2GZLA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for Ispf, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2gzlA00
1JN1A 1U3PA 1IV4A 3P0ZA 3QHDA 4C8IA 4C81A 3IEWA 1U40A 1JY8A 3MBMA 3F0DA 3IKEA 3FPIA 3JVHA 2PMPA 3K14A 1H47A 1W57A 1GX1A 1W55A 3EORA 1H48A 3KE1A 4C8GA 3K2XA 3ERNA 3GHZA 3F0GA 3RE3A 2AMTA 3ELCA 3Q8HA 1U43A 1T0AA 3F0EA 2GZLA 3FBAA 3P10A 5B8FA 1YQNA 1IV3A 1IV2A 3T80A 1IV1A 1VH8A 3F6MA 2UZHA 1U3LA 3F0FA 4C8EA 3ESJA 1VHAA 3IKFA 4C82A 3IEQA 1KNKA 1KNJA 3B6NA
chains in the Genus database with same CATH superfamily
3RYIB 5KMGA 1XV2A 3WGNA 4I55A 3JARB 2GLZA 5G4VC 3NK7A 1VQ5F 5CB4B 3RYHB 4TUYB 5FLXM 2KTVA 3LWVC 3CCJF 5MN5A 4ZK7A 2OHWA 3JATA 4X20B 1VQKF 3FFMA 2IQQA 4X1KA 2HS3A 1QD9A 5FNVB 1ONIA 1K9MH 5LA6A 5FJ4C 1VK3A 2L26A 3MBMA 5EAZA 5KX5B 4FFBA 4O4HA 5KMGB 2W8BC 4G4ZA 3RE3A 4I55B 4G4XA 4TV9B 4YJ2A 3F6MA 5IT9M 1VQNF 3WGLA 3V3TA 3ZP4A 1DT9A 1QVGF 2MQEA 3J80M 5EIBD 5CA1B 2R751 1YHQF 4O4JB 1VQPF 2Q1YA 3WGKA 3JATB 5JQGB 3WPWA 3CG6A 3I55F 3LDTA 3IKEA 4X1KB 2H8EA 2I6RA 2CW4A 1W55A 5LP6A 2LBWA 5GAPK 4I4TA 2NMUA 1YIJF 4ZHVA 1U43A 1FNJA 5LA6B 3CC2F 3UT5A 3CPWF 2HP3A 5HY0A 4E6EA 2CHTA 5HP8A 4FFBB 4O4HB 2UZHA 4BT2A 3CCLF 3JAKA 4IIJA 2RHJA 5JH7A 3PLAC 4R40B 1Q8RA 3V7EA 4YJ2B 3JAWB 1U3PA 2GVIA 3TD3A 2Q1XA 5J2TA 2FGYA 3JASA 5JCOA 3S06A 1W57A 4DRXA 5HY2A 3D00A 1VQ4F 2LBXA 2OTJF 1VQLF 2VAPA 1W581 3GHZA 5HP7A 2AMTA 2Z1EA 3G4SF 3CCRF 5GONA 4G4VA 5DCVA 3I3FA 3KJJA 3T80A 3CD6F 1VH8A 3E1YA 5LP6B 3P4EA 3CCQF 3VIUA 4C8EA 1S72F 1RQ2A 3QTYA 4I4TB 1J7HA 3JAKB 4BVRA 3QUWA 3CCMF 4IIJB 3RYHA 5JH7B 4TUYA 1JFFB 3F0DA 3OW2F 3CCUF 3K14A 5GANK 5IJ9A 3KE1A 1KC8H 3VYTC 3WXMB 4X20A 3N4ZA 2G9IA 3J7AR 3F0EA 5J2TB 3K0TA 3VI6A 4BT4A 1W5BA 1VHAA 3HTNA 4C82A 5CA0B 4B46A 5GONB 2HQSC 3DDNA 5HY1A 3S03A 3WJQA 3ZP7A 5KX5A 5HY4A 5LP6C 3VMFB 2AIZP 3SIUA 1U40A 1JY8A 2RHOA 3M4SA 3JVHA 2VAWA 3KIZA 3WGJA 2VGNA 2YXZA 4TV9A 5EYPA 3CCEF 2WALA 1CN7A 4X1IB 5CA1A 3HKBA 5IJ9B 4O4JA 5LOVB 3TD5A 3MCQA 3C9UA 5JQGA 3IR9A 4O4LB 4EB6A 1YJ9F 3DC2A 3K12A 3MQWA 4O4IB 1GO0A 2Z1FA 5BMVB 3S0WA 5JCOC 3VCZA 3WJPA 1SDSA 4RHAA 4DXDA 1Q7YH 4LNUB 5A2QM 1SA0A 1H47A 1H48A 2K1SA 4ZOLA 2OTLF 1ZWZA 3I7TA 1CLIA 2HX0A 1PXWA 2RHLA 4PWTA 3C8LA 3OBYA 4EI9A 1VQ7F 2QI2A 4BY9D 1Q86H 5EYPB 3JAWA 1U3LA 3F0FA 5J2UB 1FFXA 4M8IA 1E7KA 2KG4A 3IEQA 5EB0A 2BO1A 2PHNA 2RB9A 3HKBB 1K73H 4C81A 1M1KH 4EB6B 4U39A 1Z5WA 3S0HA 2PMPA 4X1YA 4IHJA 5HWEA 5JVDA 3WGMA 2KGWA 4NWOB 1W40A 3LMEA 3E20B 3LWOC 1W42A 3S0YA 1IV3A 3WPXA 4XCQA 3RYCA 1OFUA 1SA0B 4ZOLB 3PAFA 4TV8A 1VQOF 3VYUC 1H7MA 4X3LA 1JFFA 2VAMA 2V9YA 1JN1A 1SZQA 3QHDA 2LCAA 5ITZB 1FFXB 1K8AH 2I6DA 2CVLA 3HKEA 5C8YA 3HJWC 1GZ0A 1RLGA 5EZYB 2IAFA 5CA0A 4B5CA 1YGYA 4NUTA 4X1YB 4IHJB 5IJ0A 3JALA 5JVDB 1W59A 1VQ8F 1OAPA 3NK6A 4F6RA 5EO3A 5EIBC 2UYNA 4X3MA 3RYCB 3ZO8A 1IV4A 1XHOA 4TV8B 3C9TA 2CZWA 1TVKA 3FPIA 3U0OA 3C9SA 4NQ3A 4X1IA 1X52A 2UYKA 5LYJA 5LOVA 4TZZA 3NVKE 4LCKA 5G4UC 1Q82H 1NJIH 2Z1UA 4O4LA 5EWRA 1W2BF 1T0AA 1NMUB 4O4IA 1COMA 1FSZA 3HKEB 3C9RA 1W41A 2UYPA 5BMVA 5C8YB 3HKDB 4G4YA 3CXCF 3S02A 3ZOPA 5GIOC 2BTUA 1VQMF 3L7QA 2ALEA 4LNUA 3CC4F 3N2GB 3FD5A 3RA6A 4G4WA 3R0PA 2AIFA 2Z01A 5IJ0B 3JALB 4BVSA 3GTZA 3NVIB 4F6RB 2UYNB 1X25A 5J2UA 4ZHWA 3VTIC 3Q8HA 3ELCA 1KD1H 2VXYA 1QU9A 1CK2A 2GZLA 2RHHA 3CPQA 1TVKB 1W3EX 2ZODA 1N8RH 1FNKA 2DYYA 2FC3A 1W5EA 5LYJB 3LWPC 1IPAA 2CSLA 3NMUC 2BTQB 1YJWF 1RLUA 3JAMM 3HKCA 4ZHQB 5MN4A 4C8IA 3I56F 4ZI7B 4ERHA 3N4YA 2QEXF 4YJ3A 4U3JA 3HWUA 3VYSC 2ZOVA 3N2KA 5HXZA 1YQNA 1IV2A 3RYFA 3WJRA 2JNBA 5ITZA 2R6R1 3V4DA 2HRYA 3ON1A 4HNAA 3KHNA 2OZBA 2H6LA 4BVQA 3CMEF 1KQSF 3CCVF 5EZYA 1RQ7A 3M1XA 5IYZB 4O2BB 1DBFA 2UYJA 4C8GA 3VOBA 3HKCB 3HAXD 2HS4A 2N48A 1UI9A 4O2AA 2IG8A 3CYQA 2F9ZC 3CMAF 5MN6A 4BT5A 4I50A 1X7PA 1JJ2F 1QAHA 4YJ3B 4EI8A 4U3JB 5HXUA 4WBNA 1R1MA 2BTOA 3MDOA 3O85A 1QVFF 4BT6A 3N2KB 1KNJA 4B62A 3RYFB 4EI7A 2HVYD 1UFYA 1NQ3A 5GIPC 4HNAB 2YYEA 1GX1A 3M84A 1T0KB 3HKDA 3OBWA 5LXTA 3CYPB 2VGMA 3RA5A 4BT3A 3LWQC 1TUBA 3FBAA 5B8FA 1W5FA 1GO1A 1IV1A 3N2GA 2EWCA 3CC7F 2HP0A 2H8CA 4O2AB 1KNKA 2QA4F 2ZVYA 1M90H 5EB1B 3D01A 2ZAUA 3B6NA 3MCAB 3KJKA 4ZHYB 4I50B 5AVMA 3IMPA 3IEWA 3G71F 5GINC 3CCSF 3CB2A 1VQ9F 1XBIA 4WBNB 3FD6A 4KWEA 4G88A 1YITF 3AGKA 1Z5VA 3E22A 2Z1TA 3ERNA 2HRUA 3F0GA 1VQVA 3P10A 4C4WC 3RYIA 2KTUA 3LFOA 3LYBA 4ZHQA 1ODEA 5LXTB 3LWRC 2QTPA 3JARA 3UT5B 4B45A 1TUBB 4ZI7A 2HS0A 3TD4A 1YJNF 1RA4A 1W5AA 3P0ZA 5CB4A 3D54A 3OONA 3SIVA 2HP0B 1XRGA 3VO8A 1PF5A 2CWJA 1X7OA 2P6YA 2B33A 3EORA 3J81M 3VOAA 1JD1A 3G6EF 2DT4A 3K2XA 3JCMM 3V7QA 2CHSA 2OTMA 3JASB 2LBTA 4BT7A 2ZF8A 4DRXB 5FNVA 3E22B 4BVTA 2ZVZA 3ESJA 3IKFA 3BYQA 3GYQA 4RQOA 1VQ6F 5IYZA 1Q81H 1YI2F 4O2BA 4BW0B
chains in the Genus database with same CATH topology
1JN1A 1U3PA 1IV4A 3P0ZA 3QHDA 4C8IA 4C81A 3IEWA 1U40A 1JY8A 3MBMA 3F0DA 3IKEA 3FPIA 3JVHA 2PMPA 3K14A 1H47A 1W57A 1GX1A 1W55A 3EORA 1H48A 3KE1A 4C8GA 3K2XA 3ERNA 3GHZA 3F0GA 3RE3A 2AMTA 3ELCA 3Q8HA 1U43A 1T0AA 3F0EA 2GZLA 3FBAA 3P10A 5B8FA 1YQNA 1IV3A 1IV2A 3T80A 1IV1A 1VH8A 3F6MA 2UZHA 1U3LA 3F0FA 4C8EA 3ESJA 1VHAA 3IKFA 4C82A 3IEQA 1KNKA 1KNJA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN1 A;  1U3P A;  1IV4 A;  3P0Z A;  3QHD A;  4C8I A;  4C81 A;  3IEW A;  1U40 A;  1JY8 A;  3MBM A;  3F0D A;  3IKE A;  3FPI A;  3JVH A;  2PMP A;  3K14 A;  1H47 A;  1W57 A;  1GX1 A;  1W55 A;  3EOR A;  1H48 A;  3KE1 A;  4C8G A;  3K2X A;  3ERN A;  3GHZ A;  3F0G A;  3RE3 A;  2AMT A;  3ELC A;  3Q8H A;  1U43 A;  1T0A A;  3F0E A;  2GZL A;  3FBA A;  3P10 A;  5B8F A;  1YQN A;  1IV3 A;  1IV2 A;  3T80 A;  1IV1 A;  1VH8 A;  3F6M A;  2UZH A;  1U3L A;  3F0F A;  4C8E A;  3ESJ A;  1VHA A;  3IKF A;  4C82 A;  3IEQ A;  1KNK A;  1KNJ A;  3B6N A; 
#chains in the Genus database with same CATH topology
 3RYI B;  5KMG A;  1XV2 A;  3WGN A;  4I55 A;  3JAR B;  2GLZ A;  5G4V C;  3NK7 A;  1VQ5 F;  5CB4 B;  3RYH B;  4TUY B;  5FLX M;  2KTV A;  3LWV C;  3CCJ F;  5MN5 A;  4ZK7 A;  2OHW A;  3JAT A;  4X20 B;  1VQK F;  3FFM A;  2IQQ A;  4X1K A;  2HS3 A;  1QD9 A;  5FNV B;  1ONI A;  1K9M H;  5LA6 A;  5FJ4 C;  1VK3 A;  2L26 A;  3MBM A;  5EAZ A;  5KX5 B;  4FFB A;  4O4H A;  5KMG B;  2W8B C;  4G4Z A;  3RE3 A;  4I55 B;  4G4X A;  4TV9 B;  4YJ2 A;  3F6M A;  5IT9 M;  1VQN F;  3WGL A;  3V3T A;  3ZP4 A;  1DT9 A;  1QVG F;  2MQE A;  3J80 M;  5EIB D;  5CA1 B;  2R75 1;  1YHQ F;  4O4J B;  1VQP F;  2Q1Y A;  3WGK A;  3JAT B;  5JQG B;  3WPW A;  3CG6 A;  3I55 F;  3LDT A;  3IKE A;  4X1K B;  2H8E A;  2I6R A;  2CW4 A;  1W55 A;  5LP6 A;  2LBW A;  5GAP K;  4I4T A;  2NMU A;  1YIJ F;  4ZHV A;  1U43 A;  1FNJ A;  5LA6 B;  3CC2 F;  3UT5 A;  3CPW F;  2HP3 A;  5HY0 A;  4E6E A;  2CHT A;  5HP8 A;  4FFB B;  4O4H B;  2UZH A;  4BT2 A;  3CCL F;  3JAK A;  4IIJ A;  2RHJ A;  5JH7 A;  3PLA C;  4R40 B;  1Q8R A;  3V7E A;  4YJ2 B;  3JAW B;  1U3P A;  2GVI A;  3TD3 A;  2Q1X A;  5J2T A;  2FGY A;  3JAS A;  5JCO A;  3S06 A;  1W57 A;  4DRX A;  5HY2 A;  3D00 A;  1VQ4 F;  2LBX A;  2OTJ F;  1VQL F;  2VAP A;  1W58 1;  3GHZ A;  5HP7 A;  2AMT A;  2Z1E A;  3G4S F;  3CCR F;  5GON A;  4G4V A;  5DCV A;  3I3F A;  3KJJ A;  3T80 A;  3CD6 F;  1VH8 A;  3E1Y A;  5LP6 B;  3P4E A;  3CCQ F;  3VIU A;  4C8E A;  1S72 F;  1RQ2 A;  3QTY A;  4I4T B;  1J7H A;  3JAK B;  4BVR A;  3QUW A;  3CCM F;  4IIJ B;  3RYH A;  5JH7 B;  4TUY A;  1JFF B;  3F0D A;  3OW2 F;  3CCU F;  3K14 A;  5GAN K;  5IJ9 A;  3KE1 A;  1KC8 H;  3VYT C;  3WXM B;  4X20 A;  3N4Z A;  2G9I A;  3J7A R;  3F0E A;  5J2T B;  3K0T A;  3VI6 A;  4BT4 A;  1W5B A;  1VHA A;  3HTN A;  4C82 A;  5CA0 B;  4B46 A;  5GON B;  2HQS C;  3DDN A;  5HY1 A;  3S03 A;  3WJQ A;  3ZP7 A;  5KX5 A;  5HY4 A;  5LP6 C;  3VMF B;  2AIZ P;  3SIU A;  1U40 A;  1JY8 A;  2RHO A;  3M4S A;  3JVH A;  2VAW A;  3KIZ A;  3WGJ A;  2VGN A;  2YXZ A;  4TV9 A;  5EYP A;  3CCE F;  2WAL A;  1CN7 A;  4X1I B;  5CA1 A;  3HKB A;  5IJ9 B;  4O4J A;  5LOV B;  3TD5 A;  3MCQ A;  3C9U A;  5JQG A;  3IR9 A;  4O4L B;  4EB6 A;  1YJ9 F;  3DC2 A;  3K12 A;  3MQW A;  4O4I B;  1GO0 A;  2Z1F A;  5BMV B;  3S0W A;  5JCO C;  3VCZ A;  3WJP A;  1SDS A;  4RHA A;  4DXD A;  1Q7Y H;  4LNU B;  5A2Q M;  1SA0 A;  1H47 A;  1H48 A;  2K1S A;  4ZOL A;  2OTL F;  1ZWZ A;  3I7T A;  1CLI A;  2HX0 A;  1PXW A;  2RHL A;  4PWT A;  3C8L A;  3OBY A;  4EI9 A;  1VQ7 F;  2QI2 A;  4BY9 D;  1Q86 H;  5EYP B;  3JAW A;  1U3L A;  3F0F A;  5J2U B;  1FFX A;  4M8I A;  1E7K A;  2KG4 A;  3IEQ A;  5EB0 A;  2BO1 A;  2PHN A;  2RB9 A;  3HKB B;  1K73 H;  4C81 A;  1M1K H;  4EB6 B;  4U39 A;  1Z5W A;  3S0H A;  2PMP A;  4X1Y A;  4IHJ A;  5HWE A;  5JVD A;  3WGM A;  2KGW A;  4NWO B;  1W40 A;  3LME A;  3E20 B;  3LWO C;  1W42 A;  3S0Y A;  1IV3 A;  3WPX A;  4XCQ A;  3RYC A;  1OFU A;  1SA0 B;  4ZOL B;  3PAF A;  4TV8 A;  1VQO F;  3VYU C;  1H7M A;  4X3L A;  1JFF A;  2VAM A;  2V9Y A;  1JN1 A;  1SZQ A;  3QHD A;  2LCA A;  5ITZ B;  1FFX B;  1K8A H;  2I6D A;  2CVL A;  3HKE A;  5C8Y A;  3HJW C;  1GZ0 A;  1RLG A;  5EZY B;  2IAF A;  5CA0 A;  4B5C A;  1YGY A;  4NUT A;  4X1Y B;  4IHJ B;  5IJ0 A;  3JAL A;  5JVD B;  1W59 A;  1VQ8 F;  1OAP A;  3NK6 A;  4F6R A;  5EO3 A;  5EIB C;  2UYN A;  4X3M A;  3RYC B;  3ZO8 A;  1IV4 A;  1XHO A;  4TV8 B;  3C9T A;  2CZW A;  1TVK A;  3FPI A;  3U0O A;  3C9S A;  4NQ3 A;  4X1I A;  1X52 A;  2UYK A;  5LYJ A;  5LOV A;  4TZZ A;  3NVK E;  4LCK A;  5G4U C;  1Q82 H;  1NJI H;  2Z1U A;  4O4L A;  5EWR A;  1W2B F;  1T0A A;  1NMU B;  4O4I A;  1COM A;  1FSZ A;  3HKE B;  3C9R A;  1W41 A;  2UYP A;  5BMV A;  5C8Y B;  3HKD B;  4G4Y A;  3CXC F;  3S02 A;  3ZOP A;  5GIO C;  2BTU A;  1VQM F;  3L7Q A;  2ALE A;  4LNU A;  3CC4 F;  3N2G B;  3FD5 A;  3RA6 A;  4G4W A;  3R0P A;  2AIF A;  2Z01 A;  5IJ0 B;  3JAL B;  4BVS A;  3GTZ A;  3NVI B;  4F6R B;  2UYN B;  1X25 A;  5J2U A;  4ZHW A;  3VTI C;  3Q8H A;  3ELC A;  1KD1 H;  2VXY A;  1QU9 A;  1CK2 A;  2GZL A;  2RHH A;  3CPQ A;  1TVK B;  1W3E X;  2ZOD A;  1N8R H;  1FNK A;  2DYY A;  2FC3 A;  1W5E A;  5LYJ B;  3LWP C;  1IPA A;  2CSL A;  3NMU C;  2BTQ B;  1YJW F;  1RLU A;  3JAM M;  3HKC A;  4ZHQ B;  5MN4 A;  4C8I A;  3I56 F;  4ZI7 B;  4ERH A;  3N4Y A;  2QEX F;  4YJ3 A;  4U3J A;  3HWU A;  3VYS C;  2ZOV A;  3N2K A;  5HXZ A;  1YQN A;  1IV2 A;  3RYF A;  3WJR A;  2JNB A;  5ITZ A;  2R6R 1;  3V4D A;  2HRY A;  3ON1 A;  4HNA A;  3KHN A;  2OZB A;  2H6L A;  4BVQ A;  3CME F;  1KQS F;  3CCV F;  5EZY A;  1RQ7 A;  3M1X A;  5IYZ B;  4O2B B;  1DBF A;  2UYJ A;  4C8G A;  3VOB A;  3HKC B;  3HAX D;  2HS4 A;  2N48 A;  1UI9 A;  4O2A A;  2IG8 A;  3CYQ A;  2F9Z C;  3CMA F;  5MN6 A;  4BT5 A;  4I50 A;  1X7P A;  1JJ2 F;  1QAH A;  4YJ3 B;  4EI8 A;  4U3J B;  5HXU A;  4WBN A;  1R1M A;  2BTO A;  3MDO A;  3O85 A;  1QVF F;  4BT6 A;  3N2K B;  1KNJ A;  4B62 A;  3RYF B;  4EI7 A;  2HVY D;  1UFY A;  1NQ3 A;  5GIP C;  4HNA B;  2YYE A;  1GX1 A;  3M84 A;  1T0K B;  3HKD A;  3OBW A;  5LXT A;  3CYP B;  2VGM A;  3RA5 A;  4BT3 A;  3LWQ C;  1TUB A;  3FBA A;  5B8F A;  1W5F A;  1GO1 A;  1IV1 A;  3N2G A;  2EWC A;  3CC7 F;  2HP0 A;  2H8C A;  4O2A B;  1KNK A;  2QA4 F;  2ZVY A;  1M90 H;  5EB1 B;  3D01 A;  2ZAU A;  3B6N A;  3MCA B;  3KJK A;  4ZHY B;  4I50 B;  5AVM A;  3IMP A;  3IEW A;  3G71 F;  5GIN C;  3CCS F;  3CB2 A;  1VQ9 F;  1XBI A;  4WBN B;  3FD6 A;  4KWE A;  4G88 A;  1YIT F;  3AGK A;  1Z5V A;  3E22 A;  2Z1T A;  3ERN A;  2HRU A;  3F0G A;  1VQV A;  3P10 A;  4C4W C;  3RYI A;  2KTU A;  3LFO A;  3LYB A;  4ZHQ A;  1ODE A;  5LXT B;  3LWR C;  2QTP A;  3JAR A;  3UT5 B;  4B45 A;  1TUB B;  4ZI7 A;  2HS0 A;  3TD4 A;  1YJN F;  1RA4 A;  1W5A A;  3P0Z A;  5CB4 A;  3D54 A;  3OON A;  3SIV A;  2HP0 B;  1XRG A;  3VO8 A;  1PF5 A;  2CWJ A;  1X7O A;  2P6Y A;  2B33 A;  3EOR A;  3J81 M;  3VOA A;  1JD1 A;  3G6E F;  2DT4 A;  3K2X A;  3JCM M;  3V7Q A;  2CHS A;  2OTM A;  3JAS B;  2LBT A;  4BT7 A;  2ZF8 A;  4DRX B;  5FNV A;  3E22 B;  4BVT A;  2ZVZ A;  3ESJ A;  3IKF A;  3BYQ A;  3GYQ A;  4RQO A;  1VQ6 F;  5IYZ A;  1Q81 H;  1YI2 F;  4O2B A;  4BW0 B; 
#chains in the Genus database with same CATH homology
 1JN1 A;  1U3P A;  1IV4 A;  3P0Z A;  3QHD A;  4C8I A;  4C81 A;  3IEW A;  1U40 A;  1JY8 A;  3MBM A;  3F0D A;  3IKE A;  3FPI A;  3JVH A;  2PMP A;  3K14 A;  1H47 A;  1W57 A;  1GX1 A;  1W55 A;  3EOR A;  1H48 A;  3KE1 A;  4C8G A;  3K2X A;  3ERN A;  3GHZ A;  3F0G A;  3RE3 A;  2AMT A;  3ELC A;  3Q8H A;  1U43 A;  1T0A A;  3F0E A;  2GZL A;  3FBA A;  3P10 A;  5B8F A;  1YQN A;  1IV3 A;  1IV2 A;  3T80 A;  1IV1 A;  1VH8 A;  3F6M A;  2UZH A;  1U3L A;  3F0F A;  4C8E A;  3ESJ A;  1VHA A;  3IKF A;  4C82 A;  3IEQ A;  1KNK A;  1KNJ A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...