4ZI7B

Crystal structure of tubulin-stathmin-ttl-hti286 complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 168
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zi7B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zi7B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zi7B01
5IJ0B 4O4HB 1FSZA 4I55B 4DRXB 2VXYA 4O2BA 4E6EA 5IYZA 5IYZB 2XKBA 3R4VA 4IHJB 5JQGA 3RYIB 5KX5A 5LA6B 3HKEA 1W5AA 3ZBPA 3WGMA 2XKAA 4IIJB 3RYFA 5J2TB 4DXDA 3N2KA 1W59A 3HKCA 5JH7B 4O4JB 4F6RB 3HKBA 5JVDA 3JALB 5BMVA 3UT5A 5LXTA 5IJ9B 3JARB 5KMGA 3RYCA 2R751 4X1KA 1Z5WA 1TUBA 1TUBB 4YJ3A 4YJ3B 3HKDA 5GONA 3UT5B 5MN6A 4EB6A 4KWEA 1JFFB 3RYIA 5KX5B 3HKCB 5EZYB 3CB2A 4IIJA 3RYFB 5J2TA 5LXTB 1RLUA 4M8IA 3RB8A 4O2BB 2VAMA 5LA6A 5LP6A 4IHJA 5JQGB 4HNAA 1SA0B 3E22B 4I50A 2VAWA 3V3TA 5ITZA 4ZOLB 3RYHA 1RQ7A 5LOVB 4EI8A 5LOVA 5JCOA 4WBNA 5JVDB 5LP6C 4O2AA 4F6RA 1Z5VA 3JATB 4U3JA 5EYPA 5CA1B 1FFXA 3N2GA 5C8YB 5J2UA 5LP6B 5J2UB 5LYJA 4TV9A 3WGLA 3WGKA 3HKEB 3ZBQA 4EI7A 1RQ2A 1W5EA 4YJ2B 4YJ2A 2Q1XA 4O4LB 3ZIDA 2BTQB 2VAPA 4TUYB 3VO9A 4TV9B 5CA0A 3VO8A 3N2KB 1FFXB 3N2GB 5EYPB 3JAKA 4WBNB 5CA1A 3WGNA 4O4LA 3JARA 3VOBA 5ITZB 1TVKB 1OFUA 4TUYA 4O4IB 2R6R1 4ZI7A 2BTQA 4DRXA 4B45A 4EI9A 5IJ0A 3WGJA 2RHJA 1W5BA 3VPAA 2BTOA 4TV8B 4X1IA 4X1IB 4LNUA 4TV8A 1W581 4O4IA 4I4TB 1JFFA 4X1YB 5EIBC 4EB6B 3JAWB 4I55A 4ZOLA 3RYHB 4X20B 4ZHQB 3M89A 5C8YA 3JAKB 3JALA 5BMVB 3HKBB 4U3JB 5FNVA 4X20A 5JH7A 2RHHA 3JASB 2RHOA 4X1YA 4I4TA 2RHLA 4HNAB 4I50B 4LNUB 5EZYA 4U39A 4FFBB 5CA0B 2GVIA 5MN4A 4B46A 3C8LA 4X1KB 4XCQA 3JASA 3VOAA 4ZI7B 4O4HA 2Q1YA 5FNVB 1TVKA 5JCOC 5M7EA 3HKDB 5GONB 4ZHQA 4FFBA 3JAWA 3JATA 5IJ9A 4O2AB 5KMGB 5EIBD 5CB4A 5CB4B 5MN5A 4O4JA 5LYJB 3M8KA 1SA0A 3E22A 1W5FA 3RYCB
chains in the Genus database with same CATH superfamily
3GLGE 1VI5A 1E60A 1UZUA 1WCV1 1X1EA 3I34X 3IVGA 1T5SA 1WMEA 2IU0A 4M6WA 3PCTA 3TCXB 4DSOA 3R5KA 4ABYA 4WMLA 4IIEA 2ZAIA 3U2QA 4AZWA 1G16A 4BT4A 3CCLF 2QTFA 4TN5A 1KI7A 4UJ5A 1GSOA 1SC6A 3RIMA 1BU5A 4MW5A 5CNMA 3F2VA 3OEED 1DZIA 4H7DA 4JUCA 2CLKB 2A5JA 2NZ8A 3ZUGA 1DWUA 1L7EA 2V7QA 4A5UB 3TOVA 1Z7EA 2NU8A 5BR7A 1J25A 1WP8A 1NF9A 5B3SB 3DEKA 2MK3A 4WTOA 3AU8A 3WHPA 5ITVA 5AVVA 4D9IA 2KQXA 4OTZA 1SKYB 3ZS8A 4LYAA 2AN5A 4J0EA 1SIOA 1Q1NA 5BMVF 2N1BA 4CIDA 5C7IO 2Q6AA 4AS2A 4S24A 2PJRA 2OFWA 1V6AA 3WI7A 2QSJA 5EVJA 4C4YA 1OE0A 1J0CA 2QSZA 1KOJA 3LRTA 5DM1A 3WBKA 4QTXA 2HA5A 1QAOA 2QGNA 2Q5QA 2JASA 3HTXA 3LY5A 4EZBA 3DPUA 3TECE 4JYPA 1JMKC 2CLHB 5TQ0B 3MB5A 4G5XA 3VZSA 2ZUDA 4O0LA 3L07A 2F17A 1OCZB 4C4WC 4CM7A 4EPWA 4POAA 3ZNPA 1ZAYA 5DTJA 1QYRA 3PHIA 4F4FA 2ZIVB 2LKDA 3N05A 4YIKA 3RFXA 2YV3A 3WWYA 2Q8QA 5DVZA 1RC8A 4OB7A 4RFVA 1TE2A 2VF7A 3B6KA 1XF9A 4RIHA 3TNJA 2YZKA 4BNGA 4XWTA 3FVTA 1IC6A 3OFNA 3LPNA 4EX6A 1TO1E 3P9CA 3NBYC 4MKIA 1OCOB 1YBMA 4A6PA 5P8WA 5LIPA 1ORDA 4QXAA 3H6GA 2CMGA 1UFIA 2ODTX 5EGNA 5DXAA 3H01A 1ND5A 1W6UA 3PPWA 3P1JA 4WF9V 2ERCA 4B75A 4O4IB 1T9GS 4JWKA 2AOXA 4AMBA 3FCYA 1O97D 4D3DA 2JI7A 3D7MA 2MQEA 2JLSA 4GNRA 3HZZA 1GUDA 2OFFA 3VKFA 1QP8A 4JJEA 3HZRA 4ZTUB 1CEYA 2UU9O 2BOBC 2PKRA 2ZDHA 2GNPA 4FHZA 4OG2A 1KRWA 3L7OA 3R23A 2F95B 1E1MA 2WB4A 2IYFA 3O90A 4B85A 4B5LA 1QTRA 1RXUA 2AZTA 4IOKA 4QODA 3P9QA 4TT3A 1AZSC 5EXEA 5JNUA 2V7XA 1GZ6A 2WQZA 1XIVA 4KLAA 3WWZA 4R8CA 2JANA 4NSNA 1CUZA 4GI7A 4Q3KA 5BMVB 4PTZA 2FRVA 5CHYA 2P9JA 2K2WA 5BZBA 2CFRA 2EJ7A 3K15A 1X3SA 3L4BC 3N0XA 1DBWA 4KXYA 4XDGA 5EWJB 4ZU6X 3SYTA 2AJ8A 1N3IA 2VDPB 3TIIA 3UQYS 3ER9A 3MTBA 1KYTA 2H1WA 1NI4A 5KQPA 2FMTA 3IBYA 4JWTA 5EWRA 1ZCZA 3TBHA 1MG1A 4BB0A 1AB6A 4TYWA 1NI8A 1E2QA 2NVUA 1U3CA 3VU1A 3ABIA 2QTCA 5E9QA 2QVLA 4OHBA 2C2YA 2XDYA 1EFRD 2P2ZA 4MWZA 4RAQA 3SZLA 4QZVA 3VC7A 1YHNA 3NWOA 5KYNA 4EG8A 4R1SA 5JANA 1TTHA 4RE5A 2B6NA 1EB9A 1P5FA 3K9GA 5ERGB 4UV8A 4XWWA 3PUVA 3C2QA 3WKCA 1W0KA 1GDHA 1ESEA 2VAXA 5IDJA 4Q01A 5FA6A 3ZCSA 3EXFA 3KVYA 2CFIA 4OB6A 4DB2A 3C5HA 4BNLA 1PT8A 3AK4A 2WP8J 2ESRA 5L3SA 4ZZIA 1VFPA 4BLVA 4K3AA 1ODSA 2JL1A 3OFND 4P86A 1VGQA 2DUJA 4KQEA 2FUG1 4CODB 1Z0AA 3KE1A 2RSLA 3N74A 2PCLA 1M66A 3FYEB 1ZAKA 3Q10A 4Q7EA 4U8GA 4WX2B 3EDMA 1QR8A 1DU4A 2I6XA 1U3WA 4MTLA 1EUDB 4U9UA 4BBPA 3EVAA 4YP6A 4Y6GB 2R25B 1DP4A 4MVUA 3O4JA 2XMCA 1WB8A 1MPXA 1NY6A 3D7LA 4WKCA 1MB9A 1W36B 3QWFA 4ASUG 4FGJA 4D46A 2CL0X 1T9GR 4UHKA 1Q7YH 1T10A 3P9RA 4MUFA 3NWJA 1KNJA 1OLUA 3VYWA 4DCTA 2CZGA 1I24A 3EF1A 3N53A 4H17A 1DCKA 1ULTA 3ZVMA 3KT0A 4UU7A 4KBFA 5DU2A 1Z6AA 1PD0A 2EJCA 2BPOA 4XVQA 2MINA 4L22A 5EXTA 1ESDA 2VP0A 1H48A 4YRTA 3BBPA 3GCWA 3QPBA 3OHPA 4UCXA 4FLVA 3JATB 1ZX1A 1B8VA 1ZJZA 1GFZA 4GKAA 4R2IA 2O19A 2F3RA 5C8YB 1GN9A 2YIMA 3KDPA 3AJDA 4BFXA 3WLAA 2HHLA 4ZQGA 3WQHA 3UJAA 2F43G 3LWRC 3AB7A 4K9SA 3GA7A 1LVUA 2ZIOA 4CTOA 3EQ6A 5JLAA 2WHYA 1G20E 4XCXA 1LVHA 1YJAA 4OJYA 1Q7RA 4RA6A 1KFJB 3DCYA 2A2ZA 1LRKA 3PS9A 5CB6A 1YB6A 4Q7JB 1A8UA 2WQ6A 1Q82W 1C8BA 5HWEA 1TA9A 2GUZB 1E7YA 1WN7A 4L4YA 3BFRA 1EFKA 1FLAA 1GL6A 1JR2A 1XRJA 1ZEMA 2BHNA 4Q20A 4KTVE 4QDOA 3WIUA 3NVKI 2JK0A 1DFIA 4MK4A 3VPSA 1KI3A 1WNSA 3CSDA 3EFOA 3ZEAA 1GCGA 3PC2A 4HYEA 3SNHA 5AW4A 2H6EA 4MS4A 1SH7A 4DRXA 1Z2NX 1WMSA 2NADA 4PXSA 1XL0A 2A9VA 4LXQA 4B3DA 3S8EA 1OXUA 1KXZA 2R60A 2OT5A 5CB8A 2YN2A 2Q8VA 3GIDA 1QO0A 3CNEA 4QAQA 1UK7A 4HLDA 3HKBB 3C8HA 4WLFA 1A9TA 2RJNA 5ALNA 3TMAA 5EZSA 5TMEA 3G59A 5CXUA 3MB8A 1O9BA 1XP8A 1B2RA 4X7MA 2Y0IA 4D6YA 3ZJUA 1FFYA 3TQOA 3J81k 1QLEB 1T2AA 3OMAB 4ND1A 2G0TA 1UWCA 3LBYA 3OCUA 3ONWA 5DHPA 3ZR4B 1A4RA 3VMFB 1Z5ZA 2QWNB 1Y5RA 4ZYLA 2HIAA 2OTCA 4ZYXA 1VPDA 1X13A 3CRQA 2D5IA 5JS8A 1BD3A 2GYYA 4ZHVA 2HZBA 3HN6A 2OK8A 3PGVA 4AY2A 3M1XA 1E20A 5DWVA 1QJCA 4J03A 4BFLA 4HY3A 4EBFA 1BT8A 5C4MA 1O3YA 5BV2P 4NS4A 3R41A 4ZVLA 4RIFA 1EZ4A 1GSIA 3NAZA 2KLHA 4OP3A 4QG7A 3BTSA 5H2FZ 2HFEC 1AZTA 2X1VA 4KMSA 3RS9A 4ZYYA 3OQNA 2DH6A 3N2LA 3DDZX 5CT9A 1G5TA 4YQZA 5JJBA 4BV8A 1DAMA 5FTWA 2ZWVA 1PJRA 1ZOPA 3K6KA 3U7EB 1DEKA 3E4CA 2FUEA 3IAM6 2UVPA 1N32O 4NBNA 4FX2A 2LXNA 3PD1A 3R20A 4Y18A 5F12A 2WA3A 1QHSA 1XCOA 4JUAA 5LA6B 3CCQV 1UP4A 4HUQA 3TCUA 3KWLA 1I3LA 2EGGA 1NOIA 1AUVA 1L4EA 2LKCA 3JQEA 1L5KA 3TXXA 3VRHA 4DVJA 1XTRA 3RLFA 4MJXA 1NL3A 1IXYA 2DVMA 4HDRB 5CB0A 3DEIA 4XGKA 3DFIA 4LFCO 2ZIWB 3ZKWB 2OG1A 3E58A 5F1YA 1DE0A 2PUCA 3WLKX 3IUSA 2NU8B 4BTLA 4KWEA 1Z6ZA 1UR5A 2VT2A 2XB4A 2PZBA 3CLRC 3I2YX 3QK7A 1B16A 2Q8NA 4ROTA 3BEHA 3UO3A 2HGZA 3E84A 3NH9A 3P2OA 1SCKA 1GD1O 1TGYA 4DYVA 1W46A 4ED9A 3FUWA 2ZSKA 3V8BA 3NHKA 4MQ4A 3J81N 3P5SA 2JJ2G 1CR0A 3KTOA 4BX2A 4CCWA 1O94D 7YASA 2BAGA 1Q6UA 2QLLA 5CDFA 1U11A 3WK5A 4GE3A 3FZGA 3N75A 4MS1A 3SDLA 4IOLA 2C7GA 4MRMA 3H9VA 3B5IA 1FFCA 4JBYA 3VQYA 4LOKA 2XAQA 2C4VA 3L0CA 4PR3A 3U7RA 2AIRA 2P41A 4JASB 3EZXA 3S70A 4ZZ0A 1QC5B 3CIFA 3F9CA 1CJKC 2UV8A 1JTVA 4MJLA 1AX9A 4PG7A 4CCYA 5BWLA 3ZZ0A 2PX8A 2KG4A 4IRUB 2BDUA 4QBTA 3NAGA 4N01A 2F00A 2PL5A 3VPBA 5B1AB 2AXEA 2GKGA 1BQ3A 2PMCA 1A7JA 1WPXA 2PVCA 2FPKA 2W2LA 4GBGA 4QU5A 3QBEA 1A72A 1NW8A 3L71H 4ZCIA 4HGRA 4YT2A 5CA0A 1XZFA 4H77A 5E6SA 3SSAA 3DAGA 4AQYB 2J7KA 5CW2A 3ADCA 3K8ZA 2I1QA 4Y1RB 4EB3A 5DTMA 2BOCC 1Q82H 2A5GA 5K2MA 2R48A 1RPOA 3S0WA 3O4IA 4B87A 4QGHA 4EW1A 5KYTA 3UMJA 3BJEA 3MWEB 3EXFB 1C3OB 3LUDA 3P0IA 5IAGA 3V00A 1KVSA 2CLSA 2Q0OC 1JYSA 2JGLA 1ZDMA 1LPOA 2B0JA 5DYNA 3UKDA 4NVPA 4HZ3A 1NMEA 5FPSA 3D3WB 2G1AA 2HA4A 5A5GA 2Y71A 2FWBA 4FNMA 1IMJA 3AKDA 3K3WA 4FDTA 1LS6A 3FSEA 1MEOA 1XZDA 1ZJYA 1GG5A 1F1BA 1HE8B 5REQB 1J9ZA 3WMEA 5CCXA 3Q4HA 1FP2A 1DX4A 1Q81W 4X6LA 3ZWAA 2WTXA 1RZRD 1YASA 1X14A 1IQPA 3UMBA 4WK0B 1X1SA 3HK2A 1TJPB 2OM6A 2P9FA 2Q2OA 1FS5A 1NBWB 5HY2A 1NI4B 4YVFA 1YIAA 1BDHA 1DRVA 3Q6IA 2WF8A 2RHMA 3WIVA 1Q0PA 3TTYA 3ITEA 4JR0A 1NJFA 1R6KA 4ID3A 2G06A 4MUNA 4BJ1A 2FW6A 1QLWA 4NV0A 2ASVA 1XFAA 3Q85A 4J16C 5GONB 1U0BB 4CG3A 4R9SA 3CXUA 2QDXA 5EIOA 3H1FA 1UM8A 3IRUA 4KH1A 1C7EA 4FFPA 5BVHB 2J08A 1U7UA 1QCCA 5HQJA 3ABLC 2EFCB 3M5WA 1E3SA 1CRPA 2QP4A 1M57B 4YRBA 2IPOA 1IPFA 1B6GA 2YY6A 4OPMA 2QLTA 4O2BA 1K7FB 4X84A 1MQ9A 3JVIA 5HP7A 2QAIA 4OHPA 1TZKA 4PLCA 1EP2B 3DUWA 5DW0A 1DQRA 1OI2A 2WD8A 2IPMA 5DF1A 3ZNNA 4AMUA 1FXKA 1NR7A 4IUBS 4LXXA 1DBSA 1NS1A 4XX0B 1P7YA 4ZT5A 3LUHA 2ZTUA 1H2LA 1YJNV 1FVHA 4IVNA 3VQTA 3H42B 3GRUA 1ZK1A 4J0IA 4D9EA 2CFTA 5D01A 4L2IB 5BN4A 2ANBA 4G37A 5CBPB 1DUSA 5IVPA 4BX3A 4PSKA 3FPGA 3S1SA 3HUDA 4MYTA 1G98A 1GZDA 2WUGA 3OZBA 1TEXA 5F64A 2HR3A 1U7WA 2AHOA 2IP1A 2BFOA 4RSHA 1VMEA 3Q1LA 4DM4A 1PGOA 5ARDA 1U6KA 1WAZA 5JSUA 4P31A 4TKMA 1NVDA 5F2OA 2O7VA 5LBQA 1XNQO 3IUNA 5C4IA 3W8NA 4ESVA 4LJSA 3C9RA 3KIZA 4FLXA 3CCEV 4C7MA 4F2DA 1GSHA 4KQJA 1SM4A 2EZ8A 2CYBA 5EJGA 4XDLA 4MROA 2G77B 4ERHA 1AHHA 1M34E 3DZJA 3FWYA 3RDPA 3WLMA 2EWCA 1AHPA 2CMKA 5IU6A 2GNAA 1OU0A 1UBHS 1RSOB 4WNYA 3WJAA 2ZYSA 1HETA 4MAMA 2MMGA 2RGXA 3GAZA 1WWKA 4J91A 1PG2A 1UZAA 2P3LA 4J8PA 4LMRA 1CUCA 4MVJG 1SULA 1X2BA 3HB0A 3QRWA 4MS3B 4MVJI 4DDKA 1LPMA 1B1AA 2VRCA 4IINA 3RJZA 1KKCA 2CUZA 3FLAA 2CDAA 1XLTA 4KZPA 2G80A 1E1CB 2HLDG 2F2TA 1XAIA 3WDMA 3X1XA 4EPVA 3SJAA 2XE4A 3VU3A 2CDRA 4L8JA 2YN0A 1H2AS 5FYDA 3SM9A 2XHZA 4G0OA 1E1RG 2GFQA 2PN1A 5IUJC 2OB2A 3K16A 4EHDA 4JV5B 1RBYA 2C5BA 1TT5B 2R7NA 3DR5A 1VPTA 3MJRA 5FJJA 3RKUA 1R1MA 3IGAC 1S3SA 3DDSA 4U4AA 4CIWA 2J48A 4K3VA 3U40A 4NATA 5FOQA 2RGEA 5HSGA 3F78A 4S2EA 2OV2A 2F9MA 1CUHA 3TZ6A 5I7EA 1BL8A 2IE0A 3UHJA 3EQ9A 1HWYA 3AILA 4H9GA 2GXSA 3VMFA 1FU8A 4X3LA 1QFSA 4JZGA 2O48X 1OAAA 3HBMA 1VF7A 1OD6A 3LHFA 4PM4A 4YAOA 2ZVPX 2O8EA 1R0LA 4WIAA 4R9RA 3I8XA 1ZJWA 4B6JA 3ENKA 2H7YA 2I65A 4OLFA 2CTWA 2F43A 5EIBC 3I5XA 1SVNA 3IGFA 2PGNA 3AGKA 2Q46A 3H16A 4IFBA 4IMJB 4KBYA 2JRLA 2RB4A 1IPAA 4H1VA 3WWPA 4GI1A 4L9AA 3B1KA 4WQMA 4CL0A 3S03A 4BFUA 2XMQA 3FA2A 4JP3A 4QU0A 4N3AA 4OHMA 1QUFA 2IZ5A 1W4LA 1USGA 4PSVA 2HDOA 5ECDA 2W2NA 5ERXA 3AKZA 2XNDA 3JVHA 3T9DA 4BEWA 5HX7A 1KZ6A 1IRXA 3G5MA 3I5DA 2JCXA 3L7BA 4IXNA 5A2QA 4HDNB 5I4BA 2FQWA 1OBOA 2WA1A 3IE2A 3D2AA 3MCWA 3K73O 4RF5A 1ZU5A 4IWNA 3BB4A 2LZ0A 3E2MA 4PLVA 2HMUA 3PR1A 3KWFA 3U39A 2KG7A 3BTVA 3OE7D 4IHQA 4NS1A 2DHEA 4EPTA 4ASUA 1QUEA 1IV3A 2Q3HA 3AG5A 5CAEB 1J23A 2DT8A 1L8AA 2BGRA 2ZYUX 1USUA 5HKLA 3MF4A 3HGMA 4H31A 4E51A 3M33A 4HTAA 1M54A 5FX2A 4I9QA 1BQZA 5AUOB 7ADHA 1F2UB 4YI5A 2ILTA 1OPXA 2XNSA 1ZR2A 5JSQA 2DERA 2ZREA 3D6JA 4CRWB 4JJFA 2Q1UA 1TTQB 1YQNA 2QZJA 1Q15A 3L70H 1X7GA 1YQXA 3C6MA 2EKQA 3DWGA 3HDQA 4FIDA 1GNLA 4KC0A 3AHDA 1QFXA 3EFEA 4D97A 5GADl 5D6NA 5HILA 1IQ0A 3HSSA 4XUEA 3HFSA 4PAOA 3H9CA 3ZHVA 5A4FS 1XTUA 2DQ0A 3W2HA 3JYQA 5IVHA 1QV6A 2L6LA 1DK1A 3RASA 2ZJBA 1J49A 4JV5O 3ZHBA 1NASA 5IHXA 1C0LA 2YKGA 2EEPA 1Z0FA 3VOAA 1JNXX 4RVNA 3WHLA 3GVMA 1IU9A 2R4TA 4DQKA 1N1GA 3AJ9A 1MZFA 3B2NA 2AN1A 3NIFB 4BO5A 1KIFA 2IXBA 5BXQC 5FUQA 3Q72A 2Y2UA 1DKNA 1KFKB 1ADYA 2VDJA 3I05A 3PNQA 2IOYA 4MP3A 3W06A 3EAFA 3FUCA 4RJ2A 3U5ZB 2X9QA 2ZB3A 3IKJA 3LUJA 4KWIA 3IO3A 1Q90D 3NK6A 3V3TA 2QAGC 4GOMD 4JJKA 4P3OA 1TLLA 2QYOA 2VH2A 5AW1A 2LD4A 3D6NB 3L75H 3FSJX 3K0FB 5AKEA 3DO5A 4B3HA 1F7YA 3DBOB 1T4CA 2H4JA 2P2YA 3OQHA 5ALOA 2N75A 5LA6F 4BQIA 5J2UA 1CV2A 4MX8A 4YY3B 4Q18A 2OP0A 3DLCA 1T2DA 5GJVC 3QYAA 1MT3A 3IFSA 4CKBA 4G5HA 3L82B 3WNBA 3NVKE 1FK8A 1W5EA 3QEAZ 3QEBZ 5IT9M 2GBCA 5FWNA 2RGRA 4RVHA 4M9ZA 4OKIA 1OCCC 3FZYA 1JEDA 5F21A 4TYMA 3WIBA 4ZGGA 4ZVNA 5C7OO 2ZRIA 4C0WA 2FN9A 3VKGA 2B1RA 1DOZA 5BSWA 4G8CA 1YZYA 2FDXA 1A69A 2E5LB 4G25A 3SY8A 1KK3A 2C5LA 4NUTA 2Q7GA 5I7SA 1PFKA 4DR1O 1SZJG 4N3GA 3MILA 1IN5A 1JSCA 3SJUA 5KKCA 1PQ4A 4FSXA 3K2IA 1SCDA 2DBVO 4O25A 1KQNA 5C2JB 3K12A 2J3MA 1LXCA 5FLKA 5JYBA 4YASA 3EVGA 1UP6A 3AB8A 4IGAA 3UW1A 1NVVR 2XQVA 3A4NA 3N9IA 4R1PA 4M0MA 2FSUA 3AU9A 3EZGA 4ZQHA 4DLZA 4LVNA 4FKMA 2GZAA 1YJWF 1ISFA 2HT1A 2C99A 2JEZA 4LHWA 2HWYA 4P30A 3OBWA 1NUPA 1P5RA 2BSQA 3NXKA 4NEGA 1R6UA 5H80A 1DJNA 2AUTA 2FEWB 4FU0A 1HI9A 4LQDA 1WQ3A 5CT8A 3T5AA 4LR3A 3K59A 1ZI8A 3Q4GA 4L4XA 3VH3A 3MMPA 3JQQA 5LLDA 2HXGA 4AN4A 3K71B 2EZOA 3O1LA 4JP2A 4OVKA 3V1TC 1E3EA 5BV8A 4MWOA 3I6BA 2SICE 4HDAA 4K6MA 4DCOA 4EYOA 1RP3B 2BJWA 2F90A 4RENA 4DV3O 2E4WA 1SBTA 4TQUS 4QKQA 4MUMA 2OHGA 5CX1B 3RSZA 5LPNA 5KYGA 2Z01A 3DDNA 3PRHA 2F1RA 1VSVA 2QENA 3DAPA 2OMEA 3IP6A 3IQHX 1YXMA 3PQ2A 3BGVA 4FC6A 2B5UA 3I0MA 2FI1A 3GG2A 4K81B 3MWKA 4RPJA 3UGQA 2A84A 3D3EA 2VPQA 4DREA 5JWOA 4UBOA 4GXRA 1NR5A 1AUOA 1FTNA 1RHMA 3AF3A 2QLFA 1T29A 5AO9A 2F64A 4CMHA 4I36A 4QRIA 5AP9A 2JLYA 1J0EA 5AQ1A 2XVMA 4QULA 3TQRA 3RBXA 3S8MA 4E6EA 4F1WA 3UJPA 3F5WC 1NNI1 1Q22A 4LGCA 4OYYA 4D44A 5F98A 1S5LZ 3I52A 4C6RA 5JARA 3LW8A 2GAAA 2ATEA 4U2GA 5ICMA 1BMDA 3COSA 3ZLBA 2CV2A 2ODQA 1U2RA 3N8KA 3MHPA 4L87A 1SHJA 2QG4A 4MYRA 2Z5UA 3LDAA 5CX4A 3WL8A 5C32A 5L51A 2XYQA 4Z2AA 1P33A 1PYOA 1P0QA 5AUPB 3PFFA 1FC0A 3P97A 2JVDA 2H2WA 4NCHA 5T4HA 3RUHA 4R41A 4YRCA 4BLWA 1X7DA 4HWRA 5A9SA 1D2DA 2QX6A 1J2UA 3OZIA 3UAGA 3LSQA 1KP3A 3AI7A 3ISVA 1O5IA 1V4VA 3SQDA 3KUKA 4B9AA 3CVVA 5EHNA 5BNFA 3CCLV 2Y69B 3F0GA 3SJCC 2CLIB 2XQKA 4MRAA 3ZS8C 3JVEA 3KKNA 5AQEA 3MCUA 3TJZA 1AQYA 3PDHA 4RK6A 4ZU3A 1ZVJA 4IVPA 3RSHA 4EDHA 3NEPX 5BNTA 4ZOLB 1R0KA 1IWOA 4FFLA 2CT8A 2QWQB 2I3DA 5LP6C 1CJCA 4U3JA 3ABOB 4W5NA 5JO0A 4PHHA 1PLKA 5J2UB 4RY2A 4ZT3A 4NCXA 5FPKA 5M5BA 2PAAA 2C5EA 3M99B 3OTIA 4E2YA 4WFGA 2IS4A 4A15A 2PX6A 2CSUA 3OPVA 1NDQA 3EYWA 2QSYA 4NZPA 1O4WA 2QU8A 1QRDA 2C03A 2GDSA 2X8BA 5E95A 5AKJA 3CZ5A 3IBFA 4U7PB 1UZMA 2E55A 1QF7A 2GJ9A 1IJFA 3LGSA 3NGLA 4B82A 2OYRA 1AJQA 1Y7PA 2WMYA 2UU9B 2ZT8A 4Q05A 2X19A 1B26A 1JJBA 4A5OA 1ZR4A 4MO2A 4LNHA 4II2A 2DEUA 2QJOA 3FDZB 4CT5A 2VDUE 4FBLA 4D8TA 5HVNA 4UUQA 4N9QA 5I45A 3MWDA 1Z74A 4RX1A 1YRLA 2R0QC 4HQRA 4CETA 5IE9A 5GW7A 1Q1QA 1SCUA 3TRKA 3THWA 2IH3C 1VKOA 1Y4SA 4HS9A 4EH1A 3R9KA 5JDCA 1F9AA 2HKIA 2XAJA 1N6IA 2WHXA 1HT2E 3I76A 4K1LA 5KJEA 4E15A 4X1IB 1T6YA 1TO2E 2ZRQA 1HYEA 1JAIA 5J23A 4GLXA 5ALEA 2BLNA 2DB3A 2H85A 2YWBA 2C61A 1RLGA 1T35A 1EK5A 1LLCA 1XF1A 1QRUA 3DL4A 1J9GA 3GL9A 3WRVA 4AYTA 1EFHA 1Z35A 4ISBA 1P9RA 4L8VA 2RHLA 2DBZA 5CXQA 1QF9A 3EOAI 2YVUA 1M8KA 1D7OA 1V96A 2QEXV 5GAPK 5B5SA 1FJGB 3CWCA 3KCQA 4B31A 5BR1A 4RO2A 1UH5A 1Z26A 2PRKA 4GR4A 2ZQYA 1FRNA 1DC3A 1L5FA 3NRJA 3P9KA 4WLOA 1CRLA 2OLEA 4CYMA 1G5RA 1SUCA 2R1ZA 1OIVA 4FZ3A 3KCYA 2G71A 3FCSB 3RWRD 4TMYA 2WDZA 2QL7A 2HK8A 2O9JA 2G17A 5EL0A 4PZYA 3AFOA 4BVTA 2NG1A 2QLMA 1I3OA 3ONDA 4FOPA 1G8GA 3W2FA 1JTFA 1UC4B 5K8IA 5C80A 2DMRA 5ALPA 1BOOA 2PAFA 1WA8B 2O57A 5DGTA 1JJ7A 3EVTA 2PANA 1Q6HA 1YJ9V 3FWPA 2LBPA 4NH4A 3CH7A 1OHHD 5JROA 3RGWS 3TSCA 2ZS8A 3WZ2A 5L53A 2ADPA 1XRQA 2YZ7A 3B3JA 4UTVA 3ETQA 3H2JA 4DV6O 1AZWA 2HF8A 3V7WA 1FDIA 3LT0A 4YP5A 3ZKAA 3GJRA 2IY8A 4QYWA 3WGGA 3ELDA 1W40A 3A9CA 5AHOA 1VJCA 3RTBA 2YVLA 3BA8A 3RYCA 1VCHA 2R2GA 3I0ZA 3QA3E 3AYXB 4ZT7A 4LX0A 5JZSA 2E2WA 1VDMA 3QGMA 4R9VA 4DDVA 1SIBE 1E0KA 4FE7A 1MC4A 2F8SA 2XOKA 1D6SA 4R7TA 2XMGA 1S2OA 2BEKA 1DS6A 3C3YA 1AC5A 4ZKIA 2VTVA 4GI3A 2ZT9B 3VR3D 4DR2B 4C3OB 1AGRA 1FPQA 3DTNA 5AI6A 3GT4A 4BO6A 1V25A 2KMLA 5JQGB 1DARA 1J2JA 2MW2B 1L4BA 4G2KA 3S1LA 4Y9DA 3CWBH 1U94A 2G63A 1PJAA 4YJFA 2PLWA 4H7FA 3T1TA 4G8JA 4MYDA 3DBHB 5I7AA 5JJIA 2NXEA 1WE2A 1BYUA 1T9BA 3KQOA 1Q7EA 4PWZA 3RVBA 5IYBO 3FB6C 4DIEA 3VTKA 1Y8ZA 2WG2A 3LXUX 2HSDA 2QUIA 2VQ3A 1RQ2A 3FBWA 3GA0A 4YBRA 1XJ5A 1KARA 5LR6A 4TXNA 1T0KB 1R5OA 3FRJA 5DBGA 4CC5A 3K96A 4X3OA 2PKQO 4FNOA 1YHQV 4G4ZA 2LCIA 1JDPA 4YRDA 4LHYA 3QU7A 2YW9A 4ZWNA 1CP2A 4XRRA 2ST1A 4JT9A 2PH5A 3PEEA 2BFPA 4Y2TA 2HWWA 1GGMA 1SBNE 3D6VA 4UHCA 4BQNA 2PGJA 1P2SA 1Y1LA 1KY3A 2DYSC 4G4XA 1F5NA 1ENOA 2R65A 4P22A 3MBIA 2UZ0A 3OT4A 1YDWA 2P5SA 3OIFA 4URZR 3TGLA 5FTNA 5B1BC 3KR9A 3IP3A 3ZHUA 4LA4A 4PX9A 4PDMA 2PUBA 5AW8A 1VG1A 1YI2V 2FK8A 3LK7A 3L9XA 2W6OA 2X1LA 3FPAA 2QZ4A 2ENWA 1H3FA 1UAAA 1L5SA 3R5SA 4V0NA 2PT7A 4WJLA 1YJCA 5EE5B 2AUNA 3M82A 2J46A 2NQTA 1RRVA 3BEDA 3KWJA 3QNWA 3OU2A 2YN4A 1DIBA 3ILYA 3NFYA 2JGFA 1HG0A 3CCJF 1Z34A 3CB4A 1SU8A 1DXQA 1PAUA 1CDEA 1XKLA 5AW9A 1H2NA 1A0OA 2O5VA 3EA0A 3IURA 5EIXA 4P32A 2BJVA 1DBRA 2EU8A 1RFLA 2GD2A 2JEYA 1QFYA 3AERA 1V1MA 4PANA 4OV6B 5MHTA 1L7XA 1N0WA 1SPXA 1GXSA 2A0YA 2WYOA 4RDHA 1IXBA 1V5GA 5MN4A 1P5JA 2C95A 2QAJA 3BHJA 1NA5A 5EMMA 3SM3A 2F3UA 4X1KB 2Q7HA 1RJEA 1O58A 1TPYA 1YL6A 4KSBA 3CVYA 1FNBA 4LC0A 3MWLA 4IZ6A 3CVOA 4GT1A 1XMQB 3EORA 1Z75A 1MMFB 1WVGA 1N5RA 4JT4A 1DG3A 2PLNA 1Y4DE 3NHRA 4C0JA 1OT3A 4LF8O 4FXPA 1OMOA 5ALWA 3UATA 4JU8A 3GLGB 3BA9A 2FFBA 1U0EA 1W5FA 1KNQA 1Q1BA 2JNWA 2HY7A 2VJBA 4XXHA 1AQLA 3WLNA 3I1FA 5L3VA 1OZHA 1Q12A 4L07A 2YJNA 4AJIA 4EQ6A 2C3UA 4Z4EA 4DRXB 2QRGA 3T52A 1R5NA 4YLYA 3ANYB 1AO3A 1K8RA 3TG8A 5BN3A 1H8EG 1YBAA 3A1CA 3HYLA 2NYAA 4FR0A 5ALKA 5F3DA 3DE7X 4IPTA 1CW2B 5ILOA 4MAAA 3MUFA 3ZVKA 2KTVA 3H2SA 3TQCA 2WQ7A 2HMWA 4RE6A 2WU4A 1ONBA 3K0HA 3DO8A 4ND6A 4ECAA 3SQXA 3G4SF 1SZTA 3NV7A 1JIXA 3OZFA 2AOTB 2ONZA 1CUXA 1SQQH 1PWHA 2ZWIA 3L0DA 1SOUA 2D1TA 2Q7DA 2R00A 2OCBA 3B6IA 4N6NA 2WC1A 3JYLA 3BWBA 3CC2V 3OOJA 4K6CA 1T9HA 4E5YA 5J2TA 1JGTA 1CDZA 1WKBA 4RHAA 4RDIA 3A4MA 2JD1A 3GIWA 4I14A 4O29A 3REOA 3V7NA 4BZWA 3AC0A 2ZSHA 3IIKA 4B7UA 1XZHA 5KHJA 4GL2A 1A88A 3E22B 2QM0A 3EEQA 4AD8A 4B71A 1J21A 1H2WA 3G3EA 3WJPA 3G49A 4NBKA 4A8PA 3B40A 3IQXA 4N0DA 4CDRA 3PHBE 4HUTA 4ZAFA 3M8AA 2C42A 2ZS9A 5ULLA 3QLJA 3OICA 4LRUA 1J6UA 3WJ7A 4YCCA 1XEXB 2WZBA 2R62A 2XQIA 4M54A 4DZTA 2VNIA 2XUKA 1ZH4A 5CP8A 5DNUA 4BMOB 1GZ3A 2NYVA 3GWOA 3CEAA 1Q3TA 3S0YA 1T2VA 4JAVA 4JI8B 3KSDO 3G71F 2PY6A 3AI2A 3W5VA 1G3QA 5HOQA 1GGVA 2GYUA 1H7MA 2JS7A 4DXWA 3AG1C 2VQFB 2ZKLA 3LQYA 1ZW6A 1DKPA 4KFRA 2FLWA 5LZ5A 4R0VA 4AUEA 5CCBA 5AOCA 5FBQB 3GI1A 4YCMA 3QENA 2R1VB 2CJWB 2YEVA 3TLYA 1E94E 1EG7A 2HPZA 2FV8A 2QZ9A 3QUCA 3GLFA 3A25A 1MT0A 1Q0UA 1W4ZA 2OBBA 2D1SA 1P73A 5TQ0A 3TE6A 4H3SA 1TI7A 2ZFUA 4ZO6A 3ZKWA 2R1TB 3ROEA 3RC7A 2XLCA 3FX2A 4MUGA 4B4DA 2HADA 2YXNA 1WB6A 4KXMA 3PDUA 5D51S 4BRSA 4EENA 5BSVA 5GV7A 2CHTA 4ATNA 4ZI7F 2GF0A 1P49A 1KC8H 1I5EA 1K1EA 1VG8A 3MA0A 4AB1A 2RHJA 1KZYC 2J3KA 1VKNA 3GVCA 2EGHA 1NU6A 2RBGA 3P0JA 3TRJA 4DJFC 4EP1A 5LNK1 1H5UA 2UXDB 1BKSB 4HFNA 4N7RA 4QNMA 2OXIA 1S0UA 3G71V 1XVAA 2WJWA 3LVFO 3LMEA 2XYRA 5IZ4A 1ORWA 4FOLA 1DFGA 3MIIA 1ILEA 4Q15A 1MRZA 2J33A 1OAOA 4X20A 3T12A 4ARVA 2WRZA 5AM4A 1RHRA 1WV0A 4WFIA 4FI3C 1CUWA 2IZOA 1ENYA 1RP7A 4J0GA 3T3MB 1VE5A 3TIGA 1Z4MA 2FDRA 4MUHA 1AI5A 4AIRA 4F72A 1Z47A 1XCGB 2PEZA 4KP4A 3IBSA 3PPXA 3SWWA 4MKHA 1X7XA 2IJJA 2UYPA 3COPA 3BVOA 3TTVA 3E1GA 1Z83A 3EVDA 3KPUA 4EUFA 3AG3B 4UNSA 4QJFB 5F4BA 5FOWA 2QD4A 1SWWA 3BC1A 2PVPA 3FJ1A 1VQ9V 1MB2A 3MK31 4X90A 3QP9A 2QT0A 1QH1B 3T1CA 1JH9A 5DPMA 3U49A 3LUBA 4Z8YA 1PDWA 1XHXA 3NBZC 3OFNG 3G0CA 3NIBA 2VPWA 3HO1A 3EBLA 3Q7TA 4JS0A 5BSUA 4UMEA 3EQ8A 4E1BA 2PUJA 4HTFB 2VDMB 5JQGA 1YAJA 1HNWB 2OXTA 1ULUA 3AW9A 2PHNA 4MTGA 2NOAA 2Q4DA 5IG2A 1XHLA 1WLSA 1KYVA 3HYNA 5JXIA 2X0JA 4G0PA 2AMFA 2JI4A 2H0RA 1WV1A 1AURA 2XXBA 2CBXA 3W3AA 5C53B 1I6LA 1M2OB 4F0JA 4P2ZA 2QI2A 2DRIA 1K73H 2FX3A 5F2KA 4BNHA 1MF7A 1Z5GA 4FDLA 1RSZA 1QWOA 1HGXA 1QNMA 3HR7A 1R4ZA 3ZGVA 1T0PA 2HM7A 2BEWA 1QJ4A 4E4YA 4QOFA 1RW4A 1KEEB 2V45A 4QUDA 5ER6A 3LV8A 5AKIA 5FWYB 2A5DA 5K7SA 4BVJA 3I39X 2IPAB 5GJCA 4HWOA 1PBTA 1NVMB 2NSYA 3L0ZA 3FPBA 4NESA 4EW6A 3BF7A 2CEKA 1XTVA 2UUOA 2W2LD 2ETVA 5JYCA 3G2HA 1H05A 1OFVA 2QTBA 1OAKA 1T5BA 1FAFA 2EFJA 2X40A 3KEGA 3KZXA 3LWVC 3FWKA 3KX2A 4Q3DA 2JGDA 5IWAB 2FRDC 3EE6A 4WBXC 5B1SA 3PGLA 5K0SA 1EUYA 7REQA 3UJ3X 2VJOA 3MPUA 4BP8A 4OQQA 4E11A 3I61A 3KV3O 3LWDA 3ZD8A 2YMLA 2GARA 3G5LA 4YJ2B 1SUEA 1DCMA 1SC3A 1ZIOA 2OCCC 1M6NA 3JWJA 1VQMV 1XCLA 4EHLA 4I2NA 2BFFB 3TINA 3IX7A 1Q7GA 4B7KA 3EBPA 3MUNA 4RJJA 1SURA 2R44A 1EM1A 3VZRA 4MHOA 4F9TA 4DSUA 4E30A 1T24A 3CEIA 1RWOA 4HQNA 2LDBA 1CY7A 2A86A 2H92A 1WXGA 2R3SA 4KQWA 2Q8PA 2RKBA 3PB3A 4MR7B 5DM0A 1ZINA 4XB6B 2GEUA 5DHTA 3TWOA 1PV1A 1SD1A 1U8YA 2HK9A 4PHGA 3ZXUB 1EE9A 2XUFA 3CONA 2VDWA 3W7WA 5D1NA 4B8WA 3T1QA 2H08A 4CL8A 2AFIE 2G5GX 3ZV4A 2QBYB 1ZGCA 4URYR 1M1ZA 1HYBA 1N5DA 1Z08A 2OCLA 3KOZA 2DHCA 5IAEA 2Y0CA 1U7PA 2ZRFA 4YYEA 4QOJA 3RYHB 1G1XB 1A9YA 1T2CA 2XHEA 3A26A 3LWPC 4ZHQB 4ML3A 5SYAA 2PWYA 5E9WA 1DBQA 3EIWA 1UODA 4PYJA 1BMFA 4EMSA 5F2VO 4H7IA 4PHZA 4RAIA 3HWRA 3LSSA 3CPJB 1QBZA 3NBMA 2PYJA 2HV8A 2I3AA 4ZDIA 1Z4KA 3OX1A 3LTNC 4QDJA 2BGWA 3IKVA 1WPRA 1K0FA 2AN3A 3BDIA 4YLEA 5B1IA 3H7IA 3DAYA 1GA1A 2FPPA 1L7PA 1D0IA 3EF0A 1SWVA 2BDEA 2X4DA 3L1VA 5CGQB 1PK7A 4WACA 2I71A 3DD1A 4XWKA 1KVUA 2EBHX 3FCEA 3TD3A 5L3ZA 1LWNA 3BBLA 3OQBA 3R77A 3CEPB 4QHSA 5IANA 3ZZNA 1N7HA 1XUOA 3DJFA 4MIYA 5GOZA 3TRIA 3UJDA 1HR0B 1UCFA 3V7FA 5I7RA 5D3KA 3GT3A 4BU0A 5AW5A 4Z0TA 1MIOA 3U61B 3E5NA 1TZCA 2W2OA 1UJCA 1JB9A 4A1FA 1IJEA 4CLDA 4I1PA 3JWIA 3UKOA 4A82A 5L3SB 1P7PA 3RVRA 3ETEA 2VBIA 4EG6A 3UWMA 3IIEA 1S3JA 4BVGA 2YJZA 3NZEA 1A8SA 3O4HA 2PJZA 3IDZA 2FSFA 3QELA 4DDWA 3DXZA 4YCBA 1R0YA 5HS4A 4X0EA 3T0GA 2EJVA 3DC7A 3GGDA 4M0CA 3OTHA 3NJRA 3WKAA 2FJUA 3BG5A 3GD7A 2HR1A 4OHWA 3HI6A 1OH7A 2HRRA 2KQUA 2BFEB 3BOSA 1V5IA 3PBKA 4Y67A 3EFFK 1QGED 1LUWA 5J2TF 4D5GA 1A9XA 3X2QB 4JUFA 1KP2A 3LIIA 4GKVA 3C0KA 4PYNA 1L1EA 3EZFA 4GYJA 3VV2A 3GLKA 2ZDQA 3RF6A 2C4HA 1GCAA 2VWQA 4UCQA 3GDHA 5CG1A 2SKCA 1N2CA 1PD1A 2GF2A 3ZP4A 5TQ2B 3R3SA 1PR5A 2IITA 1XI1A 4X65O 2NTNA 2BH9A 1JP7A 1T5IA 2OTJF 3IULA 3M9LA 3QJ5A 5THXA 1LK5A 1Y7TA 3TKYA 3TNYA 3UXEA 4E3ZA 1E77A 2AYZA 3CRVA 5AVSA 3DH0A 4P2BA 1G5QA 1XVIA 4OHUA 3ANTA 1VQMF 2ZYWX 1K3UB 3EUFA 4NYMR 4NABA 4PLYA 4MVJH 3E83A 1P8AA 4HTFA 1JBKA 1JZQA 4UM7A 3NHZA 4UQLA 5EK0A 3OE1A 2HCFA 3ZIUA 2PD3A 2P3QA 1NXXA 1N2SA 3BDVA 4AY4A 2BTQB 3WPWA 2QV0A 4TLCA 3ZWXA 4A0HA 4BLUA 3N0RA 4CKZA 2AWOA 3OX4A 5KU7A 2XB6A 2O1EA 3IDQA 4I9FA 3DR3A 4QVGA 5CTAA 4H37A 1TNDA 1XDDA 4S0ZA 1F12A 1KFCB 4MTFA 1BVUA 1MGPA 2BP7B 3WGNA 1G291 2O0LA 2YZ2A 3OJEA 4OAPA 4U7TB 3T5GA 4YALA 3EPPA 1RYYA 2I3ZA 4C4XA 1E3QA 3MERA 4ZI7A 5C8VA 3JQ7B 1VL8A 2C3YA 2F23A 4RJKA 3T7DA 2ZUFA 1T9ZA 1A5SB 3MS2A 4I8DA 3DUFA 3FLBA 1DTOA 4PA6A 1MV5A 1MXFA 1YUNA 3IKTA 1W1WA 2Z09A 3OPYA 3BDAA 3V8RA 3WNDA 1IN4A 5TSDA 3RC2A 5U4XA 2CLMB 4GO1A 3A4YA 2BFEA 4J9YB 1XMJA 4IZIA 2YWCA 2GN4A 4PAGA 2GCEA 1M0SA 2R8OA 4ZAZA 1YI0A 4U3FH 3TFQA 5HE8A 4JI6B 2AFIA 3M3HA 2AI2A 3PLAC 2NZVG 4LMPA 2HPVA 1ZHOA 1U2EA 2QD5A 2ZB8A 1HDOA 4DV0B 9ABPA 4HD8A 2DTXA 3FTDA 4CZZA 3R4CA 4U6QA 3SXUB 4JTCB 5K8CA 3GV0A 5C3UA 2IHTA 3R5XA 1NMYA 3I5AA 2P1ZA 3LZCA 3WLIA 3W77A 2AKAB 4Y30A 2KX7A 4B3TB 4EY5A 3NDRA 5AXBA 1YUMA 2GVDC 2GK7A 3KUDA 2GBLA 4PA4A 5AR1A 1VCMA 4O1MA 4UMVA 4MA5A 5J3JA 1JBQA 2O3JA 2BBWA 3ODPA 2HQSA 4GOJA 1KO7A 1HNZB 1IIRA 4WZBE 4QA9A 3SIWA 4HXEB 3HP7A 2KHZA 1KPGA 4OX9O 1Z0KA 1JQ0A 3MGBA 5DGXA 2P68A 4QUBA 1YZTA 4D92A 3WK7A 3CLTC 5E1AC 3DLHA 2B35A 4X8AA 1IM2A 3I4LA 3MVEA 2ZYAA 3SI7A 5FDFA 4JVMA 4WFQA 3V1KA 1IBKO 1F9EA 3K0FA 3ZCRA 5E3HA 2X41A 5A4MS 5JXHA 4JC0A 2HMYB 4K8ZA 2BVNA 4MEBA 4PFJA 2WJAA 1ZHHA 3ULKA 3MHHC 2FLKA 1GK9A 4FS3A 5U9CA 5KYWB 1TYDE 3B09A 3UUWA 3ZXYA 4KL1A 1DNPA 1YDEA 2CLOB 2IPNA 2VSNA 3HSKA 1O77A 3CMEV 4NK5A 5FTKA 1JU9A 1K73W 3RVMA 3LQ1A 1WU7A 2O7QA 4MV3A 4B6EA 3SVTA 4AS1A 2QVXX 4OGGA 3T3GA 3FHTA 2ZR7A 2C31A 3B9QA 4BATA 1YJXA 3C6ZA 4GZMA 4P84A 2XZOA 2FOIA 4G07A 3O7MA 4IHJF 3RTDA 5AXAA 4FMDF 2FP4B 3OE7G 4LY0A 3E6AA 1F7VA 1XTPA 1YA6A 1VLMA 4WXRA 4YGYA 3CLHA 5L7WA 2D4AA 3A27A 3RYFB 2Y67A 3NNDA 2QBYA 3TLGA 1I08A 4X66O 3V8MA 3BWYA 5DW3A 2VRNA 1R4MA 4P5EA 1E2PA 2A9HA 2FX2A 3BSWA 3EZ6A 4MPDA 4WVLA 1QIIA 4Y9TA 2P35A 1Z2PX 1SXIA 2QRVA 4J76A 4BZXA 1JAHA 4YCJA 1DIAA 3CMEF 3P9IA 4HGZA 1UPBA 5T4FA 3PXGA 5LMNB 3IJPA 3E3AA 1MBZA 4IM7A 4JX9A 1UFRA 3LG2A 1ZWLA 2WF7A 1PNLA 3CLKA 3MWYW 5FIUA 4DCUA 3RTAA 3LX5A 4UQPA 2H2DA 2OTLF 2R7AA 1OXXK 3OJXA 1IEWA 3SIXA 4DWOA 2YFKA 1AUQA 2HLPA 3OR6C 1JL3A 3EG5A 5FJ4C 4I3HA 2P40A 4YIPA 3DGFC 4CGZA 1Y8AA 2D0DA 3RV4A 1E3TA 1KVQA 5D84A 5IT5A 1UK8A 1F8FA 1HE1C 3D8UA 1JZSA 1AQNA 3MUEA 5K20A 1GFWA 4ITUA 1MIHA 2CNLA 1LW7A 3NKVA 4S12A 1RCFA 2BFDA 3D5EA 3IEIA 4L78A 4KIGA 4H6WA 4TV9B 1Q50A 1TUGA 2PXXA 4YUVA 1WQ4A 3SJBA 1IHXA 1OV6A 3MLEA 2YDYA 5CGZA 3L8CA 3KXIA 2G70A 3ZDZB 5DEOA 2X8AA 5FPRA 2EINB 5EWLB 4TUYA 2F1JA 4Q7KA 2PYDA 3WBFA 4HH4A 2QX9A 4DMHA 1SO8A 3NS7A 3CNHA 5KIAA 1P61B 3K72B 1LLDA 4GP7A 4PGFA 4EFKA 1W5BA 2FZWA 2XCTB 4WCFA 1C8KA 2D6FA 1CJSA 4MH0R 4X62O 4JSTA 2IHKA 3RVLA 3HJCA 2QM8A 1NZDA 4D9FA 4OP1A 1Y3AA 1QVFU 1NJSA 3QPCA 2FN8A 4ZKEA 3UUEA 4ZOLA 2XY4A 3C8ZA 3LLVA 3MS7A 3KDAA 4HPWA 4WCDA 1E79A 3EXEA 3QFSA 1X9GA 3IEMA 4IL6Z 4EKWA 1GUBA 1SOMA 4BY9E 3KQPA 5FPTA 1S3IA 1NTKH 5T6BA 4LBEC 4R1LA 4XAQA 1SBZA 1UANA 2WAYA 4TTQA 1C1DB 4Q9IA 5BUCA 4LMAA 4KUEA 1H9CA 1J39A 1QZXA 3IJEB 3SQNA 4Q3OA 1CRQA 4ZZ3A 3KQLA 2OZEA 1VQ5V 4RTMA 2VDLB 2GXUA 4IO1A 3FKQA 1TUIA 4ZT6A 2AF3C 3NHSA 4L5AA 1FFHA 2AFIB 5DBEX 3EEBA 4Z1MD 3IBCA 2M9MA 1JILA 3B38A 3SS9X 4O2AB 4GBED 1ZUNB 3TQIA 1N36B 2QL5A 3K0EA 2FC3A 4UU1A 3W6NA 3JCZA 2BMDA 2X0IA 5IK2D 4IIUA 1KO4A 1R6TA 3D3QA 5DULA 2L42A 1DL5A 4US0R 1NI5A 3O9OA 1GAXA 4HH0A 1PJTA 2ADQB 2VSFA 2W2TA 1WPQA 2XW6A 1HZZA 3GLIB 1VQNF 1B2LA 2IV3A 3QSYA 4DQLA 4Z4HA 4RSRA 2FETA 2TMGA 2GZ1A 1QH8B 4PA9A 2HMAA 1M0WA 1W5AA 2CXUA 2PWPA 3MOIA 3NNSA 3HCWA 4GVLA 1E61A 1T0AA 3DFZA 4AX4A 4J07A 2CL6X 3WS7A 3O1HB 1GY8A 2ETXA 2Z4TA 5IKMA 1RKBA 3BGSA 2RIRA 3OJOA 5JFOA 3P20A 1KI2A 4BCCA 5BVGB 2ZJ8A 5CH8A 2QQFA 4EKDA 2C7PA 2ADFA 2O2EA 1ULHA 3MT8A 1N8NA 3CUTA 3BHMA 3HR0A 3VSEA 2QN2A 5EB0A 5LLTA 2ZPTX 3O38A 3RB8A 1IV1A 4O2BB 3IP1A 2A0FA 4RVSA 1Y3CE 5EJ2A 5JNTA 1GJRA 1P3DA 1K8YB 2BN4A 3MJ4A 2UVDA 4PYOA 2VLIA 2CXTA 2XASA 3DBLB 4GPD1 1IZ0A 3LE8A 4H1HA 4H7JA 3K08A 4M53A 3RK4A 1Q8RA 1NVWQ 4D1YA 1Y1QA 3FD6A 4QTUB 5H9WA 2CL7X 1NXWA 3DVAA 3RYCB 5TQ2A 2VF4X 2XZTA 3LYAA 3OVMA 1UBEA 4CS2A 2G4LA 5AVJA 1ZO8A 1Z0IA 5LYJA 2AG0A 1LB1B 1PJCA 2FRXA 2ZSAA 4OGWA 5AHXA 1AR5A 1ZN9A 3BD8A 3HR4A 2C9BA 2Y68A 3EXAA 4X64B 3ASNC 1ZRNA 2C29D 3FMVA 4MCIA 4MUJA 3RFFA 3STUA 2F1KA 1SQBH 3I04M 4BWGA 5B64A 1PI3A 2O8EB 1D7AA 1V8OA 4LJ6A 4MUKA 1DAFA 3EWAA 3KE9A 2ZAOA 4OXKA 4U9IS 4CV0A 2PCJA 5AVWA 1QHHB 5KJ1A 4GM4A 5EINA 5ETJA 3SBDA 4X8LA 4L75A 8LDHA 4UTNA 4Q9DA 4B74A 4CQNA 2LGQA 2CUTA 1LLQA 1F51E 2Q9CA 3EJ6A 3NBFA 3OSZA 4HB3A 3WYFA 3BRSA 2V7VA 4QTTB 4YP7A 1G41A 1S9DA 2ZGVA 1GNQA 3P0HA 1UM9A 3RUFA 1UFQA 1GRQA 3CLVA 3VO1A 2WJ4A 2FJ0A 1JDZA 2HBZA 3C8MA 4RSGA 4YHBA 1UC5B 2CMHA 1TU0A 2PJDA 3LY8A 4K8OA 4QYMA 5JD5A 2VHEA 3QG1A 4P34A 3A14A 3AB3A 1MVLA 5MGNA 1K27A 3Q9SA 3WYCA 4UNRA 1P6XA 3FH0A 4FEEA 4HNSA 1TFRA 3WJRA 2W98A 1E5XA 2XJ9A 4GC5A 4JLOA 3EC7A 4OQLA 3RODA 4AICA 4BB5A 5EJ9A 1G6KA 1P17A 1YRBA 3UH1A 2WB2A 2Q9LA 3AUAA 1U99A 1G64A 1EJ2A 2IU3A 3I8SA 1TQDA 3OTWA 3PC7A 4GLJA 4RZ3A 4NYJR 3RAPR 2XMBA 1T9AA 5I4IA 4KV7A 4S04A 1GT6A 3IHTA 4QT0A 2YY7A 5CA0B 1E69A 2QP3A 1TW3A 1TM4E 5B53A 1OVMA 1EWQA 1SIUA 2GPTA 5AESA 1JLMA 2OKCA 4TMWA 4CM8B 4BW9A 1V3UA 3OMNB 2ZUSA 3BN3A 4RZXA 1S77D 4IUYA 5L3CA 5DOZA 1U8FO 2GPSA 1J0BA 1KZ4A 3RSLA 2BMJA 4RTJA 4QREA 3A9TA 4CCYB 1V6SA 1QC5A 2V96A 3QBJA 3S29A 3T5DA 2JCVA 2W6MA 1L7AA 3T34A 3CN9A 3SZOA 2JFZA 2YWGA 3NLLA 4JF3A 3BD9A 1UT6A 3K8QA 4M87A 2G9NA 2PG3A 3TD6A 3VX4A 3A1NA 3BQNB 4UASA 3OX2A 4OM7A 2QW0X 5CK4A 4F38A 3U44B 1FSZA 4GMHA 3DAFA 4NJMB 2C4KA 4DR6O 2VPYA 2P2SA 1E9DA 3CH6A 2JFUA 3VYSB 1WP7A 2XNDG 3C15C 3M6VA 5DXJA 1YVPA 1QANA 1G17A 4TKVB 1I4WA 1O5TA 2JA2A 4BAZA 4P4TA 4O2BF 3OQ6A 4GC9A 4PSCA 3ISTA 4YONB 4I1UA 3OX3A 5T5QA 4A8JC 5BORA 4I1YA 4J80A 3K9SA 4P33A 2I7XA 5CVVA 4U7DA 2YHIB 1PNKA 1F4NA 2BR3A 2BF7A 2LDXA 2EBWA 4IH9A 3CW9A 4CIVA 1F6DA 2G0NA 2G25A 2KBFA 2PX4A 1PFGA 2FEMA 5GP1A 5IM4F 5FBWB 3EPLA 4G5FA 3AVVA 5AJZA 3TX2A 1TC1A 2H16A 4B79A 4UUAA 3KFXA 2IDZA 3SVZA 2J9YB 2YXLA 3EFHA 5ENVA 2P6UA 5B58T 3AL3A 5EKDA 2IOFA 2JC3A 3ROKA 1KB9F 1YEWA 3VYUC 5A7FA 1NKVA 5JI3E 1NQ3A 3F6CA 2R4UA 1AJNA 1WB9A 5FAKA 4ZALA 4FLMA 4ZYTA 2I2BA 3W5JA 3FBGA 4DMKA 4XR9A 3GLSA 2FSIA 2AX4A 3ESCA 5BR8O 2NXNA 5TDHA 2ZI9A 4K2AA 1U0OC 2VWGA 4B3RB 4GQBA 5KPJA 4RHFA 4K35A 3LKBA 3VR5A 2IP2A 1B04A 5HJ2A 4CJXA 5KSZA 1SHKA 3I56F 5MFPA 2P9ZA 1OIXA 5HS6A 3I45A 1P1CA 3QE2A 4BUCA 2ONKA 1LX7A 1YZHA 4Y2JA 1OXTA 1E3DA 1NQVA 3S0HA 1DRKA 1L2TA 1HTBA 3CHYA 1MNQA 3HR8A 4L9WA 4TGLA 2WSBA 3L7AA 4BNYA 1C7JA 4YXWG 3HS3A 3S1AA 3SFZA 4O4LA 4HGYA 4D5EA 1WHTA 1BXKA 1YZLA 2YWJA 3QFRA 3Q8WA 1KERA 2HP8A 1ONOA 3TRHA 1WMBA 1N5JA 2BTQA 2IXEA 4B6GA 3MGGA 1FW6A 3FKSA 3ICOA 4ERXA 2IOFK 3QTCA 5FV4A 2XLBA 2WAMA 3M6WA 1VTKA 2A6PA 2AD1A 1XEQA 3LC1O 2Y2VA 4D8XA 1NBMD 4CKEB 1Y8RB 2HU2A 3RFTA 5L3BA 1W2BU 1MA0A 1X86B 3KXPA 1Y4MA 4FLWA 4KNWA 4N5HX 3PQEA 3ZV3A 1KAQA 2NO9A 3D3NA 4AX8A 1NF3A 4F1JA 4BMZA 2XGOA 3NTXA 2H1FA 2G5TA 1QH0A 4UTPA 1QH1A 2A9RA 1FTGA 1NSFA 4LWPA 4XDZA 4IV5A 1E0JA 4JGSA 1GKYA 1N1DA 3E7XA 2VZ9A 4MKRA 3F73A 5ALXA 1LA2A 2AJTA 1B8OA 4C2AA 3K1YA 3M5DA 1L5GB 4F6EA 1VQVA 2VF5X 4HF7A 4TL8A 1IZYA 1JLLB 1GCIA 1UBFA 5FL7G 2YASA 1SCQA 3B7GA 3IUMA 4HAVA 2WIKA 4GOXA 4L2IA 5HKAA 2VUHB 2IJHA 1WXWA 3WG7B 2W83A 3OKCA 5FBZA 2OTMA 2FQXA 3KETA 4BMDA 5JO9A 1DG9A 3KNZA 5HG0A 4CG0A 2V8OA 5TT0A 2IW5A 3JATA 3JQAA 4ND3A 4MRRA 3SIPA 1CCWA 1V9SA 4LOHA 2MWMA 3M8KA 3W5UA 2E4UA 5F4ZA 1I6KA 4NAVA 3G0HA 5K0GA 3QELB 3F7YC 5TE9A 5BNIA 5K3EA 3DXRB 3SJQC 2PH3A 5CVEA 3H4IA 1I4EB 2QVCA 3L1KA 3UAOA 4D0NA 1KGSA 2OLJA 2AHRA 1DGSA 2ALJA 3TIXB 1A76A 1VJTA 3ONVA 4EKIA 1IXRC 3GYGA 4CNQA 3OE5A 1VHJA 4P38A 3RT1A 1ORVA 4A10A 3H9BA 4LY6A 1E4VA 1VQ6V 1NLMA 2PO5A 3A1EA 2WPDD 4YI3A 4E4TA 5IF3A 4J4BA 1JEQA 1IZZA 1KAMA 2BGJA 2WLSA 3EDOA 3OZRA 1I2CA 4Q02A 4DJJA 5B3JA 4C89A 1YF3A 3CD6V 3GMDA 5DECA 1J8FA 1TM7E 3NC1C 1NVEA 1J1IA 4JGGA 1E8NA 3KELA 3BQMB 4RYLA 3RRBA 2C4WA 5E1DA 4DIBA 4DQVA 4PFSA 4NKGB 4WHMA 1HR0O 1PT9A 1J2YA 3UA3A 3VAZA 3WL6A 1K7CA 1U97A 5DN6G 3EGEA 5DX0A 3K6JA 1JZTA 5CXSA 1WY5A 2JJ8A 3BJMA 3DZIA 3ZJYA 4BLTA 4J7UA 5FO1A 5IKOA 1UDRA 4LDPA 4G23A 4ESEA 1KUQA 1ZK2A 2ZJFA 3U26A 2OVFA 3PEWA 4LZZA 3QVUA 4ER7A 2B9EA 3I55F 2GLUA 1WD7A 3G9TA 4BC1A 221PA 2X9GA 4FFOA 2GHTA 3GFPA 1V1RA 2NUTB 4IO0A 3E3MA 5DCYA 3LMKA 3RRXA 1KAOA 3HKEB 2PJUA 1Q19A 1XAGA 3NP7A 4IJQA 4OMCA 1N3BA 4TRNA 2DSTA 1IBSA 3JXEA 2W2VA 3U4QA 4HL6A 2VQSA 1A8HA 3HCFA 2G9IA 3DC2A 2N3ZA 3OQIA 4FW9A 4OQXA 4PIVA 4Z7OB 3QVOA 4BFSA 2AOTA 4JJ8A 1WVIA 3QO5A 3OPQA 6AT1A 5K45A 3EZ2A 3UOAB 2R1UA 1N6HA 4N0QA 5TVGA 1ZUHA 3FAVB 4OXQA 2ZJOA 4DMRA 3AUUA 2CWWA 2YOFA 1ODFA 1WCIB 3G0OA 2ZM6B 2GSWA 2HJHA 4NMMA 4TX1A 4WKOA 3OD1A 1YSCA 2DHDA 1TVKB 1XRNA 3TE7A 3WFIA 4CUZA 2PGGA 1DHRA 2KG7B 3VYTB 4PV1B 2JBHA 4PGAA 3OJLA 3PE3A 3V6MA 4MT8A 1JIQA 3DSRA 3OEHA 3PENA 4RGBA 2I2CA 2MYTA 3GRVA 5B3AA 2RKWA 5C8ZA 1KSJA 1O95C 2VC2B 4REOA 4BC0A 2VQEB 3FPLA 5E2BA 4TV8B 5CLQA 4Q3LA 4S2UA 1CHNA 2B5OA 1ADFA 4LF4O 2IVFA 4UREA 4B5KA 4BZQA 4DCVA 2CV0A 3S3WA 3U0ZA 2BD0A 5K3BA 3SG0A 1DAHA 5B7PA 3LLUA 5KSYA 3FAKA 2GN8A 2BR5A 3CZRA 3OO0A 3PL5A 1XL6A 3TR5A 5G53C 3UICA 2C20A 4QPZA 4JI5O 2WAAA 2VTBB 4FUTA 3RRJA 3GDOA 3EF3A 4N7BA 2WPNA 5EZQA 2L26A 2PUWA 1Z4JA 2XSZD 3PE6A 4JEMA 2OCGA 2HYIC 1N34O 4KSYA 4CM3A 4GZRB 4W63A 1GTZA 3ZP7A 3DZHA 1AVMA 4FQ8A 4Z4IA 3ZY6A 5BR4A 3TGUH 5FH9A 2GPAA 5SY4A 1Y3IA 2V4UA 1CY0A 3QWIA 4BASA 4F4JA 2X42A 5K03A 4NNJA 2WWVD 5J5AA 2QUZA 3GVPA 1Z4PX 2FZVA 3UJ6A 2VSYA 1B6SA 1QBGA 2RGNA 3GLIE 4WJZA 1EWVA 1R3LC 1U5BB 1V4NA 3ABMC 2QMOA 3ORRA 4PG5A 4Q4JA 1U8UA 2D0OB 1Y80A 3RVKA 4PRKA 3L73H 4EO4A 1VCOA 1VPWA 4S0XA 1NZ6A 3L6UA 1TQ6A 1GPAA 4IS2A 4MB0A 5IY5C 2X5KO 1E1QD 2XJ4A 2QUKA 2JDIG 1U2TA 2R7KA 1RKUA 1ODEA 2VQDA 2AFHE 3MT7A 4XD7D 4O4HB 2B98A 5K4AA 5ADWA 1LVGA 5AKZA 1XL1A 3QPVA 2YHUA 1FJXA 2XGSA 1FD9A 4FKBA 3UXMA 1U96A 2H1CA 2ZIZA 1E6LA 1Q86W 2LQTA 2UYJA 1HG1A 1RQLA 3DNFA 4IDBA 4E5NA 1V6CA 4L5IA 2A1TR 7REQB 3QEJA 3K30A 4HI0E 1L4YA 1LD3A 1KNXA 2HBRA 4NCJA 4ZV7A 4QUGA 1KYZA 1P2GA 5JH7B 1W42A 1BZKA 1Y1SA 1ZGGA 1S7CA 3E18A 3HU5A 2W58A 1XU9A 2VXBA 2YYZA 3MG9A 3O4FA 1H6CA 2JBAA 2DJ5A 2Q1TA 3C6QA 4HQ6A 3MYRA 4IG4A 5GY7A 1GUYA 1U3VA 1V5EA 4RQTA 1KVRA 3LAWA 3Q2OA 5ENZA 9MHTA 3VFDA 1TECE 5ILQA 2FZ4A 3BA1A 3L40A 2G04A 4U9HS 4FZ0A 5U4QA 4DANA 3OOYA 2J31A 4PDVA 3WFVA 1LC3A 1TYCA 3ZV5A 3FJOA 3UYLA 5IKEA 1E1KA 1N33O 4GUDA 5SY9A 1NVPD 3HSYA 3C43A 4M9QA 1SOWA 2GD1O 2X9LA 1TJ4A 1X8XA 4BHTA 4GUAA 3QXJA 2ZUEA 3TD4A 1N2ZA 1EK1A 3NXSA 2AW3A 2X3UA 4KYVA 1G7CA 1L4MA 1ND6A 5DWDA 1AIPA 1YHZA 2PZLA 5JAQA 1NRWA 4QDTA 1NFFA 1W29A 5KNDD 3AVPA 3FOBA 4EUKA 3R9XA 1GRCA 1X19A 1FRQA 1ARZA 2D7JA 4KLNA 1E96A 3ICPA 3BQ9A 2JIZD 1GPBA 3K05A 1PL7A 2XD9A 4N48A 3ZMTA 4X91A 4OK5A 1XPOA 4MLPA 1DQNA 1NQ5A 3SJ7A 4CEJA 5K1PA 1T8UA 2HPAA 5PNTA 5EYPB 1SXGA 4UCOA 1VYTA 4R1QA 4AJNA 2J9GA 5FR1A 1OFUA 2AXTZ 5LC1A 4F4IA 3ILVA 1CUFA 4A73A 3I58A 5BRNA 3ZDXB 8AT1A 5ES4B 3QQPA 2E7ZA 1G38A 1FF9A 1NW6A 4R5HA 1YS6A 3F7TA 3UG6A 1JALA 3QM1A 4WFEA 4XVUA 4FTWA 4M0UA 4ZT4A 1MB3A 3EZLA 4Z7QB 3IKLA 1I80A 3WO1A 4C01A 4E5VA 3PDIB 4TL9A 1G63A 1UDAA 4I4TB 3ON5A 5A4JA 2CB0A 4YA6A 5LQMA 3BERA 2CE7A 4FC7A 3WVNA 2BZ1A 2XH8A 2GD6A 3DZBA 2IYPA 5IX8A 2FW0A 2NACA 3JALA 2AXQA 1FXVA 3IIMA 3KEMA 4HK4A 1XCMA 2F1IA 2P9EA 4MUBA 4HYOA 2XB9A 2YXPX 3P4YA 2NTVA 1Q7CA 4HLCA 2IZ0A 5HDBB 4ACBA 4AZSA 1J7JA 4L7VA 5A4IS 4WK6A 3D3WA 4PHCA 4OIFA 3RSQA 2R6ZA 4AJLA 2R6CA 1LR1A 2DWOA 4MVQA 1M1YB 3BWDD 3DV0B 4U7WA 2RCYA 4YC7A 4B46A 1NLFA 1UBSB 2J6BA 2Y9MB 4HEJA 4UEOA 4BP1A 4E09A 1A97A 1U8CB 1BJRE 1K06A 5DRYA 4D4JA 2R9AA 3I9V6 2OCHA 4P9OA 1FSGA 3P9SA 1CBUA 1SQGA 4QIWF 2AFVA 3AHFA 3D0RA 4IGIA 1I36A 5EJAA 2OYCA 3B8NA 2H51A 3ZLTA 2CHFA 3CX8A 3LNCA 4GFDA 5LKRA 1GGFA 2W7TA 4IF4A 2ZJ4A 2AG1A 3W5IA 1KECA 4A0GA 4BS9A 2RKOA 7MHTA 1D8AA 1J8QA 3DPIA 3OTQA 4JFRA 1WEKA 4JHLA 1Z2OX 1XQVA 1PLJA 1VCIA 2BLLA 4XB2A 2D7DA 2QXUA 2X6QA 4BWYA 9GPBA 3CLSC 1N9GA 2BFWA 3BYZA 3RT3C 2QL6A 3CNBA 1KS2A 3D0KA 3INGA 1A9QA 1T8PA 3X1KA 4F85A 5AVUA 3A1UA 1UPUA 2DOSA 3FNIA 2SKEA 3ZMUA 1R4MB 5DM70 5D3QA 5KUKA 1H42A 3UO2A 5T67A 1K4YA 1M2KA 3ZWVA 4K8XA 5JVDA 2BONA 4HAOA 4ZV9A 1LV8A 4TTRA 2DT4A 4BEJA 4OFZA 5E3JA 2I22A 4ZCPA 4Y0AA 2WA4A 2DPXA 5HXZA 2UXXA 1NJ1A 2HDNB 3AVQA 4NWIA 4ZHWA 3X2FA 3FB4A 4KX3A 4MAFA 4JYAB 5HFAA 4GICA 4W8GA 4EJ2A 1QVGU 2AZXA 2FW1A 1FVFA 4KN9S 3VPFA 1XMQO 4BBJA 4PSAA 1W41A 3CCSF 3JYNA 2QTZA 3GAMA 1L7OA 2Q6IA 1U9IA 1H1LB 3WNQA 3MWJA 1K86A 1UL1X 1WCYA 1R3DA 3T1YO 3M9XA 2XAAA 2XWBF 3H9QA 2NZXA 1QPGA 3FVVA 2NU7B 3II6X 5EXDA 3SJZA 4EYKA 2H1RA 3GYQA 1KFBB 3RIHA 1T4BA 4UXNA 3FI0A 3NBKA 4XJSA 4BFZA 2CV1A 3WOVA 1ZMOA 3TL3A 1VHAA 3BWXA 1YIJF 2IOHA 5IJWA 3WJQA 4HN2A 4MQLA 1CEQA 3WB0A 5IP5A 1O9HA 1AXGA 2Z8XA 2B1IA 1GZ5A 2GEJA 2GJSA 3HVHA 4G85A 4G84A 2IH1C 3C48A 3F5QA 1V55B 2WNHA 3DBVO 1IDN1 2HHHO 3T3DA 1N2CE 4O0MA 1XTTA 1EYZA 1QVWA 4BRZA 3QNEA 2ATIA 2CK3A 4FIZA 1OLOA 4Q4HB 5LYYA 3Q3GE 1X7WB 3BL8A 3VBEA 2I4MA 4B34A 5A0TA 4PXAA 4ZOAA 4QDZA 2GLTA 1FFXB 1V7ZA 5CIQA 2YWRA 2W8BB 3EXEB 4AT1A 1E64A 1V8PA 4TZ6A 3LFOA 4IRXA 1KC8W 1ZC3A 2AF4C 2Z8ZA 1E7MA 1XJCA 4J2TA 5TMBA 3T99A 4BN0A 3LD9A 5K0FA 4LAFA 3DBRA 1VL0A 3G2MA 5F51A 3VDXA 2QA5A 1H1LA 1T1RA 2EKDA 4AJPA 4AWXA 3BORA 4EJ6A 2Y48A 1IHYA 1XFDA 3I2HA 4MVJA 3ROMA 1BROA 4CLHA 4ZQIA 5JLJA 2Q3CA 2XMRA 4YPVA 3TR0A 1C50A 4RVUA 3L7JA 1KU0A 2QGZA 1PW7A 3S7TA 4BNXA 2OC4A 3FNBA 3UY4A 2UUCO 1WW8A 4MKZA 4D74A 3JVDA 2GZLA 1A7KA 3FFTA 3JZIA 4OFBA 4I1RA 5A5EA 5EZ6B 3ILXA 4HAXA 4QHYA 4DR3B 1JHOA 1K08A 4NBTA 3UCFA 1L0BA 5B30A 2Q67A 3HA2A 3PXCX 1SHZA 3FMOB 1U28C 4JLJA 4WNCA 5G4LA 3GBVA 4TKUA 2UYHA 1AP5A 2GTSA 4R2LA 2Z1FA 4RIIA 2AMYA 1G6UA 3NRBA 1KQSU 5CW1A 3RADC 2AJLI 3TMYA 3DXYA 3Q7IA 4FR5A 3THYA 3IAHA 3H11A 3QTLA 1Y9ZA 3UFXA 2ZK7A 3JVVA 4IWXA 4V02A 1LBSA 2Q07A 4BQOA 2AMLA 5KUTA 4M0EA 2DWDC 1MH1A 4KRYA 2P6YA 1E9FA 3FMIA 4EG4A 5D6OA 1USKA 2L19A 1GV1A 5LGUA 3IODA 4HWGA 3SXPA 5EMNA 5A0VA 2DWPA 4BGUA 3FR7A 4F21A 1CSEE 1I10A 4OUKX 5DIZA 1P1IA 3BULA 3VKVA 5DH9A 1R50A 3PT5A 1JV2B 4MI3A 4UKDA 4C21A 4DLPA 3EWIA 4GE0A 3OM0A 2W11A 1HTTA 1HDCA 1PLLA 1T9CA 3KPJA 4RBNA 1C9DB 3N3BC 1EHCA 5JJEB 2GN9A 5C0OE 3CPHA 1L5WA 4WASA 3Q0TA 4ZO4A 2BT4A 2FN4A 3X3HA 1GG9A 5TPWB 1E6WA 1UMBA 3ETLA 3QV1A 1A82A 1N5OX 1GO1A 1YS2X 1VYUA 2MSNA 3L0OA 5CLFA 5L3QA 1JQ5A 1MEJA 3PICA 3D7RA 2XNJA 2FJPA 3UT5B 1ZCJA 2GPJA 4MYHA 3RFCA 3NM5A 2PRZA 4P36A 4PHTA 4PO8A 4DM3A 3BIWA 4BQEA 4NE7A 3FSGD 3G80A 4DA7A 2EKPA 3ZQ4A 1L4FA 3E9CA 2PUFA 1A7UA 1XPJA 4J3FA 4H33A 3LDEA 1MRNA 3IOEA 5ALYA 1YJQA 1ZWZA 2OESA 3JQ6A 3E8HA 3KKQA 3R0PA 4RQBA 1YITV 2G7MC 5KO2A 3DZGA 5C8DA 2DR0A 4FYMA 1W47A 2F3QA 2A1UB 2H3HA 1IUNA 1JKXA 4F6RA 2NZUG 1WEHA 1R0XA 2I6UA 4UHFA 3X43A 4AZ3A 3VR0A 2BZSA 3MUOA 4DV1B 3VPHA 5HEKA 5IASA 4JI4O 3EGIA 4M22A 4KFUA 4QLBA 5FWDA 3G79A 4D7TA 2CVQA 3T2MA 2GTAA 2A7WA 2ZAUA 1PL0A 3AR3A 4I5DA 3O94A 4X7BA 3KSMA 4NENB 4MQEB 1WSDA 3TTWA 5BYAA 2J5QA 2DHQA 2I2DA 2AC4A 1AN9A 5BY1A 2EW1A 5CFQA 1QAHA 1NKDA 1S3FA 4TUYB 3GFOA 3PXEA 3SP1A 4LGVA 1B00A 3ZMSA 1U3TA 1RWWA 1JG7A 1WSWA 4NZNA 5JYDA 2C9OA 3VYVA 3BE8A 1JHVA 1FTWA 2V0CA 3R66A 3NC4A 4JJGA 2G08A 2P5UA 2P2NA 1G8MA 2P65A 2WFMA 3PSHA 1MC8A 1YB5A 1SBQA 2OQRA 2EF1A 4JH0A 1Y74A 3I2GA 4P4GA 2FTKA 3QO8A 3N2IA 2X0FA 4BEVA 5I7UA 1NQUA 4RWUA 1PP4A 2BFDB 5K0LA 1AHNA 1O97C 4NZYA 4ID9A 2GEDA 3BH7A 3NR2A 3BXPA 1QONA 2GZMA 1XROA 2IZZA 3L4KA 3BXGA 3KOWA 4IIDA 4N4AA 5JXJA 1PNTA 3I73A 4H1WA 1IRIA 2I8LA 3IHKA 3H8VA 3QKSB 1GHTA 4JLNA 4MVJM 4CTMA 4YK7A 3AWDA 1ZD2P 3P26A 1EZJA 1UKVY 4L76A 4C7UA 2HWXA 1CVIA 3WKDA 2JFQA 2D1FA 3AFMA 1JI0A 4XSHA 4U3JB 3QVGB 3TOXA 1OHHA 1Z0DA 1DKRA 3WOHA 4PLHA 4YP9A 3W5AA 2ZR8A 4PR0A 2EDAA 2WHPB 1UWVA 2X23A 3M5CA 4EYQA 5EZYA 3CLRD 1G0NA 2JAPA 2BCCH 3GF4A 1GA6A 3U11A 3AEUB 2ON6A 2GN2A 3ACDA 5BN5A 3NTUA 2QZSA 2O8CB 1Y1KE 2QM3A 3JD1A 3GROA 1GKKA 3QTTA 4F2GA 4CEIA 1QU3A 1HURA 2H4WA 4UD6A 1G1AA 4O4HA 1X38A 1LU9A 3UAVA 4ZCMA 4K0KO 1VPVA 3CCVV 3DMHA 4ZFNA 3OFVA 1W2GA 4GYCB 2NAPA 3UANA 3CZAA 4N5IX 4UZEA 1R7RA 4YRJA 4KIWA 4JAAA 5L95A 2SCUB 3PQFA 3OM9A 2YH2A 2JLAA 3OO1A 4ZHQF 2D3WA 1ZXXA 3EUWA 4D57A 3H84A 3QYPA 5I7WA 1QRTA 1O89A 3ON1A 1DTSA 1QK4A 2FZEA 1MX9A 1SGWA 1Z2AA 2Q3EA 4KQCA 3T4EA 1B23P 1Q91A 3AG3C 1YQWA 1ZL0A 3GT0A 2G6TA 3HFJA 3LFUA 4PQGA 3KCNA 5LXTF 1X0XA 4B4KA 3DCIA 5BYKA 3HWSA 4GPZA 5JMTA 5EA2A 2XKAA 3VPXA 1FS0G 4BIUA 3UK6A 3N76A 4LYFA 3VXKA 2DLDA 1HE5A 1XLUA 1ISJA 2PZEA 5GIOC 1E1YA 2VNKA 3BE6A 2A1TS 2H9AA 3R6DA 3KCXA 1VECA 4GMFA 2N1MA 4ZP1A 1CK2A 2OSBA 5E1MA 3RA5A 3TFOA 4DUYB 2WJZB 3SS8A 1V4BA 1OWMA 3FGZA 3ETJA 4BGIA 2V5VA 4BLQA 1GQRA 4BN4A 2IV7A 1DQPA 5C5DA 1CUEA 1RZUA 1DEXA 4FWBA 4BKMA 3H2YA 2Y4UA 2PLAA 5G41A 2OZLB 5CUQA 1NTOA 4EY4A 5CDFE 3H18A 3N8HA 5EGSA 2PSJA 3RRFA 1L4LA 2VA9A 4IUDS 2HA0A 4RETA 2ZJYA 4JJ7A 4OSOA 4QE3A 4FK5C 4II3A 3RUDA 4D9JA 1VGRA 1ZIYA 5DP1A 4PGMA 4DCGA 2Y0PA 1SNYA 1UOOA 3GVHA 2EX3A 2PBFA 3MC1A 5KKAA 1VB5A 4LWSA 3HY6A 1XRMA 4DR5O 1L3BA 3BTOA 3P2EA 1ZZEA 4HEQA 2QAGA 4MV6A 4WGFA 1H4SA 1G5IA 1K4MA 3DOEA 3IQWA 1XK7A 1LPNA 3RFUA 3PQDA 5E3IA 3KQKA 4ZK6A 3OBYA 4BMNA 4FM9A 3F5TA 4BNJA 2E4XA 2HVKC 1WXHA 2HH9A 3SIRA 5B57C 1CE8B 4QJIA 4J29A 1MR3F 4QU9A 1R1BA 1VM6A 5LL6P 3ASNB 2VAPA 2G4VA 3ZE2B 4Z7NB 3PFIA 1ZH6A 3CPQA 3BWEA 3LDTA 4TN1A 4LF6B 3M3PA 5K3SA 4YMGA 3HJUA 4LXYA 2WD7A 4I4NA 1YFLA 3GUYA 5JALA 1HW7A 1D03A 1JVSA 3AI1A 4RKYA 4RVDA 1DX9A 5H83A 3C14C 1SOAA 2L0XA 4NCNA 3S2UA 3USCS 3UXYA 3VO2A 3DMFA 9ATCA 2PLFA 3RSCA 3IAM1 5CDHA 3SYOA 4CL3A 4Z9XA 2VJDA 2GOYA 4IHKA 1YZQA 1GEGA 5ICSA 3FPJA 4IDAA 2PUDA 3VR4D 3AR9A 5DLYA 3UHFA 2Y05A 2HNKA 3DDOA 5T41A 2H48A 4RD6A 1BX3A 1N2BA 3DG9A 2PU7A 2LGJA 4QXRA 4V1CB 4EG0A 2AGVA 2RK6A 4INAA 4KXNA 4FCVA 5FBRB 3JAWB 2JFFA 4B4OA 1DQSA 2QRHA 3NGMA 3VZDA 2BC9A 2Y3IA 2ET6A 3AVUA 1FYJA 2GB4A 5TX7A 1DEHA 1SQSA 4O3FA 2AJCA 5DI3A 4F86A 3HP1A 4L8YA 5JNWA 3IMGA 1C2TA 1ZGZA 3B51X 2WKPA 4FGZA 2BFFA 3AVWA 2VK8A 2ACEA 4F9GA 1B0ZA 4JAUA 1RAGA 5SICE 5THQA 3FFWA 4D4KA 3GXBA 2XT6A 3K0SA 3B52X 2IUYA 3HDVA 4QIHA 4XLTA 5DEDA 4AJOA 3G2QA 3GBPA 2WK1A 1ST2A 3UWKA 3NVIB 4MTXA 3EARA 1MABG 5YASA 4PNEA 3CWQA 2HD4A 2JGDB 3T1HB 1YZ3A 4HYTA 4OMUA 4Y6PA 1G18A 2G9VA 3E27A 2DFNA 3CC4V 1GZ4A 4GWGA 4MWDA 3SYQA 3SR0A 1L5NA 4X9QA 4FYXA 1XTZA 1YE8A 4LY3A 2KB0A 2XGMA 5J4YA 4P0QB 1GGEA 3KV1A 2R9RB 1KD1H 1EM6A 3N87A 2B7BA 3O93A 3TLCA 3IA2A 4WT7A 5B6PA 2ZR0A 3L46A 4OSEA 2VP4A 3MJTA 1JN0A 3H1AA 4YQEA 4O59O 1OR8A 2QLJA 4Q39A 5K6RA 4O3MA 1SC4A 4UPEA 1FXWF 2G4CA 1B0AA 2PUAA 4R1UA 2B4AA 4KPUA 3U37A 3G6BA 2EQAA 5EG5A 1DJOA 4GHWA 5CDSA 2V6MA 4Z3OA 4HVAA 4ZI3A 4HATA 5JATA 3AIIA 2B25A 3I42A 3Q40A 4LHZA 1GUAA 1U3LA 1OWNA 2P0AA 5KWSA 1SIWA 4RFSB 2OHHA 5TVKA 3PC8C 4C88A 5IMSA 1A04A 1K6IA 1NT2A 1NU1H 1G7SA 1RI3A 2BI8A 1H4TA 2IF0A 2CKDA 2TMKA 3FUUA 1THGA 2E48A 3GVIA 4OYRA 1MQSA 4WOBA 4ADSG 4XVCA 1Z6YA 5BRAA 3QFTA 1UC9A 3GEPA 3A3NA 4WKGA 4NQ3A 5F78A 2BJHA 3SXJA 3M1LA 4M8IA 2OBFA 3L84A 5CFLA 1QK3A 2NVWA 1W4RA 3MCVA 4E13A 1RPNA 4RKFA 1OKKD 2ECPA 5JPDA 2FK7A 1QORA 4P4SA 4F06A 2GEFA 4KXWA 2ZE8A 5LIRA 4JDUA 5LOVA 3LWQC 3P3NA 4K6FA 5AM2A 5LJLA 3HE3A 3OIWA 4UUMA 5D85A 2QJFA 3VNUA 1A4UA 4UBIA 1I7NA 3GD5A 4I3GA 5DLDA 3QIAA 4EUEA 3ICQB 2L18A 1D09A 1DAKA 1P3JA 2EIXA