4LCKA

Co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein YbxF
publication title Co-crystal structure of a T-box riboswitch stem I domain in complex with its cognate tRNA.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Ribosomal protein/rna
total genus 16
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4lckA00
1YHQF 3AGKA 1XBIA 2VGNA 2OHWA 5GIPC 3SIUA 1GO0A 1RA4A 1W41A 3G4SF 2CZWA 1QVFF 3J80M 3NMUC 3RA6A 1Q7YH 5EO3A 3J7AR 1VQ7F 1VQPF 3PLAC 2QA4F 3VI6A 3I56F 3OBYA 1S72F 3RA5A 1JJ2F 2WALA 3O85A 1W3EX 4X3MA 3CXCF 5EWRA 1SDSA 2HVYD 1VQMF 3VMFB 1Q81H 2OTLF 1VQOF 1M90H 1DT9A 3WXMB 4NUTA 3CCMF 5DCVA 1PXWA 3CPWF 4TZZA 4BY9D 5A2QM 3LWQC 4BW0B 1YJ9F 1VQ9F 3JAMM 1YJWF 1KC8H 1T0KB 5G4VC 1CK2A 3J81M 1YITF 3LFOA 2OZBA 3N4ZA 2OTJF 1Q86H 3CC7F 1GO1A 3CCQF 1VQ6F 3E1YA 3CCJF 2FC3A 1NJIH 1K8AH 3MCAB 1Q82H 1VQKF 3V7EA 1M1KH 3NVIB 3CCEF 3LWPC 4LCKA 1W2BF 2KTUA 1KD1H 5GANK 3IR9A 1YJNF 4X3LA 2AIFA 1VQ5F 1CN7A 1N8RH 3LWOC 2QI2A 3V7QA 3JCMM 2LBXA 5FLXM 2QEXF 3OW2F 1K73H 2ALEA 2VGMA 3G71F 1RLGA 3CD6F 1IPAA 3HJWC 3ON1A 2I6DA 3CCSF 1VQ4F 1GZ0A 5IT9M 5GIOC 3CCVF 2LBWA 1YIJF 1X7OA 3GYQA 1H7MA 3LWVC 3FFMA 5FJ4C 3I55F 3CC2F 3CC4F 1VQ8F 3E20B 3CCLF 2JNBA 3CMAF 1VQNF 3CCRF 3PAFA 1X52A 3LWRC 3SIVA 3CPQA 3CCUF 2BO1A 3HAXD 3CG6A 1W42A 3OBWA 3N4YA 1KQSF 1X7PA 1NMUB 5GAPK 1YI2F 5GINC 1E7KA 5G4UC 2KG4A 1ZWZA 3NK7A 1QVGF 3G6EF 1W40A 3CMEF 1VQLF 2KTVA 3NVKE 4C4WC 3NK6A 1K9MH
chains in the Genus database with same CATH superfamily
3AGKA 2VGNA 4C8EA 1FNKA 5HY0A 3SIUA 4O4IA 1GO0A 1W41A 3VIUA 2CZWA 1U3LA 2AMTA 4BT3A 4EI8A 3HKEB 1Q7YH 1UFYA 2HS3A 3OBYA 4O4IB 5CA1A 3S02A 4X3MA 2HP0A 5EWRA 1W5AA 1U40A 1Z5VA 2I6RA 4O4JA 3VOBA 2OTLF 1M90H 4NUTA 1TVKA 5CA1B 4TZZA 2HP0B 1FNJA 2CHTA 2W8BC 4O4JB 3E22B 1YJWF 2GLZA 3VOAA 1T0KB 2HS0A 4ZOLA 5CA0A 5G4VC 3J81M 1YITF 1TVKB 3CC7F 3TD4A 1W59A 2H6LA 4EI7A 1VQ6F 3E1YA 3ERNA 2DYYA 1NJIH 1K8AH 1QD9A 4X1KA 3V7EA 4E6EA 3NVIB 4ZOLB 3F0EA 4LCKA 4HNAB 1W5FA 4YJ3A 3V7QA 1ONIA 3ZP4A 4LNUA 4X1KB 5EZYA 2ZVYA 3T80A 3ZP7A 1RLGA 4PWTA 2RHLA 4BT5A 3ON1A 3IKEA 4YJ3B 3ZO8A 3JARB 1VQ4F 3P10A 4LNUB 2N48A 4ZHWA 5EZYB 1KNKA 4TUYA 5FNVB 1X7OA 4NQ3A 3GTZA 4BT4A 2Z1FA 2UYJA 3I55F 3EORA 3WPXA 3LDTA 3CC2F 3C9SA 1COMA 3JALB 1YGYA 1RQ2A 3CCLF 1U3PA 2VAPA 2H8CA 2Z1EA 1VQNF 3CCRF 3P4EA 3LWRC 5B8FA 2BO1A 3HAXD 1H48A 3CB2A 2RHOA 3N2GA 2LCAA 1NMUB 1Q8RA 4U39A 3HTNA 3WJRA 5GONA 1ZWZA 3F0GA 1QU9A 3N2KA 4G4WA 5MN5A 3WGMA 1W40A 2AIZP 2BTQB 3N2GB 2BTOA 1JFFA 1XRGA 1VQVA 3NVKE 3NK6A 5EAZA 2NMUA 4EB6A 5JCOC 1J7HA 2OHWA 1JN1A 4C8IA 1RA4A 3V3TA 3F0FA 4O2BB 1QVFF 1KNJA 4ZI7A 2CWJA 4G4XA 3RYIA 2VXYA 3JVHA 1VQPF 3RA5A 5CB4A 3JAKA 1W3EX 1SDSA 2OTMA 3U0OA 2UZHA 3VMFB 3WJPA 1Q81H 3MBMA 3RYIB 3MDOA 3WXMB 3CCMF 5DCVA 1PXWA 3KIZA 5CB4B 3JAKB 4NWOB 5HP8A 3D01A 2ZF8A 2L26A 3JASA 3WGNA 5HY1A 5EYPA 4X1YB 1T0AA 2OTJF 4X20B 1GO1A 5HP7A 3JASB 2CW4A 3IEQA 1M1KH 1OFUA 5EYPB 2R6R1 5JCOA 5HY2A 5MN6A 5JVDA 2Q1YA 4G88A 1IV3A 4BVSA 3E22A 3LYBA 3TD5A 3IR9A 4ZHQB 4X3LA 1CN7A 1N8RH 2HQSC 2CVLA 2LBXA 3HKCB 3GHZA 2QEXF 3OW2F 1TUBB 4IIJB 2VGMA 3G71F 5JVDB 3M1XA 5HY4A 5HWEA 1CLIA 2I6DA 3ELCA 3F0DA 5IYZA 2Z01A 3FD5A 4RHAA 4BVTA 4HNAA 2HS4A 3LWVC 5J2TB 4R40B 1RQ7A 3B6NA 4BT2A 3CC4F 5IYZB 3RYCB 1R1MA 2YYEA 2K1SA 4I4TA 3JARA 3SIVA 5MN4A 1W42A 5FNVA 3JATA 5AVMA 3K2XA 4IHJB 1X7PA 1JY8A 2Z1TA 3C8LA 2GVIA 4I4TB 2KG4A 4C81A 3F6MA 3JALA 2RB9A 3NK7A 2MQEA 3K0TA 4B45A 3JATB 3R0PA 5C8YA 1VQLF 1OAPA 2PMPA 3ZOPA 5LYJA 4C4WC 1K9MH 1W5EA 1YHQF 1XBIA 1IV4A 5LXTB 5LP6C 5C8YB 4ZK7A 1FSZA 2HP3A 4B46A 4O4LA 3KE1A 3G4SF 3K12A 5LYJB 3ESJA 3J80M 5JQGA 1Z5WA 4TV9A 5IJ9A 3RA6A 3NMUC 5EO3A 3FD6A 5EIBD 2YXZA 3J7AR 3KJKA 3L7QA 3I7TA 2CHSA 3VI6A 2QA4F 2F9ZC 3O85A 4O4LB 3CXCF 3C9UA 4KWEA 3DDNA 3M4SA 5JQGB 4TV9B 5IJ9B 1UI9A 1DBFA 4O2BA 1XV2A 3FPIA 3DC2A 3CPWF 4TV8A 4O2AB 3KJJA 4BY9D 3TD3A 3LWQC 4BW0B 1YJ9F 4X1IB 3UT5A 4DRXB 1CK2A 4B5CA 2OZBA 3N4ZA 4YJ2A 2PHNA 4TV8B 1ODEA 2RHHA 3CCQF 3RYHB 5EB0A 3CCJF 3VCZA 1VHAA 3MCAB 1Q82H 3UT5B 3WGJA 2ZVZA 3QTYA 3CCEF 3KHNA 4YJ2B 1W2BF 2KTUA 5LP6A 1VQ5F 5BMVA 2AIFA 1W55A 4X1YA 3LWOC 2QI2A 3JCMM 4X20A 3V4DA 5J2UA 2P6YA 5ITZB 3CD6F 5LP6B 5BMVB 3HJWC 1GZ0A 1VH8A 5LOVB 3M84A 4BVRA 4ZHQA 2LBWA 2VAMA 3RYFA 5J2UB 3GYQA 3HKCA 5FJ4C 2V9YA 1TUBA 4IIJA 1PF5A 3E20B 5HXUA 3S03A 3VO8A 4ERHA 3IMPA 3RYFB 1X52A 3MCQA 3CCUF 4I50A 3CG6A 3C9RA 5JH7B 3S06A 5J2TA 3OBWA 1W5BA 3N4YA 1KQSF 2FGYA 1YI2F 2H8EA 2UYNA 5GINC 3JAWA 3RYCA 4I50B 1X25A 1XHOA 4G4ZA 5IJ0A 5KX5A 3VYSC 2UYNB 3BYQA 3JAWB 3D54A 1QAHA 2CSLA 3HWUA 4IHJA 1VK3A 5GIPC 2UYKA 5IJ0B 5KX5B 2EWCA 3LMEA 3OONA 1H47A 2HRYA 2ZAUA 5EB1B 4C8GA 1IV2A 2GZLA 4F6RA 4ZHVA 1VQ7F 2VAWA 4I55A 1NQ3A 3PLAC 5LA6A 1S72F 2HX0A 3WGKA 4EI9A 3I56F 4BT6A 1JJ2F 2WALA 3VTIC 3I3FA 2HVYD 5LXTA 5CA0B 4FFBA 1VQMF 2KGWA 3CYPB 3WPWA 4F6RB 1VQOF 1DT9A 3P0ZA 4I55B 5LA6B 4O4HA 5A2QM 2IQQA 4FFBB 3K14A 2QTPA 1JD1A 1VQ9F 4WBNA 3JAMM 1KC8H 2Z1UA 4G4YA 3LFOA 5KMGA 4O4HB 1Q86H 3FBAA 3S0HA 4ZHYB 4DXDA 2FC3A 3VYTC 4WBNB 2Q1XA 4O2AA 3HKBA 1VQKF 3CYQA 3LWPC 2G9IA 5KMGB 1KD1H 4X1IA 4TUYB 1IV1A 3IKFA 3WJQA 5EIBC 4DRXA 5GANK 1YJNF 1W57A 5FLXM 3HKBB 3RYHA 1K73H 4BVQA 3IEWA 3QUWA 2ALEA 2IAFA 4RQOA 2UYPA 1IPAA 4XCQA 1SA0A 3VYUC 3CCSF 3WGLA 5IT9M 3MQWA 5GIOC 3CCVF 1YIJF 2RHJA 1H7MA 3HKDA 3FFMA 2IG8A 2ZOVA 1SA0B 3RE3A 2LBTA 1SZQA 5GONB 1VQ8F 5ITZA 1W581 3S0WA 1U43A 2B33A 2JNBA 3N2KB 4U3JA 4BT7A 1GX1A 3CMAF 2BTUA 3QHDA 1RLUA 3HKDB 3PAFA 3C9TA 5LOVA 3CPQA 2DT4A 4G4VA 1JFFB 1YQNA 3Q8HA 1FFXA 2HRUA 2R751 4M8IA 4U3JB 2ZODA 4EB6B 5GAPK 3D00A 1E7KA 5G4UC 4B62A 1QVGF 1FFXB 3G6EF 4ZI7B 4C82A 3CMEF 2KTVA 5HXZA 5JH7A 3HKEA 3S0YA
chains in the Genus database with same CATH topology
1YHQF 3AGKA 1XBIA 2VGNA 2OHWA 5HY0A 5GIPC 3SIUA 1GO0A 1RA4A 1W41A 3V3TA 3G4SF 2CZWA 1QVFF 4EI8A 3J80M 3NMUC 3RA6A 1Q7YH 5EO3A 3J7AR 1VQ7F 1VQPF 3PLAC 2QA4F 3VI6A 3I56F 3OBYA 4EI9A 3RA5A 1S72F 1JJ2F 2WALA 2F9ZC 3O85A 1W3EX 4X3MA 3CXCF 5EWRA 1SDSA 2HVYD 1VQMF 3VMFB 1Q81H 2OTLF 1VQOF 1M90H 1DT9A 3WXMB 4NUTA 3CCMF 5DCVA 1PXWA 3CPWF 4TZZA 4BY9D 5A2QM 3LWQC 4BW0B 1YJ9F 1VQ9F 3JAMM 1YJWF 1KC8H 2GLZA 5HY1A 1T0KB 5G4VC 1CK2A 3J81M 1YITF 3LFOA 2OZBA 3N4ZA 2OTJF 1Q86H 3CC7F 1GO1A 3CCQF 4EI7A 1VQ6F 3E1YA 3CCJF 2FC3A 1NJIH 1K8AH 3MCAB 1Q82H 1VQKF 3V7EA 1M1KH 3NVIB 3CCEF 3LWPC 5HY2A 4LCKA 1W2BF 2KTUA 4BVSA 1KD1H 5GANK 3IR9A 1YJNF 4X3LA 2AIFA 1VQ5F 1CN7A 1N8RH 3LWOC 2QI2A 3V7QA 3JCMM 2LBXA 5FLXM 2QEXF 3OW2F 1K73H 4BVQA 2ALEA 2VGMA 3G71F 1RLGA 5HY4A 3CD6F 1IPAA 4XCQA 5HWEA 3ON1A 2I6DA 3HJWC 3CCSF 1VQ4F 1GZ0A 4BVTA 5IT9M 4BVRA 5GIOC 3CCVF 2LBWA 1YIJF 1X7OA 4NQ3A 3GYQA 1H7MA 3LWVC 3FFMA 5FJ4C 3I55F 3CC2F 3CC4F 1VQ8F 3E20B 5HXUA 3CCLF 2JNBA 3CMAF 1VQNF 3CCRF 3PAFA 1X52A 3LWRC 3SIVA 3CPQA 3CCUF 2BO1A 3HAXD 3CG6A 1W42A 3OBWA 3N4YA 1KQSF 1X7PA 1NMUB 2FGYA 5GAPK 1YI2F 5GINC 3D00A 1E7KA 5G4UC 2KG4A 1ZWZA 3NK7A 1QVGF 3G6EF 1W40A 3CMEF 1VQLF 2KTVA 5HXZA 3NVKE 4C4WC 3NK6A 1K9MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ F;  3AGK A;  1XBI A;  2VGN A;  2OHW A;  5GIP C;  3SIU A;  1GO0 A;  1RA4 A;  1W41 A;  3G4S F;  2CZW A;  1QVF F;  3J80 M;  3NMU C;  3RA6 A;  1Q7Y H;  5EO3 A;  3J7A R;  1VQ7 F;  1VQP F;  3PLA C;  2QA4 F;  3VI6 A;  3I56 F;  3OBY A;  1S72 F;  3RA5 A;  1JJ2 F;  2WAL A;  3O85 A;  1W3E X;  4X3M A;  3CXC F;  5EWR A;  1SDS A;  2HVY D;  1VQM F;  3VMF B;  1Q81 H;  2OTL F;  1VQO F;  1M90 H;  1DT9 A;  3WXM B;  4NUT A;  3CCM F;  5DCV A;  1PXW A;  3CPW F;  4TZZ A;  4BY9 D;  5A2Q M;  3LWQ C;  4BW0 B;  1YJ9 F;  1VQ9 F;  3JAM M;  1YJW F;  1KC8 H;  1T0K B;  5G4V C;  1CK2 A;  3J81 M;  1YIT F;  3LFO A;  2OZB A;  3N4Z A;  2OTJ F;  1Q86 H;  3CC7 F;  1GO1 A;  3CCQ F;  1VQ6 F;  3E1Y A;  3CCJ F;  2FC3 A;  1NJI H;  1K8A H;  3MCA B;  1Q82 H;  1VQK F;  3V7E A;  1M1K H;  3NVI B;  3CCE F;  3LWP C;  4LCK A;  1W2B F;  2KTU A;  1KD1 H;  5GAN K;  3IR9 A;  1YJN F;  4X3L A;  2AIF A;  1VQ5 F;  1CN7 A;  1N8R H;  3LWO C;  2QI2 A;  3V7Q A;  3JCM M;  2LBX A;  5FLX M;  2QEX F;  3OW2 F;  1K73 H;  2ALE A;  2VGM A;  3G71 F;  1RLG A;  3CD6 F;  1IPA A;  3HJW C;  3ON1 A;  2I6D A;  3CCS F;  1VQ4 F;  1GZ0 A;  5IT9 M;  5GIO C;  3CCV F;  2LBW A;  1YIJ F;  1X7O A;  3GYQ A;  1H7M A;  3LWV C;  3FFM A;  5FJ4 C;  3I55 F;  3CC2 F;  3CC4 F;  1VQ8 F;  3E20 B;  3CCL F;  2JNB A;  3CMA F;  1VQN F;  3CCR F;  3PAF A;  1X52 A;  3LWR C;  3SIV A;  3CPQ A;  3CCU F;  2BO1 A;  3HAX D;  3CG6 A;  1W42 A;  3OBW A;  3N4Y A;  1KQS F;  1X7P A;  1NMU B;  5GAP K;  1YI2 F;  5GIN C;  1E7K A;  5G4U C;  2KG4 A;  1ZWZ A;  3NK7 A;  1QVG F;  3G6E F;  1W40 A;  3CME F;  1VQL F;  2KTV A;  3NVK E;  4C4W C;  3NK6 A;  1K9M H; 
#chains in the Genus database with same CATH topology
 3AGK A;  2VGN A;  4C8E A;  1FNK A;  5HY0 A;  3SIU A;  4O4I A;  1GO0 A;  1W41 A;  3VIU A;  2CZW A;  1U3L A;  2AMT A;  4BT3 A;  4EI8 A;  3HKE B;  1Q7Y H;  1UFY A;  2HS3 A;  3OBY A;  4O4I B;  5CA1 A;  3S02 A;  4X3M A;  2HP0 A;  5EWR A;  1W5A A;  1U40 A;  1Z5V A;  2I6R A;  4O4J A;  3VOB A;  2OTL F;  1M90 H;  4NUT A;  1TVK A;  5CA1 B;  4TZZ A;  2HP0 B;  1FNJ A;  2CHT A;  2W8B C;  4O4J B;  3E22 B;  1YJW F;  2GLZ A;  3VOA A;  1T0K B;  2HS0 A;  4ZOL A;  5CA0 A;  5G4V C;  3J81 M;  1YIT F;  1TVK B;  3CC7 F;  3TD4 A;  1W59 A;  2H6L A;  4EI7 A;  1VQ6 F;  3E1Y A;  3ERN A;  2DYY A;  1NJI H;  1K8A H;  1QD9 A;  4X1K A;  3V7E A;  4E6E A;  3NVI B;  4ZOL B;  3F0E A;  4LCK A;  4HNA B;  1W5F A;  4YJ3 A;  3V7Q A;  1ONI A;  3ZP4 A;  4LNU A;  4X1K B;  5EZY A;  2ZVY A;  3T80 A;  3ZP7 A;  1RLG A;  4PWT A;  2RHL A;  4BT5 A;  3ON1 A;  3IKE A;  4YJ3 B;  3ZO8 A;  3JAR B;  1VQ4 F;  3P10 A;  4LNU B;  2N48 A;  4ZHW A;  5EZY B;  1KNK A;  4TUY A;  5FNV B;  1X7O A;  4NQ3 A;  3GTZ A;  4BT4 A;  2Z1F A;  2UYJ A;  3I55 F;  3EOR A;  3WPX A;  3LDT A;  3CC2 F;  3C9S A;  1COM A;  3JAL B;  1YGY A;  1RQ2 A;  3CCL F;  1U3P A;  2VAP A;  2H8C A;  2Z1E A;  1VQN F;  3CCR F;  3P4E A;  3LWR C;  5B8F A;  2BO1 A;  3HAX D;  1H48 A;  3CB2 A;  2RHO A;  3N2G A;  2LCA A;  1NMU B;  1Q8R A;  4U39 A;  3HTN A;  3WJR A;  5GON A;  1ZWZ A;  3F0G A;  1QU9 A;  3N2K A;  4G4W A;  5MN5 A;  3WGM A;  1W40 A;  2AIZ P;  2BTQ B;  3N2G B;  2BTO A;  1JFF A;  1XRG A;  1VQV A;  3NVK E;  3NK6 A;  5EAZ A;  2NMU A;  4EB6 A;  5JCO C;  1J7H A;  2OHW A;  1JN1 A;  4C8I A;  1RA4 A;  3V3T A;  3F0F A;  4O2B B;  1QVF F;  1KNJ A;  4ZI7 A;  2CWJ A;  4G4X A;  3RYI A;  2VXY A;  3JVH A;  1VQP F;  3RA5 A;  5CB4 A;  3JAK A;  1W3E X;  1SDS A;  2OTM A;  3U0O A;  2UZH A;  3VMF B;  3WJP A;  1Q81 H;  3MBM A;  3RYI B;  3MDO A;  3WXM B;  3CCM F;  5DCV A;  1PXW A;  3KIZ A;  5CB4 B;  3JAK B;  4NWO B;  5HP8 A;  3D01 A;  2ZF8 A;  2L26 A;  3JAS A;  3WGN A;  5HY1 A;  5EYP A;  4X1Y B;  1T0A A;  2OTJ F;  4X20 B;  1GO1 A;  5HP7 A;  3JAS B;  2CW4 A;  3IEQ A;  1M1K H;  1OFU A;  5EYP B;  2R6R 1;  5JCO A;  5HY2 A;  5MN6 A;  5JVD A;  2Q1Y A;  4G88 A;  1IV3 A;  4BVS A;  3E22 A;  3LYB A;  3TD5 A;  3IR9 A;  4ZHQ B;  4X3L A;  1CN7 A;  1N8R H;  2HQS C;  2CVL A;  2LBX A;  3HKC B;  3GHZ A;  2QEX F;  3OW2 F;  1TUB B;  4IIJ B;  2VGM A;  3G71 F;  5JVD B;  3M1X A;  5HY4 A;  5HWE A;  1CLI A;  2I6D A;  3ELC A;  3F0D A;  5IYZ A;  2Z01 A;  3FD5 A;  4RHA A;  4BVT A;  4HNA A;  2HS4 A;  3LWV C;  5J2T B;  4R40 B;  1RQ7 A;  3B6N A;  4BT2 A;  3CC4 F;  5IYZ B;  3RYC B;  1R1M A;  2YYE A;  2K1S A;  4I4T A;  3JAR A;  3SIV A;  5MN4 A;  1W42 A;  5FNV A;  3JAT A;  5AVM A;  3K2X A;  4IHJ B;  1X7P A;  1JY8 A;  2Z1T A;  3C8L A;  2GVI A;  4I4T B;  2KG4 A;  4C81 A;  3F6M A;  3JAL A;  2RB9 A;  3NK7 A;  2MQE A;  3K0T A;  4B45 A;  3JAT B;  3R0P A;  5C8Y A;  1VQL F;  1OAP A;  2PMP A;  3ZOP A;  5LYJ A;  4C4W C;  1K9M H;  1W5E A;  1YHQ F;  1XBI A;  1IV4 A;  5LXT B;  5LP6 C;  5C8Y B;  4ZK7 A;  1FSZ A;  2HP3 A;  4B46 A;  4O4L A;  3KE1 A;  3G4S F;  3K12 A;  5LYJ B;  3ESJ A;  3J80 M;  5JQG A;  1Z5W A;  4TV9 A;  5IJ9 A;  3RA6 A;  3NMU C;  5EO3 A;  3FD6 A;  5EIB D;  2YXZ A;  3J7A R;  3KJK A;  3L7Q A;  3I7T A;  2CHS A;  3VI6 A;  2QA4 F;  2F9Z C;  3O85 A;  4O4L B;  3CXC F;  3C9U A;  4KWE A;  3DDN A;  3M4S A;  5JQG B;  4TV9 B;  5IJ9 B;  1UI9 A;  1DBF A;  4O2B A;  1XV2 A;  3FPI A;  3DC2 A;  3CPW F;  4TV8 A;  4O2A B;  3KJJ A;  4BY9 D;  3TD3 A;  3LWQ C;  4BW0 B;  1YJ9 F;  4X1I B;  3UT5 A;  4DRX B;  1CK2 A;  4B5C A;  2OZB A;  3N4Z A;  4YJ2 A;  2PHN A;  4TV8 B;  1ODE A;  2RHH A;  3CCQ F;  3RYH B;  5EB0 A;  3CCJ F;  3VCZ A;  1VHA A;  3MCA B;  1Q82 H;  3UT5 B;  3WGJ A;  2ZVZ A;  3QTY A;  3CCE F;  3KHN A;  4YJ2 B;  1W2B F;  2KTU A;  5LP6 A;  1VQ5 F;  5BMV A;  2AIF A;  1W55 A;  4X1Y A;  3LWO C;  2QI2 A;  3JCM M;  4X20 A;  3V4D A;  5J2U A;  2P6Y A;  5ITZ B;  3CD6 F;  5LP6 B;  5BMV B;  3HJW C;  1GZ0 A;  1VH8 A;  5LOV B;  3M84 A;  4BVR A;  4ZHQ A;  2LBW A;  2VAM A;  3RYF A;  5J2U B;  3GYQ A;  3HKC A;  5FJ4 C;  2V9Y A;  1TUB A;  4IIJ A;  1PF5 A;  3E20 B;  5HXU A;  3S03 A;  3VO8 A;  4ERH A;  3IMP A;  3RYF B;  1X52 A;  3MCQ A;  3CCU F;  4I50 A;  3CG6 A;  3C9R A;  5JH7 B;  3S06 A;  5J2T A;  3OBW A;  1W5B A;  3N4Y A;  1KQS F;  2FGY A;  1YI2 F;  2H8E A;  2UYN A;  5GIN C;  3JAW A;  3RYC A;  4I50 B;  1X25 A;  1XHO A;  4G4Z A;  5IJ0 A;  5KX5 A;  3VYS C;  2UYN B;  3BYQ A;  3JAW B;  3D54 A;  1QAH A;  2CSL A;  3HWU A;  4IHJ A;  1VK3 A;  5GIP C;  2UYK A;  5IJ0 B;  5KX5 B;  2EWC A;  3LME A;  3OON A;  1H47 A;  2HRY A;  2ZAU A;  5EB1 B;  4C8G A;  1IV2 A;  2GZL A;  4F6R A;  4ZHV A;  1VQ7 F;  2VAW A;  4I55 A;  1NQ3 A;  3PLA C;  5LA6 A;  1S72 F;  2HX0 A;  3WGK A;  4EI9 A;  3I56 F;  4BT6 A;  1JJ2 F;  2WAL A;  3VTI C;  3I3F A;  2HVY D;  5LXT A;  5CA0 B;  4FFB A;  1VQM F;  2KGW A;  3CYP B;  3WPW A;  4F6R B;  1VQO F;  1DT9 A;  3P0Z A;  4I55 B;  5LA6 B;  4O4H A;  5A2Q M;  2IQQ A;  4FFB B;  3K14 A;  2QTP A;  1JD1 A;  1VQ9 F;  4WBN A;  3JAM M;  1KC8 H;  2Z1U A;  4G4Y A;  3LFO A;  5KMG A;  4O4H B;  1Q86 H;  3FBA A;  3S0H A;  4ZHY B;  4DXD A;  2FC3 A;  3VYT C;  4WBN B;  2Q1X A;  4O2A A;  3HKB A;  1VQK F;  3CYQ A;  3LWP C;  2G9I A;  5KMG B;  1KD1 H;  4X1I A;  4TUY B;  1IV1 A;  3IKF A;  3WJQ A;  5EIB C;  4DRX A;  5GAN K;  1YJN F;  1W57 A;  5FLX M;  3HKB B;  3RYH A;  1K73 H;  4BVQ A;  3IEW A;  3QUW A;  2ALE A;  2IAF A;  4RQO A;  2UYP A;  1IPA A;  4XCQ A;  1SA0 A;  3VYU C;  3CCS F;  3WGL A;  5IT9 M;  3MQW A;  5GIO C;  3CCV F;  1YIJ F;  2RHJ A;  1H7M A;  3HKD A;  3FFM A;  2IG8 A;  2ZOV A;  1SA0 B;  3RE3 A;  2LBT A;  1SZQ A;  5GON B;  1VQ8 F;  5ITZ A;  1W58 1;  3S0W A;  1U43 A;  2B33 A;  2JNB A;  3N2K B;  4U3J A;  4BT7 A;  1GX1 A;  3CMA F;  2BTU A;  3QHD A;  1RLU A;  3HKD B;  3PAF A;  3C9T A;  5LOV A;  3CPQ A;  2DT4 A;  4G4V A;  1JFF B;  1YQN A;  3Q8H A;  1FFX A;  2HRU A;  2R75 1;  4M8I A;  4U3J B;  2ZOD A;  4EB6 B;  5GAP K;  3D00 A;  1E7K A;  5G4U C;  4B62 A;  1QVG F;  1FFX B;  3G6E F;  4ZI7 B;  4C82 A;  3CME F;  2KTV A;  5HXZ A;  5JH7 A;  3HKE A;  3S0Y A; 
#chains in the Genus database with same CATH homology
 1YHQ F;  3AGK A;  1XBI A;  2VGN A;  2OHW A;  5HY0 A;  5GIP C;  3SIU A;  1GO0 A;  1RA4 A;  1W41 A;  3V3T A;  3G4S F;  2CZW A;  1QVF F;  4EI8 A;  3J80 M;  3NMU C;  3RA6 A;  1Q7Y H;  5EO3 A;  3J7A R;  1VQ7 F;  1VQP F;  3PLA C;  2QA4 F;  3VI6 A;  3I56 F;  3OBY A;  4EI9 A;  3RA5 A;  1S72 F;  1JJ2 F;  2WAL A;  2F9Z C;  3O85 A;  1W3E X;  4X3M A;  3CXC F;  5EWR A;  1SDS A;  2HVY D;  1VQM F;  3VMF B;  1Q81 H;  2OTL F;  1VQO F;  1M90 H;  1DT9 A;  3WXM B;  4NUT A;  3CCM F;  5DCV A;  1PXW A;  3CPW F;  4TZZ A;  4BY9 D;  5A2Q M;  3LWQ C;  4BW0 B;  1YJ9 F;  1VQ9 F;  3JAM M;  1YJW F;  1KC8 H;  2GLZ A;  5HY1 A;  1T0K B;  5G4V C;  1CK2 A;  3J81 M;  1YIT F;  3LFO A;  2OZB A;  3N4Z A;  2OTJ F;  1Q86 H;  3CC7 F;  1GO1 A;  3CCQ F;  4EI7 A;  1VQ6 F;  3E1Y A;  3CCJ F;  2FC3 A;  1NJI H;  1K8A H;  3MCA B;  1Q82 H;  1VQK F;  3V7E A;  1M1K H;  3NVI B;  3CCE F;  3LWP C;  5HY2 A;  4LCK A;  1W2B F;  2KTU A;  4BVS A;  1KD1 H;  5GAN K;  3IR9 A;  1YJN F;  4X3L A;  2AIF A;  1VQ5 F;  1CN7 A;  1N8R H;  3LWO C;  2QI2 A;  3V7Q A;  3JCM M;  2LBX A;  5FLX M;  2QEX F;  3OW2 F;  1K73 H;  4BVQ A;  2ALE A;  2VGM A;  3G71 F;  1RLG A;  5HY4 A;  3CD6 F;  1IPA A;  4XCQ A;  5HWE A;  3ON1 A;  2I6D A;  3HJW C;  3CCS F;  1VQ4 F;  1GZ0 A;  4BVT A;  5IT9 M;  4BVR A;  5GIO C;  3CCV F;  2LBW A;  1YIJ F;  1X7O A;  4NQ3 A;  3GYQ A;  1H7M A;  3LWV C;  3FFM A;  5FJ4 C;  3I55 F;  3CC2 F;  3CC4 F;  1VQ8 F;  3E20 B;  5HXU A;  3CCL F;  2JNB A;  3CMA F;  1VQN F;  3CCR F;  3PAF A;  1X52 A;  3LWR C;  3SIV A;  3CPQ A;  3CCU F;  2BO1 A;  3HAX D;  3CG6 A;  1W42 A;  3OBW A;  3N4Y A;  1KQS F;  1X7P A;  1NMU B;  2FGY A;  5GAP K;  1YI2 F;  5GIN C;  3D00 A;  1E7K A;  5G4U C;  2KG4 A;  1ZWZ A;  3NK7 A;  1QVG F;  3G6E F;  1W40 A;  3CME F;  1VQL F;  2KTV A;  5HXZ A;  3NVK E;  4C4W C;  3NK6 A;  1K9M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...