2GZLA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
b'LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for Ispf, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2gzlA00
1IV4A 3Q8HA 1VHAA 3K14A 4C81A 1IV3A 3F0EA 3F0FA 3F0GA 1JN1A 3IEQA 1W57A 1H47A 1U40A 3P0ZA 4C8EA 4C8IA 1VH8A 3K2XA 3T80A 2GZLA 3GHZA 1W55A 4C8GA 3MBMA 3IKFA 3ESJA 1IV2A 1IV1A 1U43A 1JY8A 1GX1A 3P10A 2AMTA 3ERNA 3FPIA 3F6MA 1T0AA 3IEWA 3KE1A 3EORA 3QHDA 3F0DA 1U3PA 4C82A 3B6NA 3IKEA 3RE3A 3JVHA 1YQNA 3FBAA 3ELCA 2UZHA 1KNKA 2PMPA 1H48A 1KNJA 1U3LA 5B8FA
chains in the Genus database with same CATH superfamily
2RB9A 1YJWF 5MN6A 5BMVA 3CMEF 1NMUB 2CWJA 5LP6B 3CCJF 3AGKA 5HXZA 3E20B 4PWTA 4X1YB 4BVQA 1Q7YH 3CPWF 2OTJF 1JY8A 3O85A 3CCVF 3RA6A 2GVIA 1T0AA 3CYQA 4F6RA 4I50A 1KD1H 2CVLA 5HY0A 4RHAA 4NUTA 4O4JA 2H8EA 2RHHA 2KG4A 1U43A 5B8FA 2CW4A 3FD6A 1TVKA 3E22B 3BYQA 5JCOC 4EB6A 5IJ9A 2I6DA 3ZOPA 3JASB 3S0HA 3CD6F 5MN4A 3HKCB 1X52A 4BY9D 4X1YA 2LCAA 3E1YA 4RQOA 5EB1B 3KJJA 3K12A 5HY4A 5HXUA 5JH7B 3FPIA 4TV8B 5ITZB 4IHJA 4DXDA 1XBIA 4O4HB 3N4ZA 3JALA 5KMGB 3CCEF 3RYHB 4O4IA 3I3FA 4WBNB 2LBTA 2HP0B 2ZOVA 1VQNF 3HKDB 3E22A 5LYJA 3N2KA 1VH8A 2CZWA 3HWUA 3JAKB 4X3LA 3TD3A 3JASA 1W5BA 1Z5WA 5GIPC 3CC4F 4G4XA 4I55B 1DT9A 2ZVZA 1Q86H 4R40B 1W581 3VI6A 1VQ6F 5IT9M 1W42A 4G4YA 2UYNA 4X1IA 3F0DA 1U3PA 4LNUB 1UFYA 4YJ3B 1QVFF 5EYPA 5FJ4C 3HKBA 2UZHA 4KWEA 4DRXA 1SA0B 3LWRC 2V9YA 4WBNA 5JVDB 4G4VA 5CB4B 3IEQA 3P0ZA 2H8CA 2W8BC 2PHNA 1RQ2A 2Z1UA 1VQOF 3VOBA 1JD1A 1IV2A 4IIJB 1RA4A 2RHOA 3VYSC 1W40A 3K0TA 4B46A 3GYQA 2VGNA 3CCSF 3RYCA 1VQ5F 5EZYB 2LBWA 3V3TA 3JVHA 1KQSF 5CA0A 2FGYA 3HKEB 1QD9A 4U3JA 2VGMA 4O2BA 1H47A 2HQSC 3C9TA 3CXCF 3CCRF 1SZQA 5J2UB 3G6EF 2HRUA 1YIJF 2QEXF 2UYKA 4NWOB 3RYIB 1JJ2F 2BTOA 3I55F 3FD5A 5FNVB 5HY2A 2HS0A 4ERHA 5EZYA 2KTVA 3I7TA 4B62A 1YQNA 3FBAA 4BVSA 4BVTA 3DDNA 3MDOA 5CA1B 1IV4A 3WGLA 3M4SA 4FFBA 4TV9B 1W57A 3IMPA 3K2XA 3DC2A 1TUBB 1K9MH 4O4LA 4ZHWA 2EWCA 2VAPA 4BT7A 1W5EA 3JATB 3CC7F 4M8IA 1GX1A 3P10A 1N8RH 4X20A 4ZI7B 4X1KB 1H7MA 3S06A 3V7QA 5HWEA 3B6NA 1M1KH 2ZF8A 1VQMF 4I4TB 4HNAB 2QA4F 4ZHYB 5G4VC 2HS3A 1OFUA 5LA6B 2IG8A 3SIUA 2JNBA 3WGJA 4ZK7A 3R0PA 4U39A 3S03A 2GZLA 3ZO8A 3NMUC 3WGKA 3QUWA 5LP6A 3ESJA 1IV1A 3JATA 1FFXB 1OAPA 3KJKA 1RLUA 4TZZA 3C9UA 3ERNA 3EORA 5JQGB 2MQEA 3S02A 1NJIH 3S0WA 1T0KB 3OBWA 1S72F 4EI7A 2DT4A 4I4TA 3VMFB 3S0YA 1YI2F 3J80M 3Q8HA 3F0FA 3KIZA 3F0GA 2L26A 3M1XA 3WGNA 3JARB 5LA6A 3UT5B 4BVRA 1W55A 3HKCA 3IKFA 1FFXA 4BT3A 1JFFB 2HS4A 3JAWB 4EI9A 5JH7A 4ZHVA 1VQKF 5JQGA 2ZODA 3FFMA 4TV8A 4G88A 5ITZA 3CB2A 2CHSA 3RE3A 4O4HA 2LBXA 3JCMM 1KNKA 3WJPA 1ODEA 1W41A 5EB0A 5KMGA 3RYHA 3V7EA 5LXTB 3TD4A 4BW0B 1VQVA 1GO1A 2HP0A 1U40A 3N2GB 3JARA 3HKDA 3M84A 3NK7A 5IYZB 3CCLF 1W59A 3JAKA 3LYBA 2AIZP 1X7PA 4I55A 1Q81H 1CK2A 3WJQA 5EIBC 2QI2A 1K8AH 3WJRA 2KGWA 3U0OA 5J2TB 2DYYA 3IKEA 1VQ7F 4LNUA 5EO3A 3MQWA 4YJ3A 1H48A 1VHAA 1SA0A 5JVDA 5CB4A 2ZAUA 3G4SF 2Q1XA 4O2AB 3VCZA 3WXMB 4TUYB 3TD5A 2UYJA 3LWPC 3LMEA 2HX0A 4IIJA 2NMUA 3KE1A 5EAZA 1R1MA 3NVIB 3P4EA 5JCOA 2OZBA 3CCMF 1VK3A 2CHTA 5MN5A 3G71F 2HVYD 4NQ3A 5GONB 1X7OA 3CG6A 3K14A 5BMVB 3HKEA 3D00A 3WGMA 4O2AA 1UI9A 2CSLA 5J2UA 3LWVC 3V4DA 5AVMA 5EWRA 3RYIA 1YITF 3QTYA 1W3EX 3IR9A 1CLIA 1RLGA 5GAPK 3ZP7A 2IAFA 3GTZA 2ZVYA 3CCQF 3CYPB 2H6LA 5FNVA 1FNJA 1YJ9F 3HTNA 2OTMA 4X3MA 5HP7A 1TVKB 4C81A 3C9RA 4EB6B 5CA1A 5FLXM 5IJ9B 1YHQF 2RHJA 4TV9A 5EIBD 1W2BF 4G4WA 4C8GA 4XCQA 2HP3A 2B33A 2VAWA 2R751 4BT2A 1TUBA 3OBYA 3OW2F 1VQPF 1YJNF 5DCVA 5LOVB 3NK6A 4ZI7A 5HY1A 4X1KA 4IHJB 2YYEA 4C82A 5GINC 3C8LA 1ONIA 3JALB 5HP8A 4BT4A 3NVKE 3CPQA 3HJWC 3WPWA 1W5FA 3VIUA 4O4IB 3ELCA 1Q82H 2Z1EA 2YXZA 3L7QA 1X25A 5KX5B 1RQ7A 2Z1TA 4HNAA 4G4ZA 3VTIC 5LYJB 3N2KB 2Z1FA 1ZWZA 1VQ4F 1QAHA 3T80A 3CMAF 5IJ0B 1DBFA 1COMA 3CCUF 1YGYA 1VQ8F 1CN7A 2K1SA 5G4UC 2UYNB 4X1IB 1QU9A 3F6MA 2BTQB 3MCQA 5LOVA 3ON1A 2P6YA 3VOAA 3LWOC 5EYPB 2OHWA 3HKBB 1KC8H 2Z01A 4DRXB 3MCAB 2PMPA 1J7HA 1NQ3A 2WALA 5KX5A 1PXWA 2AIFA 3J81M 4C8EA 1K73H 3LDTA 3GHZA 5IJ0A 1GO0A 3UT5A 3VYTC 4ZOLB 1FNKA 2Q1YA 3VO8A 3OONA 5C8YB 2R6R1 4B5CA 4YJ2B 1JFFA 3PAFA 3J7AR 3RYCB 3JAWA 3QHDA 4BT5A 4BT6A 3VYUC 5LP6C 4E6EA 2QTPA 1Z5VA 2N48A 2KTUA 2VXYA 5CA0B 5A2QM 4LCKA 3JAMM 3PLAC 3SIVA 2VAMA 2OTLF 2I6RA 1Q8RA 4U3JB 3F0EA 4O2BB 1QVGF 3LWQC 1JN1A 5LXTA 3D01A 3N4YA 3ZP4A 3N2GA 1PF5A 3RYFB 5IYZA 1XV2A 3CC2F 1FSZA 4ZOLA 2G9IA 1VQLF 1E7KA 2AMTA 5C8YA 3LFOA 4C4WC 4YJ2A 1XHOA 4ZHQB 5J2TA 3KHNA 2BO1A 2BTUA 2RHLA 1KNJA 3C9SA 4FFBB 4EI8A 1IPAA 1IV3A 3I56F 1VQ9F 2F9ZC 3D54A 4O4LB 4C8IA 3MBMA 2GLZA 3RYFA 1GZ0A 2FC3A 3WPXA 4TUYA 2IQQA 2HRYA 4X20B 3RA5A 1M90H 4B45A 2UYPA 3IEWA 5GIOC 1XRGA 4F6RB 1W5AA 3HAXD 4I50B 4ZHQA 4O4JB 2ALEA 1SDSA 5GANK 5GONA 1U3LA
chains in the Genus database with same CATH topology
1IV4A 3Q8HA 1VHAA 3K14A 4C81A 1IV3A 3F0EA 3F0FA 3F0GA 1JN1A 3IEQA 1W57A 1H47A 1U40A 3P0ZA 4C8EA 4C8IA 1VH8A 3K2XA 3T80A 2GZLA 3GHZA 1W55A 4C8GA 3MBMA 3IKFA 3ESJA 1IV2A 1IV1A 1U43A 1JY8A 1GX1A 3P10A 2AMTA 3ERNA 3FPIA 3F6MA 1T0AA 3IEWA 3KE1A 3EORA 3QHDA 3F0DA 1U3PA 4C82A 3B6NA 3IKEA 3RE3A 3JVHA 1YQNA 3FBAA 3ELCA 2UZHA 1KNKA 2PMPA 1H48A 1KNJA 1U3LA 5B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV4 A;  3Q8H A;  1VHA A;  3K14 A;  4C81 A;  1IV3 A;  3F0E A;  3F0F A;  3F0G A;  1JN1 A;  3IEQ A;  1W57 A;  1H47 A;  1U40 A;  3P0Z A;  4C8E A;  4C8I A;  1VH8 A;  3K2X A;  3T80 A;  2GZL A;  3GHZ A;  1W55 A;  4C8G A;  3MBM A;  3IKF A;  3ESJ A;  1IV2 A;  1IV1 A;  1U43 A;  1JY8 A;  1GX1 A;  3P10 A;  2AMT A;  3ERN A;  3FPI A;  3F6M A;  1T0A A;  3IEW A;  3KE1 A;  3EOR A;  3QHD A;  3F0D A;  1U3P A;  4C82 A;  3B6N A;  3IKE A;  3RE3 A;  3JVH A;  1YQN A;  3FBA A;  3ELC A;  2UZH A;  1KNK A;  2PMP A;  1H48 A;  1KNJ A;  1U3L A;  5B8F A; 
#chains in the Genus database with same CATH topology
 2RB9 A;  1YJW F;  5MN6 A;  5BMV A;  3CME F;  1NMU B;  2CWJ A;  5LP6 B;  3CCJ F;  3AGK A;  5HXZ A;  3E20 B;  4PWT A;  4X1Y B;  4BVQ A;  1Q7Y H;  3CPW F;  2OTJ F;  1JY8 A;  3O85 A;  3CCV F;  3RA6 A;  2GVI A;  1T0A A;  3CYQ A;  4F6R A;  4I50 A;  1KD1 H;  2CVL A;  5HY0 A;  4RHA A;  4NUT A;  4O4J A;  2H8E A;  2RHH A;  2KG4 A;  1U43 A;  5B8F A;  2CW4 A;  3FD6 A;  1TVK A;  3E22 B;  3BYQ A;  5JCO C;  4EB6 A;  5IJ9 A;  2I6D A;  3ZOP A;  3JAS B;  3S0H A;  3CD6 F;  5MN4 A;  3HKC B;  1X52 A;  4BY9 D;  4X1Y A;  2LCA A;  3E1Y A;  4RQO A;  5EB1 B;  3KJJ A;  3K12 A;  5HY4 A;  5HXU A;  5JH7 B;  3FPI A;  4TV8 B;  5ITZ B;  4IHJ A;  4DXD A;  1XBI A;  4O4H B;  3N4Z A;  3JAL A;  5KMG B;  3CCE F;  3RYH B;  4O4I A;  3I3F A;  4WBN B;  2LBT A;  2HP0 B;  2ZOV A;  1VQN F;  3HKD B;  3E22 A;  5LYJ A;  3N2K A;  1VH8 A;  2CZW A;  3HWU A;  3JAK B;  4X3L A;  3TD3 A;  3JAS A;  1W5B A;  1Z5W A;  5GIP C;  3CC4 F;  4G4X A;  4I55 B;  1DT9 A;  2ZVZ A;  1Q86 H;  4R40 B;  1W58 1;  3VI6 A;  1VQ6 F;  5IT9 M;  1W42 A;  4G4Y A;  2UYN A;  4X1I A;  3F0D A;  1U3P A;  4LNU B;  1UFY A;  4YJ3 B;  1QVF F;  5EYP A;  5FJ4 C;  3HKB A;  2UZH A;  4KWE A;  4DRX A;  1SA0 B;  3LWR C;  2V9Y A;  4WBN A;  5JVD B;  4G4V A;  5CB4 B;  3IEQ A;  3P0Z A;  2H8C A;  2W8B C;  2PHN A;  1RQ2 A;  2Z1U A;  1VQO F;  3VOB A;  1JD1 A;  1IV2 A;  4IIJ B;  1RA4 A;  2RHO A;  3VYS C;  1W40 A;  3K0T A;  4B46 A;  3GYQ A;  2VGN A;  3CCS F;  3RYC A;  1VQ5 F;  5EZY B;  2LBW A;  3V3T A;  3JVH A;  1KQS F;  5CA0 A;  2FGY A;  3HKE B;  1QD9 A;  4U3J A;  2VGM A;  4O2B A;  1H47 A;  2HQS C;  3C9T A;  3CXC F;  3CCR F;  1SZQ A;  5J2U B;  3G6E F;  2HRU A;  1YIJ F;  2QEX F;  2UYK A;  4NWO B;  3RYI B;  1JJ2 F;  2BTO A;  3I55 F;  3FD5 A;  5FNV B;  5HY2 A;  2HS0 A;  4ERH A;  5EZY A;  2KTV A;  3I7T A;  4B62 A;  1YQN A;  3FBA A;  4BVS A;  4BVT A;  3DDN A;  3MDO A;  5CA1 B;  1IV4 A;  3WGL A;  3M4S A;  4FFB A;  4TV9 B;  1W57 A;  3IMP A;  3K2X A;  3DC2 A;  1TUB B;  1K9M H;  4O4L A;  4ZHW A;  2EWC A;  2VAP A;  4BT7 A;  1W5E A;  3JAT B;  3CC7 F;  4M8I A;  1GX1 A;  3P10 A;  1N8R H;  4X20 A;  4ZI7 B;  4X1K B;  1H7M A;  3S06 A;  3V7Q A;  5HWE A;  3B6N A;  1M1K H;  2ZF8 A;  1VQM F;  4I4T B;  4HNA B;  2QA4 F;  4ZHY B;  5G4V C;  2HS3 A;  1OFU A;  5LA6 B;  2IG8 A;  3SIU A;  2JNB A;  3WGJ A;  4ZK7 A;  3R0P A;  4U39 A;  3S03 A;  2GZL A;  3ZO8 A;  3NMU C;  3WGK A;  3QUW A;  5LP6 A;  3ESJ A;  1IV1 A;  3JAT A;  1FFX B;  1OAP A;  3KJK A;  1RLU A;  4TZZ A;  3C9U A;  3ERN A;  3EOR A;  5JQG B;  2MQE A;  3S02 A;  1NJI H;  3S0W A;  1T0K B;  3OBW A;  1S72 F;  4EI7 A;  2DT4 A;  4I4T A;  3VMF B;  3S0Y A;  1YI2 F;  3J80 M;  3Q8H A;  3F0F A;  3KIZ A;  3F0G A;  2L26 A;  3M1X A;  3WGN A;  3JAR B;  5LA6 A;  3UT5 B;  4BVR A;  1W55 A;  3HKC A;  3IKF A;  1FFX A;  4BT3 A;  1JFF B;  2HS4 A;  3JAW B;  4EI9 A;  5JH7 A;  4ZHV A;  1VQK F;  5JQG A;  2ZOD A;  3FFM A;  4TV8 A;  4G88 A;  5ITZ A;  3CB2 A;  2CHS A;  3RE3 A;  4O4H A;  2LBX A;  3JCM M;  1KNK A;  3WJP A;  1ODE A;  1W41 A;  5EB0 A;  5KMG A;  3RYH A;  3V7E A;  5LXT B;  3TD4 A;  4BW0 B;  1VQV A;  1GO1 A;  2HP0 A;  1U40 A;  3N2G B;  3JAR A;  3HKD A;  3M84 A;  3NK7 A;  5IYZ B;  3CCL F;  1W59 A;  3JAK A;  3LYB A;  2AIZ P;  1X7P A;  4I55 A;  1Q81 H;  1CK2 A;  3WJQ A;  5EIB C;  2QI2 A;  1K8A H;  3WJR A;  2KGW A;  3U0O A;  5J2T B;  2DYY A;  3IKE A;  1VQ7 F;  4LNU A;  5EO3 A;  3MQW A;  4YJ3 A;  1H48 A;  1VHA A;  1SA0 A;  5JVD A;  5CB4 A;  2ZAU A;  3G4S F;  2Q1X A;  4O2A B;  3VCZ A;  3WXM B;  4TUY B;  3TD5 A;  2UYJ A;  3LWP C;  3LME A;  2HX0 A;  4IIJ A;  2NMU A;  3KE1 A;  5EAZ A;  1R1M A;  3NVI B;  3P4E A;  5JCO A;  2OZB A;  3CCM F;  1VK3 A;  2CHT A;  5MN5 A;  3G71 F;  2HVY D;  4NQ3 A;  5GON B;  1X7O A;  3CG6 A;  3K14 A;  5BMV B;  3HKE A;  3D00 A;  3WGM A;  4O2A A;  1UI9 A;  2CSL A;  5J2U A;  3LWV C;  3V4D A;  5AVM A;  5EWR A;  3RYI A;  1YIT F;  3QTY A;  1W3E X;  3IR9 A;  1CLI A;  1RLG A;  5GAP K;  3ZP7 A;  2IAF A;  3GTZ A;  2ZVY A;  3CCQ F;  3CYP B;  2H6L A;  5FNV A;  1FNJ A;  1YJ9 F;  3HTN A;  2OTM A;  4X3M A;  5HP7 A;  1TVK B;  4C81 A;  3C9R A;  4EB6 B;  5CA1 A;  5FLX M;  5IJ9 B;  1YHQ F;  2RHJ A;  4TV9 A;  5EIB D;  1W2B F;  4G4W A;  4C8G A;  4XCQ A;  2HP3 A;  2B33 A;  2VAW A;  2R75 1;  4BT2 A;  1TUB A;  3OBY A;  3OW2 F;  1VQP F;  1YJN F;  5DCV A;  5LOV B;  3NK6 A;  4ZI7 A;  5HY1 A;  4X1K A;  4IHJ B;  2YYE A;  4C82 A;  5GIN C;  3C8L A;  1ONI A;  3JAL B;  5HP8 A;  4BT4 A;  3NVK E;  3CPQ A;  3HJW C;  3WPW A;  1W5F A;  3VIU A;  4O4I B;  3ELC A;  1Q82 H;  2Z1E A;  2YXZ A;  3L7Q A;  1X25 A;  5KX5 B;  1RQ7 A;  2Z1T A;  4HNA A;  4G4Z A;  3VTI C;  5LYJ B;  3N2K B;  2Z1F A;  1ZWZ A;  1VQ4 F;  1QAH A;  3T80 A;  3CMA F;  5IJ0 B;  1DBF A;  1COM A;  3CCU F;  1YGY A;  1VQ8 F;  1CN7 A;  2K1S A;  5G4U C;  2UYN B;  4X1I B;  1QU9 A;  3F6M A;  2BTQ B;  3MCQ A;  5LOV A;  3ON1 A;  2P6Y A;  3VOA A;  3LWO C;  5EYP B;  2OHW A;  3HKB B;  1KC8 H;  2Z01 A;  4DRX B;  3MCA B;  2PMP A;  1J7H A;  1NQ3 A;  2WAL A;  5KX5 A;  1PXW A;  2AIF A;  3J81 M;  4C8E A;  1K73 H;  3LDT A;  3GHZ A;  5IJ0 A;  1GO0 A;  3UT5 A;  3VYT C;  4ZOL B;  1FNK A;  2Q1Y A;  3VO8 A;  3OON A;  5C8Y B;  2R6R 1;  4B5C A;  4YJ2 B;  1JFF A;  3PAF A;  3J7A R;  3RYC B;  3JAW A;  3QHD A;  4BT5 A;  4BT6 A;  3VYU C;  5LP6 C;  4E6E A;  2QTP A;  1Z5V A;  2N48 A;  2KTU A;  2VXY A;  5CA0 B;  5A2Q M;  4LCK A;  3JAM M;  3PLA C;  3SIV A;  2VAM A;  2OTL F;  2I6R A;  1Q8R A;  4U3J B;  3F0E A;  4O2B B;  1QVG F;  3LWQ C;  1JN1 A;  5LXT A;  3D01 A;  3N4Y A;  3ZP4 A;  3N2G A;  1PF5 A;  3RYF B;  5IYZ A;  1XV2 A;  3CC2 F;  1FSZ A;  4ZOL A;  2G9I A;  1VQL F;  1E7K A;  2AMT A;  5C8Y A;  3LFO A;  4C4W C;  4YJ2 A;  1XHO A;  4ZHQ B;  5J2T A;  3KHN A;  2BO1 A;  2BTU A;  2RHL A;  1KNJ A;  3C9S A;  4FFB B;  4EI8 A;  1IPA A;  1IV3 A;  3I56 F;  1VQ9 F;  2F9Z C;  3D54 A;  4O4L B;  4C8I A;  3MBM A;  2GLZ A;  3RYF A;  1GZ0 A;  2FC3 A;  3WPX A;  4TUY A;  2IQQ A;  2HRY A;  4X20 B;  3RA5 A;  1M90 H;  4B45 A;  2UYP A;  3IEW A;  5GIO C;  1XRG A;  4F6R B;  1W5A A;  3HAX D;  4I50 B;  4ZHQ A;  4O4J B;  2ALE A;  1SDS A;  5GAN K;  5GON A;  1U3L A; 
#chains in the Genus database with same CATH homology
 1IV4 A;  3Q8H A;  1VHA A;  3K14 A;  4C81 A;  1IV3 A;  3F0E A;  3F0F A;  3F0G A;  1JN1 A;  3IEQ A;  1W57 A;  1H47 A;  1U40 A;  3P0Z A;  4C8E A;  4C8I A;  1VH8 A;  3K2X A;  3T80 A;  2GZL A;  3GHZ A;  1W55 A;  4C8G A;  3MBM A;  3IKF A;  3ESJ A;  1IV2 A;  1IV1 A;  1U43 A;  1JY8 A;  1GX1 A;  3P10 A;  2AMT A;  3ERN A;  3FPI A;  3F6M A;  1T0A A;  3IEW A;  3KE1 A;  3EOR A;  3QHD A;  3F0D A;  1U3P A;  4C82 A;  3B6N A;  3IKE A;  3RE3 A;  3JVH A;  1YQN A;  3FBA A;  3ELC A;  2UZH A;  1KNK A;  2PMP A;  1H48 A;  1KNJ A;  1U3L A;  5B8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...