLA 3T80A 3IKEA 3K14A 3FBAA 4C8IA 4C82A 5B8FA 3JVHA 3IEQA 1H48A 1JN1A 1W57A 1U3LA 1U40A 1H47A 3GHZA 1T0AA 1YQNA 1IV2A 1U3PA 2UZHA 3ESJA 3F0DA 3QHDA 1IV4A 1KNJA 3ELCA 3P10A 3EORA 1IV1A 3KE1A 1U43A 3B6NA 1IV3A
chains in the Genus database with same CATH superfamily
1GX1A 3F6MA 5CA1B 5FNVA 1JD1A 1FFXA 5J2TB 3RYFB 3S06A 5EZYA 3F0FA 3VYSC 4IIJB 4ZHWA 3JAWA 2GZLA 4X3LA 3T80A 1JN1A 3P4EA 5HXZA 5J2UA 2RB9A 2ZOVA 3LWQC 3FD6A 4I55A 4R40B 3QHDA 5JH7A 1JFFA 5GONA 2P6YA 2Z1TA 5LXTB 3FD5A 4O4LB 3RA5A 1KD1H 5HP7A 4M8IA 1ONIA 2HS4A 3F0EA 5JCOC 4BW0B 5EO3A 1VQMF 1W41A 5GANK 3VO8A 3S0HA 4EI8A 3CMAF 3RYHA 3E22B 1YJWF 5IYZA 3K0TA 3I56F 1U40A 5HWEA 2VGNA 3C8LA 5G4UC 1YQNA 2GVIA 3JATB 1TUBA 3HKBA 5IJ0A 2F9ZC 3C9SA 3EORA 4G4YA 3NVKE 1SA0A 3JASB 1PF5A 3HJWC 5KMGA 1VQNF 5CB4B 3D01A 3F0GA 5JCOA 2HRYA 3ZP4A 1E7KA 3K14A 1Q86H 1RA4A 5EB0A 3CC4F 3WXMB 3M4SA 1QAHA 3S0WA 1KNJA 1NMUB 4BT5A 3J7AR 2LBTA 3BYQA 3CCRF 3PLAC 3E20B 1XV2A 2FC3A 2R751 1YITF 2KTUA 3V4DA 4C8GA 1X7OA 4BVTA 2MQEA 3D00A 1VQPF 4LNUB 2HP0A 4O4HB 2AMTA 4FFBB 4I4TB 4TUYA 4X3MA 3IEWA 1GO0A 3LWVC 3HKEA 3J81M 3CG6A 3KIZA 4B46A 3OONA 4G4XA 4C4WC 1K73H 3CPWF 3JALA 3E1YA 2UYNB 3VCZA 2HX0A 2VAWA 4X1YA 3OBYA 4O2AA 4KWEA 4O4JA 4BVRA 5BMVA 5EIBC 4BT7A 3V3TA 3GTZA 1Q81H 1M90H 3ON1A 1TVKA 4YJ2B 2AIZP 2JNBA 2G9IA 3JCMM 3QUWA 3CCVF 3ZO8A 1T0KB 4EB6A 2LCAA 4X1IB 2YXZA 3LFOA 4I55B 3JAMM 3LYBA 4TV8A 2OHWA 4ZI7A 5GONB 3RYCA 1IV2A 3WPWA 3MQWA 1OFUA 2L26A 3CYQA 5LYJB 2W8BC 4YJ3A 4EI7A 2NMUA 4E6EA 1COMA 1W581 2OTJF 3RYHB 1XHOA 1QD9A 2WALA 2HRUA 3S03A 3RYIB 2DYYA 1W55A 3P0ZA 4ZHVA 2K1SA 2QEXF 4NWOB 3IKEA 2QI2A 5JQGA 3G4SF 3LMEA 1XRGA 4I50A 5LA6B 3QTYA 1TUBB 3HKBB 5IJ0B 3GHZA 3D54A 3CCQF 3ESJA 5GIPC 1SA0B 3NVIB 5ITZB 3ELCA 3P10A 3LWOC 2OZBA 3KE1A 4NQ3A 5KMGB 5GINC 3WJQA 1U43A 3S0YA 3CCLF 2ZODA 3HWUA 5KX5A 3WJRA 4TV9A 5LOVA 4O2BA 2QTPA 2GLZA 3N2GB 5A2QM 1UFYA 2CHTA 3WGMA 3NMUC 3CCEF 1JJ2F 1JY8A 2N48A 1Z5WA 3UT5B 1CLIA 2QA4F 1NQ3A 3VYTC 3G71F 1FNKA 3SIUA 2CSLA 2HS0A 2BTQB 4IHJA 4BT6A 4DRXB 3JARA 4BY9D 2PHNA 4PWTA 4BVQA 4X1KB 1VHAA 5LP6B 1QVGF 1W59A 3HKEB 4B45A 4G88A 3K2XA 4NUTA 1VQ5F 3JALB 1X7PA 4C8IA 5HY4A 1W57A 1ODEA 1H47A 2ZAUA 1T0AA 3N2KB 5JVDB 2KG4A 3M84A 3NK6A 1TVKB 4F6RB 5IJ9B 5CA0A 5HY0A 1KNKA 2CVLA 3CYPB 5EAZA 4ZHQB 4O4LA 5EYPB 1SZQA 2YYEA 3ERNA 3MBMA 4U3JA 4EB6B 3HKCB 2Z1FA 2RHOA 2UYJA 4G4ZA 3WPXA 4U39A 1W5BA 3N4ZA 3FBAA 4TV8B 4C82A 3HAXD 4HNAB 1W3EX 1K8AH 4G4VA 3C9TA 4TZZA 3I7TA 1YHQF 1OAPA 3C9RA 3JAKB 1IV1A 2HQSC 3JATA 5FNVB 3CC2F 1S72F 3IR9A 1FFXB 2VXYA 3LWRC 5EZYB 3RA6A 3JAWB 4C81A 4I50B 5AVMA 1XBIA 2CZWA 5J2UB 3IEQA 5EWRA 1QVFF 3C9UA 3N4YA 5DCVA 1CN7A 5JH7B 5G4VC 1JFFB 2LBXA 1YI2F 2I6RA 2VAPA 1W2BF 1YGYA 3CCUF 1FNJA 4BT4A 3CCJF 4C8EA 5C8YA 4ZOLA 2KTVA 4X20A 1GO1A 1M1KH 1VQKF 4FFBA 5IYZB 4BT3A 3CXCF 1VQVA 2ALEA 3LWPC 2KGWA 3VTIC 2V9YA 3G6EF 3M1XA 2VAMA 3TD3A 1X52A 1QU9A 3GYQA 3CD6F 5IT9M 3V7QA 3KJJA 1IPAA 1Z5VA 3B6NA 5GAPK 3KJKA 4O4IA 3CMEF 3WGJA 1K9MH 1DT9A 4YJ2A 3TD5A 1VQ8F 2ZVYA 3I3FA 4ERHA 2RHHA 5EIBD 2HS3A 1ZWZA 2BTUA 2Q1YA 1YJ9F 3AGKA 1H48A 1W5FA 5HP8A 2LBWA 1SDSA 1FSZA 4X1IA 1VK3A 2VGMA 4RQOA 5FLXM 1Q8RA 1U3PA 2UZHA 1W5AA 5CA0B 1IV4A 2AIFA 2Z1EA 3VI6A 3V7EA 2UYKA 3HKDA 3Q8HA 4U3JB 3MCQA 3PAFA 2BTOA 2HP0B 4WBNA 4TUYB 5LYJA 3HTNA 2I6DA 1GZ0A 4B62A 2DT4A 5HY2A 5CA1A 2PMPA 4ZK7A 5J2TA 3J80M 3RYFA 3CCSF 3VIUA 1YJNF 3RYIA 2RHJA 5B8FA 1N8RH 3DC2A 3TD4A 3S02A 1X25A 4IIJA 4X1YB 4O2AB 3MDOA 2CW4A 1U3LA 3I55F 4O4JB 5LA6A 5BMVB 1W40A 3F0DA 3LDTA 2IG8A 3VMFB 1RLGA 1VQ9F 2IQQA 1H7MA 5ITZA 1IV3A 3CCMF 3FPIA 2Q1XA 2Z01A 5LXTA 1VH8A 4B5CA 2IAFA 1KQSF 2H6LA 5LP6C 3N2GA 2R6R1 3RE3A 3WGLA 2HVYD 1VQ7F 3JVHA 5MN6A 2CWJA 4ZI7B 3RYCB 3UT5A 3WGNA 4DXDA 3E22A 1W42A 1VQOF 3CB2A 2CHSA 2OTMA 3VOBA 1R1MA 1UI9A 4ZHYB 4YJ3B 4BT2A 2H8EA 2ZF8A 5C8YB 4ZOLB 4EI9A 4LCKA 4X20B 4DRXA 4BVSA 3JASA 3WJPA 1VQLF 4X1KA 1CK2A 5JQGB 5LP6A 3DDNA 2Z1UA 5CB4A 2BO1A 1W5EA 2EWCA 2RHLA 3OBWA 3IMPA 2H8CA 1VQ6F 5FJ4C 1NJIH 1VQ4F 2FGYA 2B33A 1RQ2A 3VOAA 3SIVA 5JVDA 3N2KA 1DBFA 5KX5B 4O4IB 3L7QA 1Q82H 4TV9B 5LOVB 4O2BB 5MN4A 2ZVZA 4F6RA 1PXWA 3ZOPA 5IJ9A 5GIOC 2OTLF 3CPQA 5HY1A 4ZHQA 5HXUA 3CC7F 5EYPA 5MN5A 1RQ7A 3VYUC 3IKFA 3FFMA 1RLUA 2UYPA 3MCAB 4LNUA 4O4HA 5EB1B 4I4TA 4RHAA 3HKCA 4XCQA 3NK7A 4G4WA 3O85A 1YIJF 2HP3A 1KC8H 3K12A 3ZP7A 3KHNA 4HNAA 3R0PA 4IHJB 3HKDB 3WGKA 1Q7YH 1J7HA 2UYNA 3JARB 4WBNB 3JAKA 3OW2F 3U0OA
chains in the Genus database with same CATH topology
3Q8HA 1GX1A 1KNKA 3F6MA 3FPIA 3F0EA 4C8EA 3ERNA 4C8GA 3MBMA 1VH8A 1VHAA 3F0GA 2AMTA 2PMPA 3F0FA 1W55A 3P0ZA 3K2XA 3IKFA 4C81A 3RE3A 3IEWA 1JY8A 2GZLA 3T80A 3IKEA 3K14A 3FBAA 4C8IA 4C82A 5B8FA 3JVHA 3IEQA 1H48A 1JN1A 1W57A 1U3LA 1U40A 1H47A 3GHZA 1T0AA 1YQNA 1IV2A 1U3PA 2UZHA 3ESJA 3F0DA 3QHDA 1IV4A 1KNJA 3ELCA 3P10A 3EORA 1IV1A 3KE1A 1U43A 3B6NA 1IV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8H A;  1GX1 A;  1KNK A;  3F6M A;  3FPI A;  3F0E A;  4C8E A;  3ERN A;  4C8G A;  3MBM A;  1VH8 A;  1VHA A;  3F0G A;  2AMT A;  2PMP A;  3F0F A;  1W55 A;  3P0Z A;  3K2X A;  3IKF A;  4C81 A;  3RE3 A;  3IEW A;  1JY8 A;  2GZL A;  3T80 A;  3IKE A;  3K14 A;  3FBA A;  4C8I A;  4C82 A;  5B8F A;  3JVH A;  3IEQ A;  1H48 A;  1JN1 A;  1W57 A;  1U3L A;  1U40 A;  1H47 A;  3GHZ A;  1T0A A;  1YQN A;  1IV2 A;  1U3P A;  2UZH A;  3ESJ A;  3F0D A;  3QHD A;  1IV4 A;  1KNJ A;  3ELC A;  3P10 A;  3EOR A;  1IV1 A;  3KE1 A;  1U43 A;  3B6N A;  1IV3 A; 
#chains in the Genus database with same CATH topology
 1GX1 A;  3F6M A;  5CA1 B;  5FNV A;  1JD1 A;  1FFX A;  5J2T B;  3RYF B;  3S06 A;  5EZY A;  3F0F A;  3VYS C;  4IIJ B;  4ZHW A;  3JAW A;  2GZL A;  4X3L A;  3T80 A;  1JN1 A;  3P4E A;  5HXZ A;  5J2U A;  2RB9 A;  2ZOV A;  3LWQ C;  3FD6 A;  4I55 A;  4R40 B;  3QHD A;  5JH7 A;  1JFF A;  5GON A;  2P6Y A;  2Z1T A;  5LXT B;  3FD5 A;  4O4L B;  3RA5 A;  1KD1 H;  5HP7 A;  4M8I A;  1ONI A;  2HS4 A;  3F0E A;  5JCO C;  4BW0 B;  5EO3 A;  1VQM F;  1W41 A;  5GAN K;  3VO8 A;  3S0H A;  4EI8 A;  3CMA F;  3RYH A;  3E22 B;  1YJW F;  5IYZ A;  3K0T A;  3I56 F;  1U40 A;  5HWE A;  2VGN A;  3C8L A;  5G4U C;  1YQN A;  2GVI A;  3JAT B;  1TUB A;  3HKB A;  5IJ0 A;  2F9Z C;  3C9S A;  3EOR A;  4G4Y A;  3NVK E;  1SA0 A;  3JAS B;  1PF5 A;  3HJW C;  5KMG A;  1VQN F;  5CB4 B;  3D01 A;  3F0G A;  5JCO A;  2HRY A;  3ZP4 A;  1E7K A;  3K14 A;  1Q86 H;  1RA4 A;  5EB0 A;  3CC4 F;  3WXM B;  3M4S A;  1QAH A;  3S0W A;  1KNJ A;  1NMU B;  4BT5 A;  3J7A R;  2LBT A;  3BYQ A;  3CCR F;  3PLA C;  3E20 B;  1XV2 A;  2FC3 A;  2R75 1;  1YIT F;  2KTU A;  3V4D A;  4C8G A;  1X7O A;  4BVT A;  2MQE A;  3D00 A;  1VQP F;  4LNU B;  2HP0 A;  4O4H B;  2AMT A;  4FFB B;  4I4T B;  4TUY A;  4X3M A;  3IEW A;  1GO0 A;  3LWV C;  3HKE A;  3J81 M;  3CG6 A;  3KIZ A;  4B46 A;  3OON A;  4G4X A;  4C4W C;  1K73 H;  3CPW F;  3JAL A;  3E1Y A;  2UYN B;  3VCZ A;  2HX0 A;  2VAW A;  4X1Y A;  3OBY A;  4O2A A;  4KWE A;  4O4J A;  4BVR A;  5BMV A;  5EIB C;  4BT7 A;  3V3T A;  3GTZ A;  1Q81 H;  1M90 H;  3ON1 A;  1TVK A;  4YJ2 B;  2AIZ P;  2JNB A;  2G9I A;  3JCM M;  3QUW A;  3CCV F;  3ZO8 A;  1T0K B;  4EB6 A;  2LCA A;  4X1I B;  2YXZ A;  3LFO A;  4I55 B;  3JAM M;  3LYB A;  4TV8 A;  2OHW A;  4ZI7 A;  5GON B;  3RYC A;  1IV2 A;  3WPW A;  3MQW A;  1OFU A;  2L26 A;  3CYQ A;  5LYJ B;  2W8B C;  4YJ3 A;  4EI7 A;  2NMU A;  4E6E A;  1COM A;  1W58 1;  2OTJ F;  3RYH B;  1XHO A;  1QD9 A;  2WAL A;  2HRU A;  3S03 A;  3RYI B;  2DYY A;  1W55 A;  3P0Z A;  4ZHV A;  2K1S A;  2QEX F;  4NWO B;  3IKE A;  2QI2 A;  5JQG A;  3G4S F;  3LME A;  1XRG A;  4I50 A;  5LA6 B;  3QTY A;  1TUB B;  3HKB B;  5IJ0 B;  3GHZ A;  3D54 A;  3CCQ F;  3ESJ A;  5GIP C;  1SA0 B;  3NVI B;  5ITZ B;  3ELC A;  3P10 A;  3LWO C;  2OZB A;  3KE1 A;  4NQ3 A;  5KMG B;  5GIN C;  3WJQ A;  1U43 A;  3S0Y A;  3CCL F;  2ZOD A;  3HWU A;  5KX5 A;  3WJR A;  4TV9 A;  5LOV A;  4O2B A;  2QTP A;  2GLZ A;  3N2G B;  5A2Q M;  1UFY A;  2CHT A;  3WGM A;  3NMU C;  3CCE F;  1JJ2 F;  1JY8 A;  2N48 A;  1Z5W A;  3UT5 B;  1CLI A;  2QA4 F;  1NQ3 A;  3VYT C;  3G71 F;  1FNK A;  3SIU A;  2CSL A;  2HS0 A;  2BTQ B;  4IHJ A;  4BT6 A;  4DRX B;  3JAR A;  4BY9 D;  2PHN A;  4PWT A;  4BVQ A;  4X1K B;  1VHA A;  5LP6 B;  1QVG F;  1W59 A;  3HKE B;  4B45 A;  4G88 A;  3K2X A;  4NUT A;  1VQ5 F;  3JAL B;  1X7P A;  4C8I A;  5HY4 A;  1W57 A;  1ODE A;  1H47 A;  2ZAU A;  1T0A A;  3N2K B;  5JVD B;  2KG4 A;  3M84 A;  3NK6 A;  1TVK B;  4F6R B;  5IJ9 B;  5CA0 A;  5HY0 A;  1KNK A;  2CVL A;  3CYP B;  5EAZ A;  4ZHQ B;  4O4L A;  5EYP B;  1SZQ A;  2YYE A;  3ERN A;  3MBM A;  4U3J A;  4EB6 B;  3HKC B;  2Z1F A;  2RHO A;  2UYJ A;  4G4Z A;  3WPX A;  4U39 A;  1W5B A;  3N4Z A;  3FBA A;  4TV8 B;  4C82 A;  3HAX D;  4HNA B;  1W3E X;  1K8A H;  4G4V A;  3C9T A;  4TZZ A;  3I7T A;  1YHQ F;  1OAP A;  3C9R A;  3JAK B;  1IV1 A;  2HQS C;  3JAT A;  5FNV B;  3CC2 F;  1S72 F;  3IR9 A;  1FFX B;  2VXY A;  3LWR C;  5EZY B;  3RA6 A;  3JAW B;  4C81 A;  4I50 B;  5AVM A;  1XBI A;  2CZW A;  5J2U B;  3IEQ A;  5EWR A;  1QVF F;  3C9U A;  3N4Y A;  5DCV A;  1CN7 A;  5JH7 B;  5G4V C;  1JFF B;  2LBX A;  1YI2 F;  2I6R A;  2VAP A;  1W2B F;  1YGY A;  3CCU F;  1FNJ A;  4BT4 A;  3CCJ F;  4C8E A;  5C8Y A;  4ZOL A;  2KTV A;  4X20 A;  1GO1 A;  1M1K H;  1VQK F;  4FFB A;  5IYZ B;  4BT3 A;  3CXC F;  1VQV A;  2ALE A;  3LWP C;  2KGW A;  3VTI C;  2V9Y A;  3G6E F;  3M1X A;  2VAM A;  3TD3 A;  1X52 A;  1QU9 A;  3GYQ A;  3CD6 F;  5IT9 M;  3V7Q A;  3KJJ A;  1IPA A;  1Z5V A;  3B6N A;  5GAP K;  3KJK A;  4O4I A;  3CME F;  3WGJ A;  1K9M H;  1DT9 A;  4YJ2 A;  3TD5 A;  1VQ8 F;  2ZVY A;  3I3F A;  4ERH A;  2RHH A;  5EIB D;  2HS3 A;  1ZWZ A;  2BTU A;  2Q1Y A;  1YJ9 F;  3AGK A;  1H48 A;  1W5F A;  5HP8 A;  2LBW A;  1SDS A;  1FSZ A;  4X1I A;  1VK3 A;  2VGM A;  4RQO A;  5FLX M;  1Q8R A;  1U3P A;  2UZH A;  1W5A A;  5CA0 B;  1IV4 A;  2AIF A;  2Z1E A;  3VI6 A;  3V7E A;  2UYK A;  3HKD A;  3Q8H A;  4U3J B;  3MCQ A;  3PAF A;  2BTO A;  2HP0 B;  4WBN A;  4TUY B;  5LYJ A;  3HTN A;  2I6D A;  1GZ0 A;  4B62 A;  2DT4 A;  5HY2 A;  5CA1 A;  2PMP A;  4ZK7 A;  5J2T A;  3J80 M;  3RYF A;  3CCS F;  3VIU A;  1YJN F;  3RYI A;  2RHJ A;  5B8F A;  1N8R H;  3DC2 A;  3TD4 A;  3S02 A;  1X25 A;  4IIJ A;  4X1Y B;  4O2A B;  3MDO A;  2CW4 A;  1U3L A;  3I55 F;  4O4J B;  5LA6 A;  5BMV B;  1W40 A;  3F0D A;  3LDT A;  2IG8 A;  3VMF B;  1RLG A;  1VQ9 F;  2IQQ A;  1H7M A;  5ITZ A;  1IV3 A;  3CCM F;  3FPI A;  2Q1X A;  2Z01 A;  5LXT A;  1VH8 A;  4B5C A;  2IAF A;  1KQS F;  2H6L A;  5LP6 C;  3N2G A;  2R6R 1;  3RE3 A;  3WGL A;  2HVY D;  1VQ7 F;  3JVH A;  5MN6 A;  2CWJ A;  4ZI7 B;  3RYC B;  3UT5 A;  3WGN A;  4DXD A;  3E22 A;  1W42 A;  1VQO F;  3CB2 A;  2CHS A;  2OTM A;  3VOB A;  1R1M A;  1UI9 A;  4ZHY B;  4YJ3 B;  4BT2 A;  2H8E A;  2ZF8 A;  5C8Y B;  4ZOL B;  4EI9 A;  4LCK A;  4X20 B;  4DRX A;  4BVS A;  3JAS A;  3WJP A;  1VQL F;  4X1K A;  1CK2 A;  5JQG B;  5LP6 A;  3DDN A;  2Z1U A;  5CB4 A;  2BO1 A;  1W5E A;  2EWC A;  2RHL A;  3OBW A;  3IMP A;  2H8C A;  1VQ6 F;  5FJ4 C;  1NJI H;  1VQ4 F;  2FGY A;  2B33 A;  1RQ2 A;  3VOA A;  3SIV A;  5JVD A;  3N2K A;  1DBF A;  5KX5 B;  4O4I B;  3L7Q A;  1Q82 H;  4TV9 B;  5LOV B;  4O2B B;  5MN4 A;  2ZVZ A;  4F6R A;  1PXW A;  3ZOP A;  5IJ9 A;  5GIO C;  2OTL F;  3CPQ A;  5HY1 A;  4ZHQ A;  5HXU A;  3CC7 F;  5EYP A;  5MN5 A;  1RQ7 A;  3VYU C;  3IKF A;  3FFM A;  1RLU A;  2UYP A;  3MCA B;  4LNU A;  4O4H A;  5EB1 B;  4I4T A;  4RHA A;  3HKC A;  4XCQ A;  3NK7 A;  4G4W A;  3O85 A;  1YIJ F;  2HP3 A;  1KC8 H;  3K12 A;  3ZP7 A;  3KHN A;  4HNA A;  3R0P A;  4IHJ B;  3HKD B;  3WGK A;  1Q7Y H;  1J7H A;  2UYN A;  3JAR B;  4WBN B;  3JAK A;  3OW2 F;  3U0O A; 
#chains in the Genus database with same CATH homology
 3Q8H A;  1GX1 A;  1KNK A;  3F6M A;  3FPI A;  3F0E A;  4C8E A;  3ERN A;  4C8G A;  3MBM A;  1VH8 A;  1VHA A;  3F0G A;  2AMT A;  2PMP A;  3F0F A;  1W55 A;  3P0Z A;  3K2X A;  3IKF A;  4C81 A;  3RE3 A;  3IEW A;  1JY8 A;  2GZL A;  3T80 A;  3IKE A;  3K14 A;  3FBA A;  4C8I A;  4C82 A;  5B8F A;  3JVH A;  3IEQ A;  1H48 A;  1JN1 A;  1W57 A;  1U3L A;  1U40 A;  1H47 A;  3GHZ A;  1T0A A;  1YQN A;  1IV2 A;  1U3P A;  2UZH A;  3ESJ A;  3F0D A;  3QHD A;  1IV4 A;  1KNJ A;  3ELC A;  3P10 A;  3EOR A;  1IV1 A;  3KE1 A;  1U43 A;  3B6N A;  1IV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...