4LCKA

Co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein/rna
molecule keywords Ribosomal protein YbxF
publication title Co-crystal structure of a T-box riboswitch stem I domain in complex with its cognate tRNA.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 16
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4lckA00
1S72F 3HAXD 2WALA 1KD1H 1Q86H 3AGKA 5FJ4C 1VQNF 1NJIH 2OTJF 3LWOC 1W40A 1YJNF 2LBXA 3MCAB 3RA5A 1VQ9F 2LBWA 1GO0A 5GIOC 1X52A 1X7OA 3CCQF 1K8AH 1JJ2F 4NUTA 3N4ZA 1GZ0A 1XBIA 3J80M 1SDSA 5GAPK 3CCSF 1Q81H 3HJWC 4X3LA 3RA6A 1VQOF 1W2BF 2QI2A 3LWRC 4LCKA 3SIVA 1YITF 1KC8H 5A2QM 3CMAF 1VQ7F 3GYQA 1KQSF 5EO3A 3OW2F 1GO1A 5G4VC 3WXMB 3G6EF 1RA4A 3CCRF 3CC4F 5EWRA 3CC7F 1W3EX 5GIPC 3G71F 5G4UC 2AIFA 1M90H 3PAFA 3JCMM 2QEXF 3N4YA 3LWPC 3PLAC 1VQMF 5FLXM 3CCEF 1YI2F 1W42A 2OTLF 3CCJF 1VQ4F 2KG4A 1T0KB 3E20B 3OBYA 2HVYD 1X7PA 4BY9D 3CG6A 3NMUC 1YHQF 1VQPF 3V7EA 5GINC 1YIJF 1PXWA 1W41A 2BO1A 3VI6A 3JAMM 2I6DA 3IR9A 3SIUA 3ON1A 1RLGA 1QVGF 4TZZA 1VQKF 3G4SF 1Q82H 2VGNA 4C4WC 2OHWA 3CXCF 1QVFF 3V7QA 1H7MA 1VQ8F 1DT9A 3J81M 3CCUF 3NVKE 1K9MH 1NMUB 2VGMA 1VQLF 5IT9M 3LWQC 3FFMA 1CK2A 3CPWF 3CC2F 3CMEF 3NK7A 4X3MA 3LWVC 1YJ9F 3VMFB 2KTUA 1K73H 1M1KH 3CD6F 5DCVA 3E1YA 3O85A 3CCMF 1IPAA 3NVIB 2KTVA 2CZWA 3CPQA 1Q7YH 1CN7A 3I56F 1ZWZA 3LFOA 1E7KA 2ALEA 3J7AR 2FC3A 1VQ5F 4BW0B 3CCVF 2OZBA 3OBWA 1VQ6F 3CCLF 1YJWF 1N8RH 2JNBA 3NK6A 5GANK 3I55F 2QA4F
chains in the Genus database with same CATH superfamily
3K0TA 3RYHB 4BT5A 2BTOA 2CVLA 2AMTA 3P0ZA 2YXZA 5J2TA 3ZO8A 1VQNF 1YJNF 1JFFA 3ELCA 1VQ9F 4C8GA 3S0YA 4IHJA 2DT4A 3TD4A 3F0EA 1FNKA 1X52A 1X7OA 4NUTA 4BVRA 3MCQA 5EYPB 4ZI7A 1SDSA 2HS0A 3D01A 4O4HA 2PMPA 4NWOB 5C8YA 3S0WA 5BMVA 3SIVA 1SZQA 5JQGA 4O4IA 1TUBB 4U3JA 5A2QM 3N2KA 3VYUC 3GYQA 3IEQA 5G4VC 3S03A 3HKEB 4PWTA 2CSLA 3CCRF 1RA4A 1RQ2A 5AVMA 5EWRA 3IEWA 3RYCB 3HKBB 5HY0A 5LXTB 3PAFA 3IKEA 3JCMM 3S0HA 1J7HA 2GVIA 3JASB 3N4YA 1VQMF 4O2BB 1U3PA 3HWUA 5CB4B 4X1IA 4EI8A 2HVYD 2Z1FA 4BY9D 5J2TB 1FFXA 3V7EA 1JFFB 4I4TA 3E22A 5EZYA 1W41A 3VYTC 2BO1A 4G4WA 4YJ2B 4IHJB 2KGWA 4BT2A 3JAMM 3F6MA 1QVGF 3CB2A 4TZZA 2OTMA 2VAPA 4ZI7B 3WGMA 4BVQA 5LYJA 4X1YA 2HS3A 1W59A 4O4HB 1XHOA 3WGLA 5BMVB 2Q1YA 4O4IB 4C81A 3CC2F 3CMEF 3S06A 4U3JB 1YGYA 3N2KB 2KTUA 1M1KH 1W55A 3CD6F 5DCVA 1W581 3KIZA 4DXDA 1Q7YH 5LP6A 1ZWZA 2RHLA 3K2XA 3LFOA 3P10A 1U43A 3Q8HA 3WPXA 2ZODA 5HY4A 3C8LA 5HP7A 4G88A 3OONA 1VQ6F 3I3FA 4X1IB 5J2UA 3HKCA 1U40A 3NK6A 4X1KA 3VOBA 3HAXD 4I50A 4I4TB 3E22B 5EZYB 1KD1H 5HY2A 5FJ4C 4G4XA 1XV2A 2LBXA 3MCAB 3JARA 5CA0A 1TUBA 5IJ0B 5IJ9A 1GO0A 1VK3A 4B5CA 3JAWA 4DRXA 5LYJB 4X1YB 1SA0A 3J80M 3CCSF 1W5AA 4ZOLA 5EIBD 3VO8A 4X3LA 2R6R1 1VQOF 1IV1A 5KX5B 2F9ZC 4O2BA 2UYJA 5CB4A 4LCKA 1YITF 3WJQA 5ITZB 1FSZA 2CHTA 4G4ZA 1VHAA 2HX0A 5LP6B 3OW2F 1GO1A 1VH8A 5JVDA 4NQ3A 4YJ2A 4R40B 4G4YA 3LMEA 3CC7F 1W3EX 3MDOA 5G4UC 5J2UB 3HKCB 3F0GA 2QEXF 1JN1A 2ZF8A 3LWPC 2UZHA 3PLAC 4X1KB 4TUYA 3C9RA 3HKDA 3WGKA 5LP6C 4I50B 2OTLF 3MBMA 3RYFA 5EB0A 3OBYA 3C9SA 4ZHVA 1YHQF 1VQPF 2Z01A 3JARB 1YQNA 5CA0B 1JY8A 5IJ9B 3CYPB 2I6DA 3S02A 2H8CA 2HRUA 3JAWB 4YJ3B 5MN4A 4DRXB 1VQKF 3QUWA 1SA0B 2VGNA 4ZK7A 4C4WC 3M84A 4ZHWA 2OHWA 4TV8A 3CXCF 4ZOLB 1QVFF 1VQ8F 4X20A 5JCOA 5EAZA 3JVHA 4F6RA 1XRGA 2GZLA 3VYSC 3FFMA 1CK2A 2HRYA 3CPWF 2HP3A 1Z5VA 3T80A 1COMA 4O4LB 1CLIA 1IV3A 3C9UA 3D00A 3E1YA 3WPWA 2PHNA 4EB6B 2G9IA 5JVDB 4ZHQA 3CPQA 5MN5A 2VAWA 1RLUA 4U39A 1RQ7A 5IJ0A 1IV2A 4BW0B 3CCVF 4TUYB 2OZBA 3HKDB 1YJWF 1N8RH 3K12A 3RYFB 3TD5A 1QD9A 1S72F 2WALA 3JATA 1X25A 5KX5A 1W57A 2RHHA 3AGKA 1Q86H 2VXYA 2Z1EA 3ZP7A 1NJIH 2OTJF 1U3LA 3LWOC 3B6NA 1NQ3A 3RA5A 1W5FA 5ITZA 5FNVA 4TV8B 3JALB 3CCQF 3WGJA 2GLZA 3JAKB 1K8AH 3N4ZA 1OAPA 3VOAA 4BT6A 3GHZA 4X20B 1W5BA 5HXUA 3TD3A 5GAPK 4F6RB 1Q81H 4O2AA 3KE1A 5EIBC 3VIUA 1GX1A 3LWRC 4C8IA 1KC8H 2V9YA 2MQEA 4ZHQB 2Z1UA 1DBFA 3CMAF 1KQSF 2BTUA 2Q1XA 3WJPA 3WXMB 3FPIA 5HXZA 2H6LA 5LOVA 1ONIA 5GIPC 3G71F 4YJ3A 1Q8RA 2RHOA 4IIJA 3CCEF 1W42A 1H48A 3FD5A 1VQ4F 1UFYA 2KG4A 3F0FA 3JATB 5EB1B 2AIZP 3LDTA 1X7PA 4BT4A 3NMUC 3CG6A 3V3TA 4FFBA 5KMGA 2FGYA 5GINC 2NMUA 2UYNA 2CHSA 5FNVB 3VI6A 3SIUA 4O4LA 2W8BC 3G4SF 1KNJA 4EB6A 1Z5WA 3V4DA 2BTQB 3ESJA 2IQQA 3V7QA 3WJRA 4O2AB 1DT9A 3J81M 3WGNA 3NVKE 4BT7A 1K9MH 1NMUB 2N48A 3ZOPA 1QAHA 4I55A 5IT9M 1QU9A 3GTZA 2EWCA 4KWEA 1K73H 3NK7A 3LWVC 3VMFB 1T0AA 2LCAA 5LA6A 2ZVZA 5LOVB 2KTVA 3L7QA 3NVIB 4B62A 2VAMA 2ZOVA 3FBAA 4TV9A 2ALEA 3ERNA 1JD1A 3J7AR 3N2GB 2HP0A 1VQ5F 4IIJB 3MQWA 3OBWA 3JALA 3JAKA 2DYYA 5JH7A 2UYPA 2JNBA 1IV4A 5GANK 3QTYA 3LYBA 2QA4F 2UYKA 4FFBB 5KMGB 2I6RA 4ZHYB 2UYNB 2ZVYA 4O4JA 3K14A 3D54A 4EI9A 1W40A 3KHNA 5CA1A 2ZAUA 1H47A 1KNKA 3DDNA 1W5EA 4BVTA 2R751 2LBWA 5GONA 3KJKA 2RHJA 5GIOC 4LNUA 5B8FA 2RB9A 1JJ2F 3ZP4A 1GZ0A 1XBIA 4BT3A 1TVKB 3RYIB 2K1SA 5HY1A 4I55B 3M1XA 4WBNA 2P6YA 3RA6A 4B46A 5MN6A 4BVSA 1W2BF 2QI2A 2CWJA 5LA6B 3M4SA 1FNJA 1VQ7F 3R0PA 4HNAA 2YYEA 4TV9B 5EO3A 4C82A 2L26A 4RHAA 2HP0B 3G6EF 2Z1TA 3CC4F 2AIFA 3UT5A 5JH7B 1M90H 5IYZA 3U0OA 3I55F 2IG8A 5FLXM 1YI2F 5HP8A 4C8EA 2CW4A 5C8YB 3CCJF 5JQGB 1T0KB 3E20B 3F0DA 1R1MA 3IKFA 4O4JB 3KJJA 3RYHA 2IAFA 5CA1B 4RQOA 1YIJF 1PXWA 4E6EA 5JCOC 5GONB 3IR9A 3ON1A 1RLGA 1UI9A 2H8EA 4LNUB 2QTPA 3VTIC 1OFUA 1Q82H 1ODEA 3QHDA 3DC2A 5HWEA 2HS4A 4WBNB 1H7MA 3N2GA 4M8IA 3CCUF 5EYPA 3I7TA 2VGMA 1VQLF 1FFXB 3LWQC 3IMPA 1PF5A 3HJWC 4X3MA 1YJ9F 4HNAB 3O85A 4XCQA 3CCMF 1IPAA 2CZWA 3CYQA 3VCZA 1CN7A 3I56F 3HTNA 4G4VA 3RE3A 1E7KA 3UT5B 3HKEA 4B45A 4EI7A 5IYZB 2FC3A 3FD6A 4ERHA 2LBTA 2HQSC 2B33A 3RYCA 3C9TA 3HKBA 3CCLF 5LXTA 3EORA 3BYQA 3JASA 1TVKA 3RYIA 1VQVA 3P4EA
chains in the Genus database with same CATH topology
1S72F 3HAXD 2WALA 1KD1H 5HY2A 1Q86H 3AGKA 5FJ4C 1VQNF 1NJIH 2OTJF 3LWOC 4EI9A 1W40A 1YJNF 2LBXA 3MCAB 3RA5A 1VQ9F 4BVTA 2LBWA 1GO0A 5GIOC 1X52A 1X7OA 3CCQF 2GLZA 1K8AH 1JJ2F 4NUTA 3N4ZA 1GZ0A 1XBIA 5HXUA 4BVRA 3J80M 1SDSA 5HY1A 5GAPK 3CCSF 1Q81H 3HJWC 4X3LA 3RA6A 4BVSA 1VQOF 1W2BF 2QI2A 2F9ZC 3LWRC 4LCKA 3SIVA 1YITF 1KC8H 5A2QM 3CMAF 1VQ7F 3GYQA 1KQSF 5EO3A 3OW2F 1GO1A 5G4VC 3WXMB 5HXZA 4NQ3A 3G6EF 1RA4A 3CCRF 3CC4F 5EWRA 3CC7F 1W3EX 5GIPC 3G71F 5G4UC 2AIFA 1M90H 5HY0A 3PAFA 3JCMM 2QEXF 3N4YA 3LWPC 3PLAC 1VQMF 5FLXM 3CCEF 1YI2F 1W42A 2OTLF 3CCJF 1VQ4F 2KG4A 1T0KB 3E20B 3OBYA 4EI8A 2HVYD 1X7PA 4BY9D 3CG6A 3NMUC 1YHQF 3V3TA 1VQPF 3V7EA 2FGYA 5GINC 1YIJF 1PXWA 1W41A 2BO1A 3VI6A 2I6DA 3IR9A 3JAMM 3SIUA 3ON1A 1RLGA 1QVGF 4TZZA 1VQKF 3G4SF 1Q82H 2VGNA 4C4WC 2OHWA 3CXCF 5HWEA 4BVQA 1QVFF 3V7QA 1H7MA 1VQ8F 1DT9A 3J81M 3CCUF 3NVKE 1K9MH 1NMUB 2VGMA 1VQLF 5IT9M 3LWQC 3FFMA 1CK2A 3CPWF 3CC2F 3CMEF 3NK7A 4X3MA 3LWVC 1YJ9F 3VMFB 2KTUA 1K73H 1M1KH 3CD6F 5DCVA 3D00A 3E1YA 3O85A 4XCQA 3CCMF 1IPAA 3NVIB 2KTVA 2CZWA 3CPQA 1Q7YH 1CN7A 3I56F 1ZWZA 3LFOA 1E7KA 2ALEA 3J7AR 4EI7A 2FC3A 1VQ5F 5HY4A 4BW0B 3CCVF 2OZBA 3OBWA 1VQ6F 3CCLF 1YJWF 1N8RH 2JNBA 3NK6A 5GANK 3I55F 2QA4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 F;  3HAX D;  2WAL A;  1KD1 H;  1Q86 H;  3AGK A;  5FJ4 C;  1VQN F;  1NJI H;  2OTJ F;  3LWO C;  1W40 A;  1YJN F;  2LBX A;  3MCA B;  3RA5 A;  1VQ9 F;  2LBW A;  1GO0 A;  5GIO C;  1X52 A;  1X7O A;  3CCQ F;  1K8A H;  1JJ2 F;  4NUT A;  3N4Z A;  1GZ0 A;  1XBI A;  3J80 M;  1SDS A;  5GAP K;  3CCS F;  1Q81 H;  3HJW C;  4X3L A;  3RA6 A;  1VQO F;  1W2B F;  2QI2 A;  3LWR C;  4LCK A;  3SIV A;  1YIT F;  1KC8 H;  5A2Q M;  3CMA F;  1VQ7 F;  3GYQ A;  1KQS F;  5EO3 A;  3OW2 F;  1GO1 A;  5G4V C;  3WXM B;  3G6E F;  1RA4 A;  3CCR F;  3CC4 F;  5EWR A;  3CC7 F;  1W3E X;  5GIP C;  3G71 F;  5G4U C;  2AIF A;  1M90 H;  3PAF A;  3JCM M;  2QEX F;  3N4Y A;  3LWP C;  3PLA C;  1VQM F;  5FLX M;  3CCE F;  1YI2 F;  1W42 A;  2OTL F;  3CCJ F;  1VQ4 F;  2KG4 A;  1T0K B;  3E20 B;  3OBY A;  2HVY D;  1X7P A;  4BY9 D;  3CG6 A;  3NMU C;  1YHQ F;  1VQP F;  3V7E A;  5GIN C;  1YIJ F;  1PXW A;  1W41 A;  2BO1 A;  3VI6 A;  3JAM M;  2I6D A;  3IR9 A;  3SIU A;  3ON1 A;  1RLG A;  1QVG F;  4TZZ A;  1VQK F;  3G4S F;  1Q82 H;  2VGN A;  4C4W C;  2OHW A;  3CXC F;  1QVF F;  3V7Q A;  1H7M A;  1VQ8 F;  1DT9 A;  3J81 M;  3CCU F;  3NVK E;  1K9M H;  1NMU B;  2VGM A;  1VQL F;  5IT9 M;  3LWQ C;  3FFM A;  1CK2 A;  3CPW F;  3CC2 F;  3CME F;  3NK7 A;  4X3M A;  3LWV C;  1YJ9 F;  3VMF B;  2KTU A;  1K73 H;  1M1K H;  3CD6 F;  5DCV A;  3E1Y A;  3O85 A;  3CCM F;  1IPA A;  3NVI B;  2KTV A;  2CZW A;  3CPQ A;  1Q7Y H;  1CN7 A;  3I56 F;  1ZWZ A;  3LFO A;  1E7K A;  2ALE A;  3J7A R;  2FC3 A;  1VQ5 F;  4BW0 B;  3CCV F;  2OZB A;  3OBW A;  1VQ6 F;  3CCL F;  1YJW F;  1N8R H;  2JNB A;  3NK6 A;  5GAN K;  3I55 F;  2QA4 F; 
#chains in the Genus database with same CATH topology
 3K0T A;  3RYH B;  4BT5 A;  2BTO A;  2CVL A;  2AMT A;  3P0Z A;  2YXZ A;  5J2T A;  3ZO8 A;  1VQN F;  1YJN F;  1JFF A;  3ELC A;  1VQ9 F;  4C8G A;  3S0Y A;  4IHJ A;  2DT4 A;  3TD4 A;  3F0E A;  1FNK A;  1X52 A;  1X7O A;  4NUT A;  4BVR A;  3MCQ A;  5EYP B;  4ZI7 A;  1SDS A;  2HS0 A;  3D01 A;  4O4H A;  2PMP A;  4NWO B;  5C8Y A;  3S0W A;  5BMV A;  3SIV A;  1SZQ A;  5JQG A;  4O4I A;  1TUB B;  4U3J A;  5A2Q M;  3N2K A;  3VYU C;  3GYQ A;  3IEQ A;  5G4V C;  3S03 A;  3HKE B;  4PWT A;  2CSL A;  3CCR F;  1RA4 A;  1RQ2 A;  5AVM A;  5EWR A;  3IEW A;  3RYC B;  3HKB B;  5HY0 A;  5LXT B;  3PAF A;  3IKE A;  3JCM M;  3S0H A;  1J7H A;  2GVI A;  3JAS B;  3N4Y A;  1VQM F;  4O2B B;  1U3P A;  3HWU A;  5CB4 B;  4X1I A;  4EI8 A;  2HVY D;  2Z1F A;  4BY9 D;  5J2T B;  1FFX A;  3V7E A;  1JFF B;  4I4T A;  3E22 A;  5EZY A;  1W41 A;  3VYT C;  2BO1 A;  4G4W A;  4YJ2 B;  4IHJ B;  2KGW A;  4BT2 A;  3JAM M;  3F6M A;  1QVG F;  3CB2 A;  4TZZ A;  2OTM A;  2VAP A;  4ZI7 B;  3WGM A;  4BVQ A;  5LYJ A;  4X1Y A;  2HS3 A;  1W59 A;  4O4H B;  1XHO A;  3WGL A;  5BMV B;  2Q1Y A;  4O4I B;  4C81 A;  3CC2 F;  3CME F;  3S06 A;  4U3J B;  1YGY A;  3N2K B;  2KTU A;  1M1K H;  1W55 A;  3CD6 F;  5DCV A;  1W58 1;  3KIZ A;  4DXD A;  1Q7Y H;  5LP6 A;  1ZWZ A;  2RHL A;  3K2X A;  3LFO A;  3P10 A;  1U43 A;  3Q8H A;  3WPX A;  2ZOD A;  5HY4 A;  3C8L A;  5HP7 A;  4G88 A;  3OON A;  1VQ6 F;  3I3F A;  4X1I B;  5J2U A;  3HKC A;  1U40 A;  3NK6 A;  4X1K A;  3VOB A;  3HAX D;  4I50 A;  4I4T B;  3E22 B;  5EZY B;  1KD1 H;  5HY2 A;  5FJ4 C;  4G4X A;  1XV2 A;  2LBX A;  3MCA B;  3JAR A;  5CA0 A;  1TUB A;  5IJ0 B;  5IJ9 A;  1GO0 A;  1VK3 A;  4B5C A;  3JAW A;  4DRX A;  5LYJ B;  4X1Y B;  1SA0 A;  3J80 M;  3CCS F;  1W5A A;  4ZOL A;  5EIB D;  3VO8 A;  4X3L A;  2R6R 1;  1VQO F;  1IV1 A;  5KX5 B;  2F9Z C;  4O2B A;  2UYJ A;  5CB4 A;  4LCK A;  1YIT F;  3WJQ A;  5ITZ B;  1FSZ A;  2CHT A;  4G4Z A;  1VHA A;  2HX0 A;  5LP6 B;  3OW2 F;  1GO1 A;  1VH8 A;  5JVD A;  4NQ3 A;  4YJ2 A;  4R40 B;  4G4Y A;  3LME A;  3CC7 F;  1W3E X;  3MDO A;  5G4U C;  5J2U B;  3HKC B;  3F0G A;  2QEX F;  1JN1 A;  2ZF8 A;  3LWP C;  2UZH A;  3PLA C;  4X1K B;  4TUY A;  3C9R A;  3HKD A;  3WGK A;  5LP6 C;  4I50 B;  2OTL F;  3MBM A;  3RYF A;  5EB0 A;  3OBY A;  3C9S A;  4ZHV A;  1YHQ F;  1VQP F;  2Z01 A;  3JAR B;  1YQN A;  5CA0 B;  1JY8 A;  5IJ9 B;  3CYP B;  2I6D A;  3S02 A;  2H8C A;  2HRU A;  3JAW B;  4YJ3 B;  5MN4 A;  4DRX B;  1VQK F;  3QUW A;  1SA0 B;  2VGN A;  4ZK7 A;  4C4W C;  3M84 A;  4ZHW A;  2OHW A;  4TV8 A;  3CXC F;  4ZOL B;  1QVF F;  1VQ8 F;  4X20 A;  5JCO A;  5EAZ A;  3JVH A;  4F6R A;  1XRG A;  2GZL A;  3VYS C;  3FFM A;  1CK2 A;  2HRY A;  3CPW F;  2HP3 A;  1Z5V A;  3T80 A;  1COM A;  4O4L B;  1CLI A;  1IV3 A;  3C9U A;  3D00 A;  3E1Y A;  3WPW A;  2PHN A;  4EB6 B;  2G9I A;  5JVD B;  4ZHQ A;  3CPQ A;  5MN5 A;  2VAW A;  1RLU A;  4U39 A;  1RQ7 A;  5IJ0 A;  1IV2 A;  4BW0 B;  3CCV F;  4TUY B;  2OZB A;  3HKD B;  1YJW F;  1N8R H;  3K12 A;  3RYF B;  3TD5 A;  1QD9 A;  1S72 F;  2WAL A;  3JAT A;  1X25 A;  5KX5 A;  1W57 A;  2RHH A;  3AGK A;  1Q86 H;  2VXY A;  2Z1E A;  3ZP7 A;  1NJI H;  2OTJ F;  1U3L A;  3LWO C;  3B6N A;  1NQ3 A;  3RA5 A;  1W5F A;  5ITZ A;  5FNV A;  4TV8 B;  3JAL B;  3CCQ F;  3WGJ A;  2GLZ A;  3JAK B;  1K8A H;  3N4Z A;  1OAP A;  3VOA A;  4BT6 A;  3GHZ A;  4X20 B;  1W5B A;  5HXU A;  3TD3 A;  5GAP K;  4F6R B;  1Q81 H;  4O2A A;  3KE1 A;  5EIB C;  3VIU A;  1GX1 A;  3LWR C;  4C8I A;  1KC8 H;  2V9Y A;  2MQE A;  4ZHQ B;  2Z1U A;  1DBF A;  3CMA F;  1KQS F;  2BTU A;  2Q1X A;  3WJP A;  3WXM B;  3FPI A;  5HXZ A;  2H6L A;  5LOV A;  1ONI A;  5GIP C;  3G71 F;  4YJ3 A;  1Q8R A;  2RHO A;  4IIJ A;  3CCE F;  1W42 A;  1H48 A;  3FD5 A;  1VQ4 F;  1UFY A;  2KG4 A;  3F0F A;  3JAT B;  5EB1 B;  2AIZ P;  3LDT A;  1X7P A;  4BT4 A;  3NMU C;  3CG6 A;  3V3T A;  4FFB A;  5KMG A;  2FGY A;  5GIN C;  2NMU A;  2UYN A;  2CHS A;  5FNV B;  3VI6 A;  3SIU A;  4O4L A;  2W8B C;  3G4S F;  1KNJ A;  4EB6 A;  1Z5W A;  3V4D A;  2BTQ B;  3ESJ A;  2IQQ A;  3V7Q A;  3WJR A;  4O2A B;  1DT9 A;  3J81 M;  3WGN A;  3NVK E;  4BT7 A;  1K9M H;  1NMU B;  2N48 A;  3ZOP A;  1QAH A;  4I55 A;  5IT9 M;  1QU9 A;  3GTZ A;  2EWC A;  4KWE A;  1K73 H;  3NK7 A;  3LWV C;  3VMF B;  1T0A A;  2LCA A;  5LA6 A;  2ZVZ A;  5LOV B;  2KTV A;  3L7Q A;  3NVI B;  4B62 A;  2VAM A;  2ZOV A;  3FBA A;  4TV9 A;  2ALE A;  3ERN A;  1JD1 A;  3J7A R;  3N2G B;  2HP0 A;  1VQ5 F;  4IIJ B;  3MQW A;  3OBW A;  3JAL A;  3JAK A;  2DYY A;  5JH7 A;  2UYP A;  2JNB A;  1IV4 A;  5GAN K;  3QTY A;  3LYB A;  2QA4 F;  2UYK A;  4FFB B;  5KMG B;  2I6R A;  4ZHY B;  2UYN B;  2ZVY A;  4O4J A;  3K14 A;  3D54 A;  4EI9 A;  1W40 A;  3KHN A;  5CA1 A;  2ZAU A;  1H47 A;  1KNK A;  3DDN A;  1W5E A;  4BVT A;  2R75 1;  2LBW A;  5GON A;  3KJK A;  2RHJ A;  5GIO C;  4LNU A;  5B8F A;  2RB9 A;  1JJ2 F;  3ZP4 A;  1GZ0 A;  1XBI A;  4BT3 A;  1TVK B;  3RYI B;  2K1S A;  5HY1 A;  4I55 B;  3M1X A;  4WBN A;  2P6Y A;  3RA6 A;  4B46 A;  5MN6 A;  4BVS A;  1W2B F;  2QI2 A;  2CWJ A;  5LA6 B;  3M4S A;  1FNJ A;  1VQ7 F;  3R0P A;  4HNA A;  2YYE A;  4TV9 B;  5EO3 A;  4C82 A;  2L26 A;  4RHA A;  2HP0 B;  3G6E F;  2Z1T A;  3CC4 F;  2AIF A;  3UT5 A;  5JH7 B;  1M90 H;  5IYZ A;  3U0O A;  3I55 F;  2IG8 A;  5FLX M;  1YI2 F;  5HP8 A;  4C8E A;  2CW4 A;  5C8Y B;  3CCJ F;  5JQG B;  1T0K B;  3E20 B;  3F0D A;  1R1M A;  3IKF A;  4O4J B;  3KJJ A;  3RYH A;  2IAF A;  5CA1 B;  4RQO A;  1YIJ F;  1PXW A;  4E6E A;  5JCO C;  5GON B;  3IR9 A;  3ON1 A;  1RLG A;  1UI9 A;  2H8E A;  4LNU B;  2QTP A;  3VTI C;  1OFU A;  1Q82 H;  1ODE A;  3QHD A;  3DC2 A;  5HWE A;  2HS4 A;  4WBN B;  1H7M A;  3N2G A;  4M8I A;  3CCU F;  5EYP A;  3I7T A;  2VGM A;  1VQL F;  1FFX B;  3LWQ C;  3IMP A;  1PF5 A;  3HJW C;  4X3M A;  1YJ9 F;  4HNA B;  3O85 A;  4XCQ A;  3CCM F;  1IPA A;  2CZW A;  3CYQ A;  3VCZ A;  1CN7 A;  3I56 F;  3HTN A;  4G4V A;  3RE3 A;  1E7K A;  3UT5 B;  3HKE A;  4B45 A;  4EI7 A;  5IYZ B;  2FC3 A;  3FD6 A;  4ERH A;  2LBT A;  2HQS C;  2B33 A;  3RYC A;  3C9T A;  3HKB A;  3CCL F;  5LXT A;  3EOR A;  3BYQ A;  3JAS A;  1TVK A;  3RYI A;  1VQV A;  3P4E A; 
#chains in the Genus database with same CATH homology
 1S72 F;  3HAX D;  2WAL A;  1KD1 H;  5HY2 A;  1Q86 H;  3AGK A;  5FJ4 C;  1VQN F;  1NJI H;  2OTJ F;  3LWO C;  4EI9 A;  1W40 A;  1YJN F;  2LBX A;  3MCA B;  3RA5 A;  1VQ9 F;  4BVT A;  2LBW A;  1GO0 A;  5GIO C;  1X52 A;  1X7O A;  3CCQ F;  2GLZ A;  1K8A H;  1JJ2 F;  4NUT A;  3N4Z A;  1GZ0 A;  1XBI A;  5HXU A;  4BVR A;  3J80 M;  1SDS A;  5HY1 A;  5GAP K;  3CCS F;  1Q81 H;  3HJW C;  4X3L A;  3RA6 A;  4BVS A;  1VQO F;  1W2B F;  2QI2 A;  2F9Z C;  3LWR C;  4LCK A;  3SIV A;  1YIT F;  1KC8 H;  5A2Q M;  3CMA F;  1VQ7 F;  3GYQ A;  1KQS F;  5EO3 A;  3OW2 F;  1GO1 A;  5G4V C;  3WXM B;  5HXZ A;  4NQ3 A;  3G6E F;  1RA4 A;  3CCR F;  3CC4 F;  5EWR A;  3CC7 F;  1W3E X;  5GIP C;  3G71 F;  5G4U C;  2AIF A;  1M90 H;  5HY0 A;  3PAF A;  3JCM M;  2QEX F;  3N4Y A;  3LWP C;  3PLA C;  1VQM F;  5FLX M;  3CCE F;  1YI2 F;  1W42 A;  2OTL F;  3CCJ F;  1VQ4 F;  2KG4 A;  1T0K B;  3E20 B;  3OBY A;  4EI8 A;  2HVY D;  1X7P A;  4BY9 D;  3CG6 A;  3NMU C;  1YHQ F;  3V3T A;  1VQP F;  3V7E A;  2FGY A;  5GIN C;  1YIJ F;  1PXW A;  1W41 A;  2BO1 A;  3VI6 A;  2I6D A;  3IR9 A;  3JAM M;  3SIU A;  3ON1 A;  1RLG A;  1QVG F;  4TZZ A;  1VQK F;  3G4S F;  1Q82 H;  2VGN A;  4C4W C;  2OHW A;  3CXC F;  5HWE A;  4BVQ A;  1QVF F;  3V7Q A;  1H7M A;  1VQ8 F;  1DT9 A;  3J81 M;  3CCU F;  3NVK E;  1K9M H;  1NMU B;  2VGM A;  1VQL F;  5IT9 M;  3LWQ C;  3FFM A;  1CK2 A;  3CPW F;  3CC2 F;  3CME F;  3NK7 A;  4X3M A;  3LWV C;  1YJ9 F;  3VMF B;  2KTU A;  1K73 H;  1M1K H;  3CD6 F;  5DCV A;  3D00 A;  3E1Y A;  3O85 A;  4XCQ A;  3CCM F;  1IPA A;  3NVI B;  2KTV A;  2CZW A;  3CPQ A;  1Q7Y H;  1CN7 A;  3I56 F;  1ZWZ A;  3LFO A;  1E7K A;  2ALE A;  3J7A R;  4EI7 A;  2FC3 A;  1VQ5 F;  5HY4 A;  4BW0 B;  3CCV F;  2OZB A;  3OBW A;  1VQ6 F;  3CCL F;  1YJW F;  1N8R H;  2JNB A;  3NK6 A;  5GAN K;  3I55 F;  2QA4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...