4ZI7B

Crystal structure of tubulin-stathmin-ttl-hti286 complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 168
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zi7B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zi7B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zi7B01
3N2KA 4ZOLA 3JASA 5BMVA 5CB4A 5EIBD 4ZHQA 4O4JA 5EIBC 3WGMA 4X1IA 4I55B 4LNUA 2VAMA 3JALB 1FFXB 5CA1B 5IYZB 5LXTA 4DRXA 3JAWA 1RLUA 3R4VA 4XCQA 4M8IA 3WGKA 3RYIA 4YJ2B 5ITZA 2Q1YA 3HKEA 3ZIDA 5LYJB 4IHJA 5JQGB 3RYCA 2RHOA 4X1KB 4YJ3A 4O2AB 5JH7B 4X20A 5M7EA 1SA0B 4TUYB 4X1YB 1TVKA 4F6RA 1W59A 4U3JA 5KX5B 1W5FA 5J2TB 3HKBA 5LOVA 3M8KA 5C8YA 4TV8B 2BTQB 3HKCA 2VAPA 3E22B 4FFBB 1W5EA 5GONA 2BTOA 4TV9B 5JVDA 1Z5WA 1W5AA 3JARA 4HNAA 3RYFA 2Q1XA 4O4IA 5CA1A 5IYZA 1OFUA 3M89A 4YJ2A 3WGNA 3UT5B 4IIJA 5LYJA 4ZI7A 4E6EA 4DXDA 3V3TA 3RYHB 5IJ0B 5EYPB 5IJ9B 4TUYA 4EB6B 4WBNB 3ZBQA 1JFFB 4O2BA 5KX5A 3JATB 4I50B 2XKAA 3N2KB 4ZOLB 3JASB 1TUBA 5EZYA 5BMVB 5CB4B 5J2UB 3N2GB 5JCOC 5LP6C 5FNVA 3E22A 4FFBA 5MN6A 4O4LB 5LXTB 1W5BA 4DRXB 3JAWB 4I4TB 5LA6B 4EI7A 4I55A 3RB8A 2RHJA 3WGJA 3VO9A 3JALA 3JAKB 4O4HB 1FFXA 3HKDB 4YJ3B 4X20B 5LP6B 4EI9A 5CA0B 5JQGA 1TVKB 4X1KA 1RQ7A 4O2AA 5JH7A 5KMGB 1W581 2VXYA 5MN4A 5IJ0A 5LOVB 5EYPA 2R751 3VPAA 1SA0A 4EB6A 4WBNA 4X1YA 3VO8A 4B45A 3HKCB 4I50A 5J2TA 5GONB 3WGLA 5JVDB 5J2UA 2R6R1 3N2GA 4ZHQB 4TV8A 2BTQA 4O4JB 2RHHA 3JARB 4HNAB 4LNUB 4X1IB 3RYFB 4O4IB 4KWEA 4EI8A 2GVIA 4O4LA 4TV9A 2XKBA 4I4TA 5LA6A 5MN5A 3VOAA 3RYIB 4IIJB 5ITZB 4O4HA 3JAKA 3HKEB 3HKDA 1FSZA 1RQ2A 4IHJB 3RYCB 4U39A 4ZI7B 4B46A 5JCOA 2VAWA 3UT5A 5LP6A 3ZBPA 5CA0A 3C8LA 1Z5VA 4F6RB 4O2BB 4U3JB 3HKBB 5KMGA 1TUBB 5EZYB 3RYHA 5IJ9A 3CB2A 5C8YB 2RHLA 3VOBA 1JFFA 3JATA 5FNVB
chains in the Genus database with same CATH superfamily
5KNBA 2ZDQA 3HR8A 1NUUA 3V3KA 4TZ0A 4UBJA 3VR6H 1SXHA 2V7XA 2YV3A 1ILEA 1R0RE 5LMUO 5DYWA 4BNVA 5JYCA 2Y1OA 3ICOA 2R11A 4PDLA 1RLGA 2JI8A 1W6UA 2WOJA 4TQAA 3ESBA 1ZH2A 2XNDD 2QSZA 5IF9A 3AG4C 4FE3A 4DZRA 5I7SA 2GDSA 1NJ2A 1HDOA 4DV1B 3G4SF 2XYQA 2O59A 3L84A 1RFYA 3Q7PA 1W76A 2O0LA 4K0KO 4BMCA 1LNZA 1CW2B 3MLBA 5EXTA 4EUKA 2P5TB 1TIKA 2WHQA 1J23A 2A3NA 3NFRA 1CHNA 2LPMA 5AI6A 2VK8A 1E7SA 1TPZA 1NQVA 3HN7A 4NONA 3AEUA 3K0KA 1T2EA 1JVMA 3WK6A 3CV3A 3WI7A 1WU7A 4GKAA 2WSMA 1QPZA 2IV7A 4U1RA 4L15A 3J80N 2QW0X 1CQPA 2DFDA 1U9CA 3G2PA 5LGTA 5BPHA 3AYZB 2ZI3A 2OK7A 3H5IA 3QEKA 1KAEA 3SDZA 5DBFA 3U2QA 1PJRA 4JL8A 3VRHA 2Z6QA 5HKOA 1STOA 4DAOA 3ISVA 1SJ9A 1XZNA 4AZWA 4PAOA 4K9KA 3QJYA 1A8QA 1AV6A 2R72A 1KPIA 1W44A 1HO3A 1YFJA 1XFAA 1AI7A 3R5SA 1VKJA 2ZIFA 5HR5A 1I7NA 3C6XA 5GV7A 3C3CA 4MI9A 1K6XA 1GZSA 2X5OA 5KKNB 1LVGA 1Q1BA 4XUEA 1XZAA 3A4VA 1TF7A 1LNQA 4YJGA 1OR8A 3D02A 2VJBA 1LUAA 3VHRA 1E1RD 5TQ2B 4X1KA 1SUWA 2WIJA 3VVBA 4EGCB 4XSVA 3CGWA 2PT5A 2K2WA 2PX8A 4JSRA 1U3FA 3TLZA 4FMBB 4UFPA 3L02A 3AK3A 2OHOA 1E4VA 4BN0A 3CF6R 3IERA 2I03A 4E88A 3GOHA 3H5TA 4RQTA 2H7XA 3T2MA 4TV8F 1NQAO 5JEEA 4KAJA 1JU4A 1XWWA 2BGTA 2YDXA 1FDOA 4LYJA 3C7CB 3IS3A 3EBLA 4PX3A 4DSZA 1Y4AE 3IR5A 1SXJD 1I5EA 3R5TA 2QVXX 1KYVA 1FU8A 5CTAA 3ZEAA 4LOHA 2R70A 3E7XA 3R2JA 3V7UA 5AOBA 5H16A 3FYSA 1MX9A 3C48A 4MGYR 3T4XA 3O91A 2XZDA 4LOLA 4WXEA 4MYRA 3GLFE 5EJ2A 3KT3A 3DVAB 3ESAA 4RKYA 4W4TA 2CFOA 1BQZA 4LJ5A 3VQVA 1I2AA 4E2LA 4DBVO 5FLKA 2WJJA 1GQYA 1L4NA 4E46A 1FNBA 3E8MA 4P4SB 3QY0A 2C2AA 1VA4A 4TOIA 2H59A 3KYCA 2EEZA 4RLSA 4DCPA 3DBRB 5DKFA 4DLTA 5KOIA 2DUJA 1FSPA 3S44A 3NHSA 1GRQA 2V6JA 1AGNA 4WEOA 2VUTA 5DE3A 3SKVA 3T38A 3ACDA 1QQTA 2DT5A 1COWG 4K9NA 1KFCB 1MMFB 3UHOA 4WNCA 1PL0A 2HYIC 4WBNF 3OKAA 1PQ4A 4NOMA 3VH3A 4E11A 4PU0A 2JVJA 2ZJAA 4BGEA 3MERA 3KJHA 3T9EA 3WLLA 3NMUF 2QE6A 3BWYA 3CCFA 3B1FA 1XDZA 4NK5A 4CODB 1H48A 5JD5A 1R15A 4LJAA 2QMOA 4HDMA 2NZ2A 5JPDA 1OPXA 2FN4A 1X7WA 4AO8A 4OQXA 3T52A 5FL7D 1AN9A 5EQFA 2R6GA 5DTEA 5IAOA 4PQGA 2QLMA 3IIKA 5AUOB 4Y7DA 3RYTC 1VB5A 2X8JB 1K8AW 3GJ6A 1B6SA 1DS6A 3SFTA 1E2UA 1LJUA 3SPXA 5ALUA 1VG8A 4PYKA 4RTPA 1DZIA 1AJNA 4R1SA 1W73A 4JJGA 1S0UA 4G4ZA 1YKGA 2YV1A 2ZRDA 3EF0A 1O8BA 1XJCA 1XDDA 3ANMA 4RMHA 1EK1A 4OQPA 1IHDA 3G2OA 2HR1A 1QNLA 4M6WB 3KR0A 2H9AA 4NQZA 4C81A 1N3LA 4JLUA 4TMVA 2G4LA 1RYEA 5B58C 2J7PA 3PUYA 3D59A 4N76A 4ZI2A 2XQKA 1NVVR 4ZVTA 2ZFUA 4CMIB 5AW5A 2V6GA 3DAFA 3OEHA 1Z0FA 4BT3A 1X9HA 4PZDA 2YRFA 3CQ9A 2PMCA 4NXMO 5EJ9A 2RSLA 1JAZA 4X1YA 1NOKA 5KA5A 2KI5A 1RXEA 4Q9KA 1NUAA 4WXHA 3S99A 4AAYA 3QO7A 2HLDG 4K9PA 2EU8A 1Z37A 1LDMA 1XHLA 3IOYA 5AHXA 3JAKA 3GLGA 1D6NA 1YBMA 3FDFA 1J97A 4CIVA 3H8WA 4ETMA 4Q18A 1G8JA 3AEQA 4OHRA 4L5BA 1IRIA 3I6BA 2P0YA 4EMSA 4LHSA 3SC2B 3UTDA 1XF1A 1GOTA 3IUSA 1J8YF 4DEXA 3Q8XB 4FZVA 2QP4A 2W2TA 5JD4A 1NT2B 3CWCA 3ONWA 1Z07A 1IPFA 5H82A 1MB3A 2CVPA 1UH5A 2Y77A 3N70A 3TLGB 5C32A 4RO2A 3NV9A 3MT7A 5IJ0B 1PT5A 4WASA 3CMEV 3HN6A 5ITSA 1NGSA 1XZCA 1U99A 3QXHA 4CRWB 4DLBA 1GLGA 221PA 2DFKB 3G8AA 4DEVA 1XT6A 1YE5A 1BZKA 3LV8A 3JSLA 1UZLA 3A0RB 3PC8A 3QGMA 1DKPA 2QTWB 1SBHA 4MEBA 3HI6A 2Q2VA 4FUQA 5KKAA 1MB9A 1EFVA 4XVUA 4XVCA 4X8AA 2A94A 4MVJD 1I10A 1G5PA 3WAGA 2W6QA 1Q7BA 2HQBA 3ZGVA 3PHLA 4CEJB 1FQWA 3RTAA 1N2XA 1HYHA 1K4MA 2OXIA 4A5OA 4BXOB 3WL5A 1T9KA 5G02A 1M74A 3LSTA 5F7ZA 3B9QA 2C5LA 2NUAA 4C4SA 3MAJA 4Z9XA 1GR0A 2IU6A 5AYVA 3W8FA 5KOJB 1NDQA 1XQWA 4LMRA 3CG4A 3DUWA 5L51A 3CYQA 1ZLYA 5DSTA 4NBNA 2D2EA 1ZK4A 2QLJA 1Z4QA 5HCUA 1S2DA 1WNFA 3JSAA 2CUKA 1PWHA 1YU9A 1NI5A 1RLOA 4EF4A 3AEYA 4NMHA 2W2PA 3UYLA 4OGFA 2XRZA 1LLQA 1MW8X 3LL4A 5IC6A 3M49A 4DUZB 5A4MS 5G0WA 3LKZA 1Y5NA 2IHJA 2ODMA 4UB6Z 3WGLA 2AJDA 4MKXA 2WU3A 1WNTA 3TETA 2H4JA 4BWVA 1U7WA 4MUNA 2VHCA 2G36A 3CR8A 3KR9A 4RA9A 4PR3A 4K26A 4YRMA 4XSGA 2REQB 1M1ZA 2VQSA 4LF4O 1PZEA 2DPXA 4F46A 2Z6AA 3ND5A 5BV1A 4CIXA 5FUMA 1AM4D 2UUOA 4AU1A 3OTFA 5DSXA 3WYDA 4DIUA 1U1FA 3H0KA 1P0CA 1H93A 3IAAA 4TKVB 3W2GA 3TQCA 3DLCA 2XB6A 2NMUA 4HXFB 3W4KA 3ENKA 4PQYA 4MVMA 5A7FA 4R6XA 2E3JA 1YAJA 2I65A 1ZM7A 4V0NA 5ALJA 5ERGB 3K32A 1IB6A 5D87A 4MTGA 4K8OA 2GVNA 4PY2A 2IHTA 1NS1A 4BFLA 4N8DA 1CF2O 2ONJA 5B1AB 3B4SA 4GX0A 2YRXA 1AF4A 4C01A 4MVJP 3A6KA 4ZCIA 3VOUA 1K8XB 4YRBA 4JA2A 2WHPA 2ZYSA 5D3MB 2BEJA 4RU1A 3RVOA 5IN4A 1GZ4A 4EY6A 1ZUNA 1ZI6A 4TZKA 3C3MA 2QRKA 2XZLA 2V7BA 3BTSA 5DGCA 3NBAA 3S4YA 2PUWA 2ZZNA 2OXTA 1RE0A 4QRIA 1EBOA 3H9UA 4IEFB 4KKVA 2PUVA 3RFRA 4ILEA 2QUIA 4ZI7A 4BO7A 3OLVA 1RADA 2ZKOA 4UW9A 1JEAA 2AFIE 3JWIA 3NXKA 3BMOB 4EATA 3QFTA 3A7DA 3T4EA 4WLUA 3IVXA 4F04A 3H5LA 5FPRA 4DCJA 2O2ZA 3CS5A 1YFLA 1Z13A 1CE8B 2F17A 3OZ7A 1XLTC 5LKRA 1L1EA 3ET4A 3O5AA 4Q02A 4ACBA 1ZBQA 2P9EA 4XFKA 2I2CA 5L6LB 1T9HA 3FOCA 3L4EA 4JB8A 1OU0A 1U65A 1L5OA 1JSZA 3GFVA 2VCHA 4COOA 4P81A 2NU6A 4RA6A 3HKEA 3LC1O 2ZSKA 1PD1A 1DGQA 4PC2A 1BJRE 3MPOA 5AM4A 5AESA 4EA6A 1PV2A 3C87A 3NEYA 1OB2A 1ZXBA 3SJAC 4N8EA 8GPBA 1G66A 2UYYA 3VHQA 4Q7EA 2WZCA 2YYAA 3AESB 1PW5A 4JI4O 4UU7A 3MWLA 1YHZA 1AB5A 5CEFA 2PCJA 4M0CA 1CTQA 3TVYA 5H8WA 4PJ0Z 5D01A 1NYRA 5HY1A 5C51B 3PHJA 3GJ5A 5EZYF 2JVDA 5DCLA 5KYGA 3QFCA 3GMSA 4F84A 1YD7A 1IK4A 2W6JG 2GD1O 1IY1A 1XTJA 5JAIA 1N6NA 1FSFA 3SLGA 1VCOA 4ZTUB 2WPDD 3QLJA 5T4EA 5K8IA 3EARA 4YACA 1RRGA 1R6DA 4PGMA 2QKCA 1YGPA 4I9FA 4E7PA 2DY0A 1RSZA 3A2KA 3D1VA 1KSGA 5GZ1A 2ONZA 4NV0A 3A1VA 1QS0A 1CZHA 4HGYA 3AVVA 3P9CA 5CYPA 3C5CA 3DDSA 2AMTA 5IX8A 4CQJA 4UHDA 3LCVB 4JVNA 1UC8A 1FP7A 2N04A 3SZMA 4FDTA 1CR4A 3L6OO 5AQ1A 3K79A 4ZJUA 3BXEA 3O8NA 5JJJB 2JHFA 3NBMA 2M7WA 1EJ2A 5COBA 1ZL8A 3F6PA 4FLWA 3GP3A 3PQ7A 2E5FA 4S0ZA 1EH5A 4BFVA 2BGLA 3QKTA 1ZAUA 3W5VA 1W42A 4HLDA 2J41A 3QIAA 4CMBA 4EELA 3ZCCA 1RKUA 4NNJA 1HRDA 3H1LH 1MQAA 2HR3A 3WTBA 5F2EA 4BUJA 3OTWA 1SVWA 4PS1A 4ZK7A 3UV7A 5LL6Y 4P7JA 4PZEA 1AMOA 2Q7HA 4M1QA 3BZBA 4QYWA 3S1LA 4XR4A 3EG9A 4XIIA 5AJHA 3GH3A 3OE5A 2RQ6A 1WSDA 2XE7A 5FO1A 1IHPA 4ZYUA 1U11A 3AZQA 3TXQA 3NGLA 3BF8A 2AMJA 1IUOA 3CKKA 3M7IA 1FS6A 3DLBA 2AG1A 4BVRA 2YX1A 3AZPA 4KI7A 1A8UA 2DFTA 2JGAA 4PYRA 5FIUA 3ZDFA 2GEBA 1GTRA 5CCXA 1NW6A 2PKQO 2GWRA 2CMGA 3KV3O 1EK5A 1YAHA 1JJIA 5KCMA 3H5NA 1GN8A 3LJKA 2UXCB 1RXYA 3EDRA 2JFUA 9ATCA 1JF8A 5FOTA 5DZSA 1G8HA 3PFCA 2PS3A 5CM9C 1UK6A 3REFA 4JJ7A 4CIAA 3ELDA 2HK9A 1N2ZA 4GRDA 3MBOA 2AMYA 2YHIA 3DW1X 1J25A 4YJ2A 2DHRA 3NDIA 2VTEA 1WB7A 2BC9A 1DQRA 5KTOA 3LCMA 4R0MA 3U13A 3P3NA 4KTTE 4QA9A 3GVHA 1UJ2A 4XQEA 4ZO7A 3BSFA 2AE1A 3OGIB 4RPHA 1BE3H 1JKIA 1JG3A 1YJWV 3QTCA 1WF3A 4AO6A 2I6FA 5DLPA 4E2WA 4LR3A 1BMFA 3NGXA 4N4AA 1GXSA 5JVDB 2J4DA 2J5XA 4H37A 2FPXA 3NOQA 4BOYA 2Z1MA 2GXUA 4MWOA 1SKQA 1QV6A 3AHGA 1YZGA 3DP9A 4L6IA 2H18A 2VHWA 2BH9A 4DDVA 3O75A 3MRVA 5TT1A 3Q98A 4XJXA 1PK9A 3GRVA 1M6VA 1VQ4F 2CTQA 4FFDA 3CM0A 3G4SV 1BXRA 5BW4A 4J6FA 1GJRA 4QASA 4FINA 2C2MA 1I7SB 1T1SA 2X14A 4KE9A 4FFLA 5A5DA 4R1UA 2EZTA 1E7MA 1NXSA 1N7GA 3HO1A 3ADPA 2Q4PA 2HRUA 3FB7C 3OKFA 4AJ2A 4DSUA 1UJNA 4RD2A 4I4IA 5J43A 4ASUG 2GA9A 5E3JA 3UAYA 3MPUA 5EIHA 4UTPA 4IBOA 3K6SB 3E7PA 5BN1A 1KEWA 4GBGA 1E7RA 2W2LA 3GRYA 4CCSA 1URPA 4MQFA 4EBBA 3QVNA 2CFSA 3E7FA 4KTVE 4IYRA 3ORSA 3PRJA 4JYMA 2ZPUA 5E4JA 5BUZA 3ZZ0A 1KNQA 1THGA 1E9SA 4TYMA 4CG2A 3JVDA 2ZCUA 2G9ZA 4LRYA 5KOHB 2PKWA 3Q40A 1P2FA 2D0PB 4R2HA 1QFSA 3BIFA 5LCXA 4XE5A 1JLKA 4YHBA 3HCAA 1ZA2A 5JYBA 4MVUA 4GL4A 1ZR2A 3GWZA 3QPBA 1RW4A 2WLLA 1FYEA 3NWJA 3FMGA 2SCUB 1U6KA 3TD3A 3HWSA 4A3SA 3HFGA 3D3KA 5LBTA 2O3JA 2FLVA 4KQKA 5LZ4A 4KP7A 1RWMA 3SIXA 4WOBA 4UMFA 1DFGA 3NETA 2P0AA 4Y2GA 4OB6A 4ZHWA 1VDZA 3KELA 3JS5A 3TJTA 3OQIA 3K06A 2PRJA 3P2MA 4P2ZA 2JCVA 5FBQB 5H4GA 4EZBA 1NJ6A 5CB6A 1V5EA 3BIOA 2NTNA 3M9XA 2HJRA 5C4GB 4K0KB 2AV6A 5EWMA 1KH3A 5KKCA 3M33A 3BZUA 4RGQA 3MC1A 1NW7A 3FNHA 4TXMA 4REQB 1HPLA 3EXFB 2B94A 3VHXA 1J5XA 3A9VA 3FNEA 4K2HA 2VQEO 3IXLA 1JHOA 4XPIB 1XMXA 4LJ4A 1J09A 4MGZR 1HE5A 5JADA 4CLEA 2EZPA 2ZANA 4NZNA 5I9IA 1VLHA 4FZ0A 2PS1A 1OYWA 2P06A 2OLJA 4HB4A 2H2FA 1NW8A 1TUGA 5KHGA 3K8ZA 3TQRA 1YF3A 2GYVA 4Q7KA 4L74A 1IBMO 2DFPA 4NCAA 4O2BA 3IQHX 3O1HB 5JAMA 3GTZA 5IMSA 4DT1A 1NW4A 4CC6A 4WE3A 1XK7A 4B7CA 1JG2A 3H0EA 1E5LA 3ZE2B 3S8MA 2JIZD 4INZA 2F8LA 2Q7OE 4R40B 3WMFA 4BMDA 1NJIH 4XWOA 3NIFB 4D9MA 3IEWA 4YRIA 4WNAB 5IKMA 4B79A 3ED5A 3HJBA 2PWPA 3F6RA 5JZOA 4GIBA 3AFGA 1ID8A 1NVPD 3KV1A 3HKDA 1VSUA 3N53A 2EKLA 4FN5A 4GMFA 4Q01A 1SC1A 1PEAA 5B4VA 1QG2A 5JZVA 3CZ9A 3L93A 3Q5EA 3A32A 1C1XB 2OWDA 2FWMX 1PAUA 3MHSC 2H4WA 3ZRWA 1SG6A 2WPNA 3IE0A 3RSZA 3PP8A 3LHDA 2ET6A 1HDRA 4O2AB 2VZ0A 4KRXA 3Q88A 4HQRA 2AH5A 4FNAA 3I62A 1XZGA 2NSHA 1D2RA 1HQYE 3ASZA 1OI3A 3FFXA 3ZDBA 1GFWA 3Q3VA 5KTSA 2KLHA 3NV7A 2FMHA 4I1VA 3I92A 1JFTA 2IPOA 3U6BA 3C5WP 4MVJF 2AFIA 2ZOSA 3GFOA 1BXGB 3G9TA 4WD3A 3W5UA 3RS9A 1QBGA 1R4NA 1K88A 2XUMA 2JAUA 4BFWA 4LISA 1GGKA 3ICQB 3KOUA 2GZLA 1EJ0A 4QELA 3IV9A 3OIWA 3AETA 1Z6YA 3MDOA 4M4SA 1PSDA 3VZQA 2BSXA 2YN4A 1GNQA 3DZGA 1S1CA 1EHYA 1RPTA 1O0BA 1AD2A 3SYTA 1TLLA 4B8WA 4PV7A 1P49A 1PNTA 5EESA 1H23A 3Q1LA 1RYZA 2YQ5A 4W5WA 2IFTA 1XDBA 3W7XA 1P91A 3NR2A 1CQZA 5AW2A 3K53A 1C8LA 3SEFA 1RPRA 3ASOC 2ZRHA 1W0KA 3RU7A 3IDQA 4U3JA 2MSDB 4N8SA 4EZEA 2NACA 1NX6A 2NG1A 5JYDA 3HEAA 5THQA 2HB6A 3PICA 3Q9LA 3TLYA 4FYJA 3UTCA 3H83A 4JBXA 1M0TA 3QF4B 1B3RA 3IBYA 3KTOA 3BRCA 4YO7A 2P4VA 3LC0A 2IYFA 3PPWA 1H1LA 4KAAA 2O8FB 1XTKA 2IKQA 2JH3A 5AICA 3QE0A 4DNXA 5JNTA 2B98A 2FFRA 8AT1A 5L3GA 3D1JA 2KLBA 4PA3A 4NS4A 1S3SA 5HSGA 5CURA 4P2GA 4OHXA 4RKQA 4C87A 3RYIB 2BE3A 4C7KA 2WMDA 1OX4B 2DPMA 4F6RB 2GK7A 2IYNA 1UFKA 2WTXA 1LDYA 4LE2A 1XMJA 1IUKA 3E3AA 3KVOA 3HU3A 3KCNA 4GWLA 2F3QA 1DDIA 1O6CA 3B7WA 3J81A 4ICGA 5JSFA 3FB6C 1Z5WA 2Z1EA 3M3DA 4EWLA 1QRSA 3ZCSA 1OCZC 1Z0AA 1Y0BA 5H6QA 1VTKA 2XUJA 5IVDA 5D85A 1XUOA 3WP1B 4Z53A 3V9PA 4Q7JB 1ZH0A 5KYKA 1YJBA 1BC5A 3ZH2A 5LOVB 2ZRQA 5JAHA 4AJPA 1LX7A 4KN5A 1I2BA 3MFYA 3BAAA 1WBBA 1PWZA 3AB7A 5IAKA 3STXA 1A5BB 4S0XA 1LV8A 3KDSE 2RC6A 2XVZA 1JLMA 3JQEA 4FDAA 1TC1A 1ORWA 1QJ4A 1TW3A 3J81N 3PDUA 4LTMA 3VISA 2Q6LA 5ELMA 5A6SB 3I42A 3BIWA 4L5CA 2P6PA 4NXMB 1RAHA 4B4OA 1D5NA 2W6NA 5HIJA 4IGEA 3Q9UA 5JH7B 3ENZA 4MPRA 4RD1A 2CXHA 4QUBA 2YJZA 4R1TA 5C9ZA 4PQFA 1P5FA 2PSHA 3OEWA 2R62A 2YOHA 1OFUA 1ULUA 1PFKA 2BSKB 3GWOA 4UAJA 4UM7A 5DX8A 1XQYA 4WRRA 1WUIS 3AUUA 5BURA 1UJBA 1U5CA 1H3EA 2OBBA 3NVIB 3VVMA 4C78A 3ZQUA 3LCCA 2FPKA 4XA8A 1NNI1 3K09C 4LYDA 5KU7A 1GM8A 3LUKA 3RKSA 3LLVA 3SG0A 4EBFA 3K0HA 2X0RA 3GLFB 2YMMA 1K9MH 4P3OA 1RHJA 2ZIZA 4Z7QB 1G38A 4ZQGA 2AXQA 3AXSA 1V25A 4J90A 1Z45A 3UWDA 5EZQA 1KY2A 3WHIA 2CNNA 4M1MA 3SR2C 4TT3G 3GXBA 5LMZA 3UUFA 2YVLA 3L0BA 2ALEA 2G83A 3DVAA 3G0HA 3ZCRA 4JLPA 5LYJB 1Q22A 1T2CA 3GVIA 1QZZA 5FWAA 4XPZA 1AK9A 4P4SA 2PRIA 1HH4A 1L7AA 4MP6A 3UVEA 1UT6A 4RVSA 3DBRA 1NM5C 4ESOA 3W9UA 4MWBA 2OP1A 2TECE 5K0FA 4J16C 4IDDA 4KR6A 3TKLA 3VX3A 1HP8A 4JXJA 2PKRA 3TDNA 1DE0A 3FCCA 4KQWA 5KA6A 1DIOB 1ZGBA 3U44B 1RVV1 3FSGA 4U9UA 5KEIA 4ZC8A 1Q81H 2QYTA 1Y37A 1CWUA 4J0EA 2QMQA 2QRZA 4CMEC 2XTJA 1YUMA 3NBQA 3S2GA 1T4BA 3EJWA 4NZPA 5AVVA 4Y1GA 1FDWA 3H18A 4FDLA 3D54D 4FCCA 1SU8A 1YMUA 1II9A 2XUIA 1V11B 5LZ8A 5LFAA 3ASOB 3DDNA 1ETUA 4QVKA 3QEOA 3FVTA 2AC7A 3A7EA 2PJRA 3S5JA 5HM6A 1A71A 2EARA 1Y3BE 5DNAA 3UJAA 4G8DA 3GFGA 3V6LA 1AKUA 1NBEA 3R8FA 3D8HA 4OKSA 1V8BA 1TMYA 3WGOA 3IJ5A 4KXUA 1CY1A 3VR2A 3Q85A 2NPIA 1U8UA 2X8JA 2JLSA 3KQOA 2ADMA 2ATEA 5EE9A 4XGKA 1I6KA 2B4AA 1J5PA 1EVLA 2P65A 4EX6A 3B7PA 3E9RA 5IKXA 4HNSA 4QSHA 2IUYA 3QX8A 4C5AA 1JKXA 2GD2A 2AZTA 1OOEA 5I4CA 3DVSX 3MTAA 3PB3A 5A5FA 4LYYA 4CMCA 4ND8B 3D7RA 4B09A 1Y7TA 1T13A 1PL8A 1Y81A 4ZU1X 2EJTA 3TOZA 2GVDC 5E0OA 1PWYE 2P1RA 2FFJA 4TWAA 3T61A 1K4YA 4YHHB 3OQ6A 4BVEA 3T1OA 3U3XA 3F2VA 2WP0A 2OCHA 2HU8A 2DQ4A 1OCZB 2X7HA 2C61A 4P32A 2PJDA 3KPWA 4M0FA 3AL0C 5TR9A 5JMPA 1NSYA 1SULA 2FMIA 1QLWA 3R5FA 3PDIA 3L7QA 4TUYA 4LVOA 4ESVA 4QXQA 4FMCB 3HBFA 4LDNA 4DLUA 2IE8A 1L7QA 1GSAA 2L6LA 1JS1X 3KXKA 1MB0A 1DLJA 4FGUA 3G0IA 4K6FA 1NT2A 4KN9S 4J42A 4ZU6X 2PMEA 3OX1A 1H6BA 3F49S 1NH2D 2G17A 4QC2A 1KEEB 3S40A 1EJBA 4C76A 3ELUA 4D42A 3UJ6A 4F21A 4K9MA 4CR6A 1I4WA 2P3QA 4LMPA 4YR7A 3RFUA 4FQ5A 4BLPA 2PA0A 1ZTEA 2JARA 4DL9A 2FWRA 4G5QA 1W59A 1QCZA 1IIBA 1E6KA 3UUGA 1VLVA 2H4YA 4PAGA 3O4IA 1G42A 2F00A 3RGWS 5IC5A 3MIIA 2DOSA 1NXXA 1K08A 2EFGA 3SSMA 4NS1A 1FPQA 2A9FA 1MAUA 1N4CA 2WM9B 4EI7A 1WD5A 3Q7QA 5LQSA 1Z7BA 3MCAA 3TIFA 2XIQA 5CH3A 1YXBA 2ZUUA 4X6YA 2QZ9A 4NAUA 3EORA 3E1KA 2FSFA 1TK3A 1QKJA 3C3JA 3HPLC 1NJSA 1ZSYA 1F6DA 3G5AA 4BZWA 4HAXA 3NTOA 4REMA 4JIMA 4OX9O 5KHIA 1MJNA 4ZFNA 5DHSA 1X80B 3WYBA 5GINC 3O4VA 5C7LO 3B5EA 3ZQJA 4MSWC 3GJRA 1W2HA 5EXSA 4KFUA 1MX1A 2VUHB 3OIYA 3CIOA 2KG7B 1SOMA 1P2UA 2G0AA 2B21A 4OGWA 3MELA 1MD9A 4I8XA 1RRPA 3ADBA 3AM4A 1FTYA 5LNK6 1Z68A 4FHEA 2PR7A 5ADHA 2IA5A 4GE0A 5D2CA 2REQA 1FQKA 3D0RA 2ADQB 3U5TA 1K9SA 5H3CA 1TAQA 4ZARA 3OUUA 3AFHA 5B36A 2VT6A 2R5FA 4LHXA 2FNAA 4AKTA 1K8RA 1YRBA 2B34A 1PNQA 1U31A 4YAKA 4HVLA 1R1DA 3VTKA 4TKVA 3QF7A 2IXGA 1FLDA 5TDHA 2R68A 3WDLA 1RXUA 1QUEA 4NQRA 3HRIA 1F7UA 3BICA 5AVTA 1JJ2F 2I7CA 3TYXA 1ZH4A 1U0EA 2CVFA 4UOQA 4L0DA 2VQ3A 3OHSX 3IA2A 4BNUA 4R69A 1ISRA 2BWJA 2BGRA 2BV3A 3L0DA 4OKIA 1GUBA 2UU9O 3TW6A 1FY2A 1EX7A 1J8QA 2XQVA 4IQFA 3FCXA 5D3MA 4F4DA 3JVUA 3JAMA 5EI5A 5TY0A 3MK31 1W4RA 2QQFA 5E6UB 2PPVA 2ZBQA 2FWAA 2V7GA 2ZJ7A 5J3JA 1TKRA 3DCJA 3ZRSA 2WD8A 1VQ4V 2O8CA 3AOGA 1N2IA 4TSFA 4ZQEA 5F33A 4NNPA 3GLVA 4HAUA 4ZEOA 4ZCTA 2YJGA 5DU2A 3QKIA 2ZDIC 5D6NA 1L7PA 2KX7A 5AVXA 4CUJA 1RP7A 2ZJOA 1KYYA 4CKWA 3B48A 1T8WA 2YYSA 4E07A 4PC6A 5KB3A 3GAFA 3KEQA 4DAEA 4EG5A 3JAMN 3UGKA 3WWPA 1SCJA 4I4TF 4D9JA 3D8BA 3ZLJA 4G89A 1Q8RA 2DHDA 1PU2A 4PZUA 4HQLA 3FMFA 1PEDA 4UCFA 3QUAA 4OXRA 2HDWA 4LFAB 3KDAA 4Y6QA 2J3LA 3DGEA 3OJ0A 4X91A 3B6MA 5MGBA 1BNCA 3FF1A 3KKMA 3VU9A 5EYPA 2PQ2A 2BP7B 4BKOA 4OQDA 3QPWA 3SQLA 2Q41A 2F64A 1AU9A 4DLKA 3R7SA 3WISA 4GZ3A 2OV4A 2VNHA 4X71A 4C0JA 1DMRA 3LDTA 1WPQA 3OI7A 1P75A 3AESA 4JPRA 4ZZ0A 1QVGU 1LLUA 1SCBA 2HSJA 4QM7A 4TLCA 4WFIA 4XVQA 4WDQA 2RHWA 3KJGA 2VTBB 4HG2A 2OHWA 1BHO1 2WQ7A 5EFOA 1XEWX 1YVUA 3ZWBA 1G1XB 3PUKA 2EWMA 2QR2A 2NN3C 2WKQA 2DHCA 3AQ4A 1ADBA 3B9PA 1K7CA 3V33A 3AUAA 4DNQA 4OXNA 1WG8A 2RBKA 2Y2VA 4FPPA 3UUEA 4QUEA 4ZYWA 3G6BA 3VYRB 5CH8A 2EAUA 3CVOA 4AULA 3BGIA 3CX5F 1J0BA 4H2DA 1MV5A 5KSPA 4IG4A 4RCYA 4CG1A 1KXJA 5FA6A 2Y1CA 3WQBA 3TGUH 5KQMA 3CCSV 3HB7A 5ESWA 2ZDHA 4V1CB 4OGGA 3EZNA 2FB9A 2V74B 5BSUA 1P33A 2JJ1D 3LYAA 2GTIA 2A0XA 2BW0A 5BSRA 4EG8A 5KJ1A 1HQDA 1SU6A 1E1MA 3EF3A 3VR4D 3WNVA 4BLOA 3MYRA 2I1QA 4CKBA 1N2EA 3A10A 1IRXA 3HVKA 4KK3A 4YS6A 2WSBA 4QKQA 5FJ4C 3NVMB 3NBFA 3O3OB 3OQ1A 5EP2A 1CIJA 4YRJA 4MGIR 1OAAA 2GKSA 1Y8QB 4GR9A 3IAHA 4YJKA 1RIIA 1Q6UA 3OPVA 3ROXA 5IUJC 2OSBA 3UMFA 1LS6A 1QLNA 2A9PA 3MUFA 1YZVA 1LX6A 2Q0XA 1K3EA 3FPIA 1BEZA 1JKMA 3LBHA 5I7AA 3KPUA 1R0CA 3PU6A 1ZHOA 3T9BA 2Q07A 1HDXA 1X52A 4NPHA 5JXIA 4NUTA 2PV7A 3HHEA 2C4UA 4Z49A 3ZHQA 4JOCA 1TC2A 3F96A 1PKXA 3P9RA 3A6HA 3HXPA 3OCWA 2YUTA 3OQOA 3CF0A 1FBTA 2OT5A 1JV2B 4W5NA 3RNLA 1JL3A 2W00A 4BQOA 2G25A 4BCBA 1I1HA 4M1KA 4RFLA 3RTDA 2H4XA 2QDXA 4DO2A 2C9OA 3RA5A 1SWVA 4MLPA 3TNYA 5B8FA 2AXEA 4E7OA 3EVCA 1XTZA 4HFMA 2VJAA 2C54A 1Q3HA 3B1WA 1KNJA 4YLGA 2IZZA 4X1OA 2VQEB 2F9ZC 2GHRA 2QMEA 3T5GA 1E2GA 4Q1AA 3R9IA 2CMFA 3IQFA 4MV8A 4X20B 4OP1A 4NCXA 5ALGA 1VARA 2P7HA 4KDEA 5LNK1 1UZAA 5KNCA 2XDWA 3VPBA 2IPXA 1X6VA 1IBMB 2DWOA 3X1WA 1F0KA 4AF6A 3VQTA 2R1TB 1HTTA 1TQ4A 4HTAA 2CKMA 3D6AA 2CMHA 2WJ4A 2Q2WA 2XEXA 1NBME 2Q4RA 4JU9A 2WFAA 3K1TA 1KMHB 2D0DA 4R54A 4ZREA 4GYYA 5DSZA 1Q14A 4GX5A 4D9GA 2GZ2A 3K5OA 3WV5A 4I36A 3IEPA 1XLTA 2X6CA 1INLA 1Z5UA 3GMDA 2Q3BA 3V4ZA 1X94A 3ZMSA 1WB9A 2QV7A 5LU8A 3V2UA 1YTFB 2WKPA 2A0YA 4ABMA 5JVDA 3D7LA 3LNCA 5TJ9A 3H1EA 3N0WA 2BRUC 1I36A 4V0ME 1A9ZA 4X3MA 3G02A 5EQDA 1VE3A 4JAAA 3ZBHA 3ZI4A 4MDHA 4LG1A 4ZDJA 5B1AC 3SJAA 1K7XB 5TV2A 5HF6A 2Z2IA 2WILA 3FJ1A 2XVAA 1J6UA 1XEQA 1B74A 1XTIA 3CN7A 1K5SA 2JGFA 4QLBA 4PLTA 1SDSA 5KTNA 4QJFB 4W4KA 1V6CA 4LYFA 2X1VA 1ENOA 3IP9A 3MLAA 2JDIA 3FPHA 1DBFA 4FUTA 5F76A 3TG8A 3K6SA 2Y9PB 5FI5A 2IH4A 1IMOA 1Y6JA 4DDMA 1Z3CA 2ENWA 2XUKA 1ZEJA 4IIXA 5B37A 1BXZA 2BFWA 4GKKO 5DNYB 1AI5A 2ZYUX 2BKXA 2UYJA 3NVDA 2I4RA 3STUA 4QTXA 4WKPA 2CLHB 4AURA 2PUBA 1JTFA 5KOHA 4H7DA 5DBGA 3R3YA 1COZA 2W7TA 4MTCA 5FA5A 1DAOA 4IQ8A 5JZBA 3NC1C 4O4HB 1GRJA 2B5WA 1MPTA 1U0NA 2IP4A 3D2AA 1Z7EA 4Q3LA 4PWTA 4Y2TA 1UBRS 3QVJA 3TB6A 3KZNA 2EKBA 5JRJA 4JLOA 2EL9A 3IDSA 3IP3A 5JCPA 1HT1E 4GH5A 2FPUA 5I7VA 5CT9A 3MGCA 1OHHG 2IBZH 1QLEC 4OLAA 3DC6A 1A32A 3BX1A 2SKCA 2P7IA 1SVOA 3KXPA 5GZ3A 1PNVA 1T4DA 2A1TR 1XZBA 5TPWB 4DCTA 1VHAA 1WCYA 5KHAA 4BT6A 3T35A 3GLUA 3KFXA 4IS2A 1PJTA 3W5IA 4GPD1 2CJYA 1EU1A 5CA1A 1QLHA 3ZY6A 4ND3A 2YV4A 2HG5C 1RAIA 1BCCH 2QRJA 4REQA 1TNDA 4G0NA 2XBMA 2OBLA 3AHCA 3QK7A 2YIMA 3SXUB 4Q4AB 4MV4A 2PQ0A 3S0HA 2HUPA 2QT9A 3JQCA 1NDUA 3SD7A 1Q11A 2I2FA 3H2ZA 5CVTA 2Y4NA 5TISZ 3SZOA 4EUHA 1DELA 4P80A 3KBBA 1MAVA 3G67A 4GLXA 3OONA 2V1XA 1RYFA 1QE0A 4RS3A 2AK3A 3L07A 5DM60 5LB2A 2WLHA 2YNMD 2NZUG 3UJBA 3DV0B 4WQMA 1LK0A 3P9YA 1OCOB 1I6LA 3CEAA 3RIHA 1XZ8A 2O1SA 3PIDA 2XTNA 4L3WA 1ISJA 4TS1A 2AW9A 4WPGA 4WNAA 2PO7A 3DM9B 2JGDB 3GGPA 2CXTA 1I3MA 1VGVA 2EBHX 1UM8A 3GLRA 4WLOA 4UCTA 1XBLA 3TRKA 1U7HA 3CNLA 3F5MA 4EHHA 1SFRA 4N03A 1O95C 3EQ8A 1LJ8A 3DMNA 1GA4A 4TX1A 2PV0A 3DO6A 3SF0A 3HPQA 5J4LA 2CDAA 3FCEA 3F4LA 1SZPA 3BF7A 3LVQE 2HVKC 2GO1A 2IYUA 4O2AA 3D3QA 3CSDA 2GD0A 2DZDA 1FS0G 4ZDKA 1X3SA 3I1YA 4F2HA 4OI1A 4E5MA 3H13A 2VF4X 4XIJA 3TIGA 1R00A 1E2KA 1NSTA 2Z5LA 5CG2A 3RIMA 1CXZB 4C4TA 2YHBA 2BKVA 4HR7A 4B7ZA 3GEIA 1IEVA 3I9OA 3AR2A 4K9SA 1CZOA 1BXGA 3QBTA 1T1EA 2P6OA 4I5GA 2FJPA 4H3KB 5T4HA 2P2YA 3A4MA 1HSOA 2JGJA 3U39A 3K14A 3I4CA 4AZTA 4YNBA 5BR1A 1ID1A 4EKGA 4UTNA 3T7RA 4UREA 1NVKA 4HGQA 2UUPA 1XILA 3NHAA 1TM2A 5CDHA 1CUVA 2OZEA 4LWPA 3CRW1 3HV0A 1JDSA 1MH1A 2GBGA 2YXBA 3JRXA 4ZKIA 3KSDO 4AZ0A 3ABOB 3E27A 3EC7A 2VJQA 4MKRA 1XDGA 1U4SA 3IKMB 2XA2A 4F11A 5JALA 5JAPA 1B2RA 1G5HA 1ONOA 2E4WA 1FVXA 4GF5A 2CHTA 4DYLA 4RQBA 5KOYA 2O23A 2PMPA 3ZVKA 3L5KA 3UW1A 3N2NA 2IHKA 1P1IA 4DXHA 5EIBC 4G84A 3S2SA 3RUCA 5DCYA 4QDOA 5DTQA 2P1ZA 4Y6LA 2H8PC 1FF9A 2FEMA 2O8FA 4WT7A 2ANCA 1JI3A 2QN3A 4M1WA 4YRCA 4G5GA 1T3GA 3WLQA 3IO5A 5DBIA 2PDAA 2R4QA 5H68A 4XB6B 2Y8EA 1AKTA 1S9HA 1IVSA 4WV3A 1UPBA 5A0FA 1G3UA 1GGMA 3PYXA 1EX9A 1DHTA 1OX4A 3GRKA 5KSYA 1XD2B 1BJKA 1ZD3A 1D03A 1E79A 2V9ZA 1PQYA 1SAYA 3QNWA 3U10A 1E3DA 2ODAA 1UWVA 4K88A 2ZI9A 4Q93A 5JSUA 5JAOA 4EKYA 4IOLA 4MKIA 3K2IA 1XRLA 3GQVA 1WPRA 4C05A 4RAIA 2CUGA 2IOFA 2J3KA 3P2KA 1S2OA 4DLVA 4KVGA 3U16A 1QLEB 6CHYA 4G88A 1E4YA 3R0QA 1I9GA 4KUEA 1QR2A 7AT1A 2Z4RA 3Q8LA 2WZBA 2HHLA 2A9KA 2G06A 3IAFA 3ZCVA 3QJGA 4H6PA 1ZW1A 5FI1B 3ZDRA 2JLYA 3ZXSA 2YN0A 5DX0A 4JGBA 3UCXA 2NLJC 1P80A 1U2ZA 5LOVA 3W79A 1USVA 1RXWA 2CHGA 1V41E 4FS3A 2BFFB 5JI2E 4JYBA 4IGKA 4NV3A 1WP4A 1EUYA 5NULA 4BVJA 1WDMA 5DEIA 3L82B 3ZDEA 1Z5PA 1JDBC 4EPRA 4JJIA 4KNWA 3RB8A 3ENWA 5CLQA 5AI0A 1J1ZA 3OE7A 5BR8B 3OZUA 2P41A 5JH7A 5FI3A 1ESEA 1SUDA 5AVKA 4JBLA 4KWEA 2GBCA 3IT2A 4U0JA 3KTFA 5ER9A 2UYQA 3UGQA 3DBVO 3CZPA 2F1JA 4JJFA 2BSKA 5E4TA 5HP7A 2FCRA 1ZM3A 2DP4E 2JPDA 1ZWLA 3FF4A 1IWPB 2LUOA 2PWAA 1KSHA 4DLWA 1AHNA 2ZBRA 3PK0A 1VPLA 3K3WA 4JF3A 2QRNA 1IU9A 4AFNA 4QVGA 1BQ0A 4IHJA 1KUQA 3GLFA 3FPFA 1FVFA 1M0EA 2J9FB 1IHUA 5HFLA 2OHXA 1A95A 1R6KA 1Q5PA 3SYLA 1YJ5A 4HDSA 1DWOA 5GINE 3NC4A 4V3CA 4LWZA 3FM9A 2QB5A 3F6BX 5BWNA 4ECEA 3CLVA 4HLUA 4KPUB 1ZCZA 1ULBA 3IUYA 4GKJB 2R8OA 3H05A 4YRQA 1QVRA 2OA0A 3SQNA 5DCUA 4MVRA 4N49A 3T7CA 3PZBA 3JQAA 4RF3A 1P84F 1E1LA 2VWJA 2P22C 2WT9A 4RJKA 2CY0A 4HWOA 1NF2A 1JYSA 1ZNWA 1QXSA 1MU0A 4EAAA 2ZYRA 1U8ZA 2UUBO 3LC7O 3NVKI 2ETVA 2QTSA 1OD6A 4CBCA 3E53A 4PC7A 2V45A 1GK9A 4AROA 1VXRA 3K70D 4A0SA 3MVEA 3MXTA 5I7EA 4ECAA 2MOKA 2AEEA 5ALSA 4OLFA 1KK3A 2FW6A 5HM8A 1FB5A 1GNLA 3IP1A 3DKIA 1Z15A 4FB4A 5H02A 3HGMA 3A06A 2BFCB 1HLPA 3FOBA 2AWNA 1A7JA 3P19A 1KVTA 5AI4A 1QKIA 4TRJA 3V7YA 1G4YB 1YASA 1TT5B 1UJ5A 4DG9A 2X9LA 1I5RA 1LPMA 3BMQA 1Q0SA 2WTUA 3CZCA 3DZJA 3HVIA 1COMA 3ILXA 1HT2E 4D3ZA 1BO6A 1DO8A 5F1KA 5HY2A 3VYSC 1UBEA 2C8VA 3O8DA 2CGEA 1V7QA 3LHIA 3SM3A 2ZJ3A 2BI7A 1H2ZA 3BCCH 3L0ZA 1J7KA 1MT0A 3PJEA 3TBFA 4HVTA 5G0TA 3AEZA 3FYTA 4ND8A 2G5PA 4CLOB 1V3TA 3LF1A 4Z4CA 4GVXA 4M0MA 3RSCA 1TK2A 6NULA 2Q21A 1W1UA 5KWJA 1N78A 4Q82A 3C8MA 2NAPA 3NDJA 5SZHB 2NQTA 2X0NA 1F6WA 4G01B 1HNXO 1YQQA 5LQUA 1G17A 1NI4A 4DEYA 1KZHA 4ZCRA 5DTRA 4WKGA 4P7KA 1WBJB 2NMVA 2H57A 2HWYA 3I6YA 1ONIA 4F2PA 4RV4A 4CKXA 5K0GA 5FX2A 1IL0A 4P9NA 2ZOVA 1TADA 4TSKA 4KZPA 3FNQA 1YMQA 4ZN6A 1AQJA 2F3RA 3F0EA 1V6SA 1PT7A 2HS4A 5G0UA 4LECA 1N6KA 3GPIA 4JENA 1GM7A 4WLFA 1YV9A 1IX9A 3K8YA 3BVOA 1KDYA 1A04A 2RGNA 5GQSA 3B6EA 3WP0A 1MVOA 3P0JA 3ZEDA 2HV9A 3KSUA 4CKYA 4QPPA 4EHLA 3FWZA 1JDBB 1KS9A 1R0YA 2J87A 1U2PA 1R9GA 2JI9A 3H19A 1Z73A 3W8DA 3G71F 3ZY4A 2WE7A 3VZPA 3MQFA 1CDOA 2J6IA 1A8PA 2FQQA 5JI3E 2D06A 3NBZC 4YV0A 4OGQB 1NMEA 3C97A 3THWA 2YEVA 1HM5A 2CXOA 1NV9A 3CINA 4H13B 5EKUA 2H31A 3A58B 3PXAA 2FMXA 2PAAA 4DA7A 5EN4A 1RIFA 1ISSA 1NLFA 4ND4A 4RD0A 1DXHA 2Q45A 3VMMA 1H2MA 1DVRA 4RGBA 1Y48E 3IX7A 1D4ZA 5ECYA 2WYIA 3IHLA 2PTMA 3P4UA 1DRVA 2J1LA 1TYZA 2J0EA 1XZDA 2JF0A 4FMDB 1JIQA 4JI7O 4JTAB 4B74A 3BB1A 5LMUB 2V3CC 1L4EA 1P7YA 5AM2A 2BOBC 2XOKD 2PX3A 3WLJA 4I9QA 2ZTUA 4FHFA 4BNMA 4RO0A 1ACMA 4FK8A 1H2EA 5IVIA 4MUYA 2IDZA 2GPTA 3GLSA 4PONA 121PA 3MMPA 1X80A 3WMWA 3VKFA 3UQZA 3CJRA 3WQSB 2HP8A 5MGNA 1YA4A 3FRIA 4U2FA 4IIHA 3STZC 5IKPA 2GPJA 2Q3FA 3D0OA 4BJ6A 4JFRA 4M0DA 4BYGA 1NM5A 4G63A 4FQ8A 3RSLA 1J8VA 5KQLA 1XCBA 4J16A 1Z6TA 5A1TA 3IOBA 2Y1EA 3QMMA 3TD6A 5EJIA 4BP3A 1EP3B 1TTQB 1M6WA 4DK1A 5AO9A 2XLCA 4CV1A 5MHTA 3D43A 2W83A 1Q16A 3SGLA 3I09A 3RVYA 3RAEC 2WU0A 2HBQA 1AKYA 4LS3A 3W6UA 1Y1TA 2N48A 4EHFA 4CMEA 4ARSA 2FR8C 3B5JA 1NVVQ 4PYJA 3OFNG 2Z43A 2ZE7A 5FPQA 3LQRA 3H6HA 4I1RA 4UCVA 2WICA 3W7UA 4H31A 2VF5X 2PMBA 2FPGB 4A03A 1ZNZA 3HA3A 3AINA 3TTVA 3WWZA 2C8LA 1GZ0A 1R4ZA 4E03A 1UODA 5ALQA 2GA8A 2V3VA 4FJCC 3ASUA 4WA7A 1O94C 2OHGA 1N57A 5C34B 4FFVA 1UBMS 1G8KA 3WLPA 1KEPA 1EBFA 1G7TA 4WWHA 3VYSB 1USKA 4CH3A 2I1VB 2CZWA 4XARA 1E9VA 2DT4A 3VOBA 2QI2A 3Q15C 4FOOA 4F2WA 3FXAA 4PLPA 2HBRA 5CGZA 5CXUA 3DFZA 2R79A 3CRAA 1CUYA 3S5UA 5BRAA 3H7IA 5DNVA 1B00A 2J9XB 5E6UA 1DBSA 1CRWG 1QGED 4GR4A 3T1YO 4M98A 2R3SA 3KEFA 2ZWMA 4WFAV 1H9AA 3IUJA 1YJ9F 2J9YB 1FS5A 4HBGA 2C3OA 2FDCA 1NY6A 1P77A 1U0GA 1W34A 3K2EA 1MB2A 2PUAA 3U7HB 3I8XA 5BNWA 4PZZA 2XRMA 2J31A 3QO8A 2C82A 1F0PA 4UVIA 3DEZA 1U7OA 2CFCA 3L70H 5TMEA 1Z35A 5IYZF 1BDBA 4KQHA 3CLSD 2WG2A 2ENUA 3H5WA 1RQLA 1D3AA 1CKEA 4Z54A 5B2EA 1FU4A 2CLFB 2VF8A 4A27A 4PG4A 1TUBB 1XNGA 3OR6C 3HP1A 1VGRA 5LDGA 1DL5A 3WRWA 3W3AH 3QHAA 1Q82H 4FT2A 4LVCA 2HIHA 2AVNA 2EG5A 3JWEA 4UM9D 4IDEA 5FUXA 1DBQA 3VGJA 2YXLA 2OG2A 2BP7A 3EAGA 1CP2A 1T1GA 4S12A 4A6PA 1QK3A 5FYQA 5EHQA 3LZCA 1MPXA 3LQ2A 4BX0A 1OAOC 3QTYA 3V3TA 3IBFA 3OEEA 4IPTA 1H8EA 1L5SA 3LGAA 3P5SA 3W4IA 3VKHA 1PDWA 4EENA 3KAKA 3OOEA 2YJ3A 3EK2A 1G6HA 2VTBA 4JR2A 5EXPA 2QXUA 4BS9A 2Z01A 1PG2A 2QGZA 4ZOCA 2A30A 3BHJA 1DKLA 4XEUA 2LR0A 3O4FA 3TB4A 2EJWA 3B3JA 3PA6A 1X1QA 3J81k 5B2ZA 3RHZA 3PFFA 3PWKA 1MQ8B 2HJ9A 1SKUA 1DJMA 5U1PA 4GD3Q 2WD7B 1A9OA 2H6EA 4BGVA 2YS6A 2JFYA 4R1QA 4JC0A 3C15C 1VMEA 2GSDA 1FA9A 5LQAA 1ILWA 4LAFA 1RCUA 4NULA 1VF6A 4JY7A 4BZZA 2QVLA 4KCGA 3QLEA 4BU0A 2ZZKA 1E1DA 3QH4A 4BNWA 5FADA 1CUDA 1W0CA 1CJCA 3L8ZA 4QLOA 5AW0A 4V1CA 1VZ3A 1GA6A 3M6AA 3A1UA 1DIHA 4TLLB 2NP6A 3TGLA 5EXEA 4HNAB 5LZ5A 1YJAA 1ZINA 3CCCA 5BWBA 1B0ZA 1NIJA 3WHPA 1W5SA 4V03A 2MYUA 2VHQA 5TQ2A 4GNKA 1EXNA 3Q7TA 1D09A 1EX1A 1XKQA 2JD2A 4NJOA 5EMLA 2DWUA 2Z04A 1Y8QA 3B1VA 4BWGA 1MENA 2GJ4A 3P5BA 3QOWA 2J6CA 2O0KA 2P79A 4HDNB 1F2DA 4GGPA 4J8PA 4CT4B 2AG0A 1QVWA 4OH7A 5I8PA 4IJ5A 1BXKA 5A05A 3EZ9A 4YXWD 3F1LA 1Y8RB 3N2YA 3DOEA 5FFNA 1BYUA 3QJ5A 1AK2A 3M3HA 4IO1A 2HVYD 4MW1A 3G8YA 2CB0A 4BLQA 3KYJB 3O94A 3K5NA 1WBDA 4PNHA 3FRJA 1F4PA 4EPTA 1KARA 3AB8A 1Q7GA 3CSXA 4YP0A 5K8TA 2WWHA 1GPJA 3WA7A 2KM1A 2C0PA 3AY7A 4S24A 1DRKA 1DX6A 5GZ6A 3L7DA 4WK2B 4LDAA 1EWRA 1UKEA 2FA9A 4RQOA 3EGIA 3GVMA 4Z5XA 2XT9A 1QWSA 3GJ7A 4DNFA 1P4AA 1C29B 2VT3A 4CLHA 3KYDB 5F3RA 3L8MA 2EQBA 3KUXA 2Y76A 5B58T 2E1RA 2CXNA 3SZGA 2CSUA 4R8LA 1GKUB 1I1NA 4RVOA 5HE8A 1T35A 1QOPB 3EFHA 2C2HA 1VYUA 2GCEA 2YXEA 3CX6A 4RJIA 2R87A 4X20A 4LRXA 9LDBA 2JRCA 1T3ZA 3A2MA 2X6TA 4II7A 1GNRA 4J0QA 3LUJA 1X9IA 2ZDIA 2W6IA 3OPYI 4I5SA 2VJCA 3RHFA 4LE1A 1DUSA 1RJWA 3R5HA 1KDOA 4TRNA 1Z4NA 1KMHA 4ARZB 2VJNA 4X6UA 2DH6A 4IV0A 6YASA 3DMDA 1I51A 1XZLA 2AF3C 4X6LA 5CVEA 4PHGA 1SRYA 4MUEA 2EGHA 2Z0MA 3H17A 3BB3A 3CURA 2FVXA 2ZBFA 1LKZA 1KZ1A 2ZUFA 2HSZA 3NOVA 4MPPA 2DYSB 2RGXA 1WB8A 3ZE6A 4D4IA 1AVMA 3KM0A 4MVJI 3OO0A 4Y2SA 3LVRE 1I3LA 5K0LA 1WB5A 1H5NA 5F1YA 1QVVA 1QPGA 3KRTA 5FHRA 3WRYC 2CAZC 3SOZA 1R10A 3T41A 3BBLA 2QI9C 2MJLA 1HX7A 4LF4B 2GUGA 3V4OA 4IYHA 1CSEE 1JJAA 2R8XA 3OBWA 4NABA 4OI0A 3F9IA 2G67A 1ZO8A 1WLYA 3NPMA 4CM1A 2AJ8A 3I9NA 4FR5A 2I33A 1QIKA 2WU4A 4B35A 1WKBA 2OKCA 3K15A 4CT0A 5THXA 3KOYA 1QCYA 4M6WA 5K1XA 3UKOA 1CR0A 1OH7A 1UK7A 4IGFA 2I6SA 2VZ9A 1II0A 2V7EA 4CMIA 1NF9A 1PBNA 1LQTA 1YEWA 1CU1A 1CJMA 2RGCA 3GRFA 3VVCA 1T1IA 1T24A 1RAFA 1CRQA 3L0PA 4UQLA 4RXMA 3FI0A 2BFDB 4FFWA 3R4VA 1H6AA 1XRQA 2LCFA 1DEOA 5AVWA 3OY7A 1Q7TA 5EQJB 3CWZA 2NIPA 1V48A 2C4VA 2DAPA 1IUPA 1W5EA 1RZVA 5REQB 3H4VA 5FPOA 5HGJA 3SC2A 5KAPA 3ID6C 1EGHA 4RX1A 4Y2JA 3FKSD 2ZJ4A 4YRDA 5BW6B 1NI3A 1U0TA 3AVWA 4LX0A 3R09A 3M6WA 5TPWA 3ELCA 4HVAA 3IDOA 4LCEA 3TLGA 2Q9CA 1SPXA 5IJ0A 2IYYA 1UADA 5IS2A 2W0XA 1MKYA 3WK7A 4ER6A 3VQWA 4Z9BA 5ANRB 3OT5A 3JWGA 3WL6A 3A0RA 4JUIA 3VGPA 1CHDA 1W4LA 3E23A 3N4ZA 1KU9A 1G5IA 4NAHA 3KQWA 1F0YA 3SXUA 4I9HA 1IN1A 5KINB 4MVJH 3ZIDA 1KR2A 2DWCA 2RHTA 1OZ0A 4LOJA 2HL6A 4CEJA 2GZMA 4D5EA 4BXOA 5I6DA 3PQFA 3C1UA 4WDRA 3H4IA 2FOIA 4CCAA 1SZJG 3K6JA 4GSYA 4OQEA 1NQXA 3HYTA 4L5IA 2B9VA 1CUXA 1N5KA 2X2FA 3UMCA 2AFHB 3G85A 4JI4B 4IUBS 5KOJA 1BJTA 1N9KA 2J5KA 4QUAA 3Q5DA 2Q62A 2I2BA 1CVIA 2G76A 3PCTA 4F45A 4EI8A 3NRJA 5HEKA 4L73A 1HV8A 3DNMA 2JGDA 4FEGA 4RACA 1MNGA 3L7AA 2UUCO 4XFJA 1L3CA 3A0UA 1OLUB 4F4JA 2LP7A 2XXAB 3LOPA 3DLHA 2O4CA 2V1UA 1Y4SA 2QTZA 3IUMA 2VI5A 4TV9F 4G4XA 1CQJB 4JB0A 2HQRA 2FC3A 2ZETA 4PA9A 1Q2XA 2P5SA 5F2OA 1XZEA 2GM4A 2IF2A 2BR5A 2OFXA 2ZJ1A 1FXKC 1Q19A 1CQXA 2XNDG 1V2HE 2EP5A 3FOWA 5TVGA 4UUPA 5BSKA 3WJPA 1CXZA 3S0WA 2DERA 2VRCA 4Q7LA 5BWLA 4I4LA 4ZHQF 1Q86H 5DXAA 2RH5A 5JPIA 1FK8A 1XJWA 4UUQA 3ICVA 3KHTA 3AR7A 1Z29A 1YFZA 1AGXA 4Y3UA 3TZQA 1TJ5A 2FZLA 4EO9A 1WSBA 5KTMA 4BX9A 1XVVA 2QEXF 5C80A 4JLVA 2A4MA 1VA5A 2ZRCA 2EW8A 3QYAA 1HI9A 2ILVA 4S1OA 3FJOA 2IS2A 3FCOA 4BNIA 3K0FB 5IASA 4RZQA 3ANYB 1LSSA 3ROMA 5ENZA 4NHOA 2RGEA 2IIBA 2JLCA 4MAAA 2XUZA 3HABA 4IH4A 2PI5A 4URUR 4WKOA 1MW9X 5DNWA 2OAGA 2QN8A 2IH5A 4ZO6A 3U7QB 5LLDA 4MGKR 1R8YA 3K0CC 3I1IA 1SQVH 4Z0TA 1RJFA 2P2DA 3HCCA 1W7AA 4PCVA 3X1MA 4FE7A 5GTIZ 2D3WA 3MHPA 2ID8A 3SFZA 3ZK8A 5A5GA 4GBMA 1UAYA 2XMCA 3H99A 2D2IA 2F2TA 2GASA 1Q0PA 1DQZA 3KL4A 5AKHA 2DPHA 3TSAA 1KU0A 1X92A 2D5BA 3OUFA 1C9NA 1SVIA 4CZZA 1HT3A 3Q3JB 2ZUEA 4P9PA 5BYAA 1R6TA 3B82A 1FYDA 1E6CA 4DM4A 1F06A 4U2DA 1X7GA 2O48X 3CUUA 2N74A 1E1RG 4U63A 2ZTVA 4BIZA 3BMOA 4Q3CA 4ZYTA 1AKQA 2HS0A 1T9GR 3G8DA 4GI1A 3Q7IA 1L4BA 2R8RA 2AXPA 4XIGS 3BRWD 3RS4A 3AUFA 1XD2A 3EISA 1CE8A 3KCYA 1Q7RA 4H0NA 5DRTA 4H1UA 4IYJA 1L4UA 1EDOA 2X3YA 4ATNA 4BCCA 5U9CA 1VPTA 3N5KA 1GZHB 3O21A 1DRUA 2FPRA 5JD3A 1ZH6A 1VHJA 3BA8A 1J2JA 2MYTA 2ONYA 1LC3A 1U43A 3M5WA 4G1VA 3G0BA 4I08A 3CZQA 4IKPA 3ROFA 2B83A 3EWNA 6Q21A 4LYAA 4RAQA 3AVUA 4BVBA 2NUTB 5JROA 2R4UA 3BQNB 2CV1A 3BAZA 5AVUA 5JJCA 4CNBA 2ZNJA 4FZJA 1J95A 3ESDA 4BP9A 3GFFA 4Y2HA 3OJEA 4JJZA 1MP0A 3DNFA 4H1VA 1Z88A 5EPOA 3MEQA 1D1QA 1DXQA 4EDHA 1N2BA 4FTWA 2OMKA 3N4YA 4C8IA 4GKVA 3OTOO 2HXYA 3K0GA 1X86B 2D8MA 3PQ6A 1R3LC 5HZKA 3RS0A 3E86A 5KX5B 1LGYA 2B8EA 3BREA 5THKA 4YRRA 4ZHVA 3P3PA 3DLTA 2AI2A 2AX3A 5ILOA 1ZVKA 5DHTA 2ZUCA 3C90A 3KD2A 1T2UA 4DYVA 3I9LA 3JCZA 3DE6X 1DG9A 2OVBA 3OLZA 5IAGA 4RHXA 4D0LB 5LQNA 3H1AA 5JR3A 3BGDA 4IXWA 3ETCA 3ZGOA 2UXBO 1GGJA 1EA5A 1UFIA 4AILC 3LT4A 2GRJA 1R27A 3FCYA 3FFAA 2ZITA 5L3SB 3MWEB 4D3SA 3T80A 2FSIA 1M67A 4ND7A 1Z6ZA 4L8VA 5LLTA 3ZX5A 2P91A 3AVPA 5CNIA 5FL7G 4IOKA 2AZ4A 5IN5A 5DHRA 2IYVA 3IP8A 4N5IX 1O95A 2H51A 3LQYA 1G5TA 3VR5A 5D5PA 4R1PA 3PL5A 3CHXA 3R3ZA 3D8CA 4TTIA 3NZEA 1U8FO 4IS3A 4QGHA 1N6LA 3H1TA 1FXKB 3M84A 1I4TD 1JJBA 1GN6A 1NFRA 2JAQA 4H1TA 2ZBEA 4UUJC 3PQ8A 1MABG 2QA4F 2R4TA 3TXSA 1R3DA 3HR0A 4M0LA 4FFKA 1OKKD 1DC3A 5EPEA 5LJLA 4N48A 3D4BA 3ZD9A 3E5HA 3GV0A 5EKSA 3QRWA 3DBHB 1I6WA 2MU1A 6LDHA 4AQDA 3PBKA 4JI6O 1M2VB 3V8VA 1IXBA 3BA9A 4FDMA 4FX5A 2C5HA 3U80A 2R85A 1PR3A 1JQEA 4NBVA 3EZXA 2AHYA 4MRVA 4RPLA 3CF4G 1I14A 1WMEA 3V7NA 2WNSA 2N1BA 1F14A 5E38A 4A36A 3SC3A 3I2YX 3LLSA 3GC6A 3TSYA 3AXTA 5KHKA 2Q4DA 4MVQA 2R1VB 2C5SA 5FI0B 4U00A 1TEHA 1OCOC 1QP8A 1XRMA 2DJ5A 2KQUA 3GZ4A 3NXSA 1YB5A 4YP5A 5KQGA 2RHOA 3QXJA 1EKXA 2A67A 3L7MA 4CEHB 1H2HA 1TT5A 1VJGA 2KGWA 4OB8A 3J80M 1QIDA 1E5VA 5K5EA 1N1MA 2IHUA 4MKFA 2Z4TA 5TNXA 5JAUA 2ATCA 4OYHA 3V1MA 2NZ8A 4XYLA 3TRJA 2HSGA 2XWBF 3VAAA 4WK0B 4M9CA 4XX1A 1P4SA 5LBQA 3IOEA 4Q19A 2W2MA 4RKWA 2YKGA 5HBGA 4CCYB 3OKCA 1L5NA 4ENPA 2ZAYA 1QYVA 4IIJF 1F48A 1OXMA 1K73H 1I7PA 3CMCO 2B0CA 3T3IA 4KR0A 4OATA 4YRLA 4J29A 3TX2A 2ZPAA 1QHXA 3OLXA 5HQJA 3SYCA 3PGJA 3ON1A 1KK1A 5H3HA 2PKEA 1Q91A 1Z4KA 3NWBA 1BTOA 2GD6A 4P98A 4C5BA 3UM7A 4CLOA 2JANA 5H80A 4MVJG 4BN5A 4PD4F 4C6RA 2H54A 2HRDA 5ICGA 4NF2A 2YVUA 2IZ5A 1C1DB 1VPEA 2PGNA 3LDFA 4DTIA 5IKOA 3CO0S 4QBGB 3MOIA 2AYZA 2IBMA 2V6MA 3CZMA 4XDHA 3TZ6A 4HWKA 2GJ8A 1Q44A 4KJZA 1L1RA 4KFMA 2AOXA 3M81A 1JIUA 4GC5A 2C96A 3LCRA 3RPEA 2NVBA 1K8YB 1SUBA 1IIRA 4ZT2A 2O2HA 4L78A 2NV0A 1MFZA 2K7ZA 3GUCA 4LHZA 3ZIUA 1F2UB 1WEHA 2WHYA 3A9WA 1MO2A 5CBKA 1Y6XA 3VSCA 2W42A 3B1ZA 3ZHOA 5BZBA 3S1SA 2PF4E 5DOZA 3PNYA 2MMGA 3MWFA 3EVKA 5JMWA 1E0KA 2G04A 1IXYA 2XQIA 2GTSA 4U8GA 2A9QA 1AMUA 3CB2A 1XCLA 2BLLA 3C3PA 3ZWDA 2JVIA 2YQZA 3UANA 4RMNA 3S7ZA 4KMRA 3Q3CA 2VYNA 4L8JA 3WGHA 2G72A 3GFBA 3B89A 5FUYA 3EIUA 5HP4A 3BCSA 2YCBA 1E2PA 3HADA 3OJXA 2VUIB 5K2MA 1AUXA 3KS9A 5LXTF 2I4IA 3ED1A 4NLLA 3ESJA 1FJHA 4PAMA 2WJPA 2QTVB 3VIUA 1MEOA 3PEYA 4HXEB 1VJTA 2JLXA 4DE5A 4KRFA 2HF8A 3II6X 3O3MB 2H3EA 5CG1A 2SCUA 3PNSA 5GVSA 4WY5A 3WBKA 2VXYA 4UCRA 3STWA 5CA3A 2CJWB 3R8XA 1J24A 4B45A 2XQJA 2BKEA 2IS6A 3PTLA 3PGXA 1SH7A 1NZFA 2ZP1A 4CDRA 1VIDA 1K8ZB 2FP3A 2LGJA 4EITA 3LUCA 4MI6A 1S3GA 4PSCA 2CD7A 2D59A 3EMBA 5A5EA 1UBOS 3NOOA 4JCCA 3TCNA 4LDRA 5GTDA 1N25A 2EBFX 3RARA 4FHCA 2NTVA 2CCKA 5C0OE 3DD1A 1B6TA 1NTRA 5AD1A 1N8SA 3QE4A 3WJRA 4D98A 3EXFA 3I01A 4X7BA 3LXXA 4RS4A 2C7VA 1CX9B 3H3FA 4XPIA 3TL2A 5AW1A 3AO0B 5FBHA 3PRHA 1HNZO 3J7AC 1UOQA 4ZKEA 4NWOB 3MWDB 1KEVA 2X4GA 4M7PA 5AH0A 3VFDA 1VE1A 3IEXA 5C8XA 3AG2C 2QZPA 1CVLA 1E6MA 2I67A 1CEQA 5CLLA 1Z8FA 3MD0A 3OIFA 2R8ZA 3U3OA 2DFLA 2WUGA 1CRPA 2JC3A 1T3LA 1ZIYA 2D7DA 4MVWA 4R40A 1MG0A 2GAFA 4DUPA 3HEBA 4AM8A 3ZC3A 1M6YA 1AP5A 5DHPA 4N0PA 5JU6A 4NNOA 4MIKA 3BWCA 5CUQA 2FV8A 3UMJA 1L5YA 4D0GA 4CM9D 4BFZA 1VI2A 2O0JA 2AFHE 2IDKA 1OASA 3PEEA 1NVGA 1EGQA 2ZBVA 3LM8A 3SBOA 1RE1A 1EUCB 3EUWA 1C1XA 4TVKA 2NTEA 5JCXA 1DAHA 2OP0A 2W0FC 1WZIA 1NI8A 3HXLA 2VSNA 2OBMA 2WLNA 4A0HA 4DW8A 1GZUA 2W0SA 1OLXB 5E6SB 2YC0A 2QRMA 3A70A 3WICA 1MX3A 3HU1A 2PFSA 4DR7O 2WD9A 1UBHS 1ODJA 1DBVO 3D8RA 1M5UA 4R2WA 4AG6A 1S5HC 2ORWA 3GJXC 2WT4A 4BJ3A 2P4SA 3IQGX 1ZUWA 5JNUA 3JZIA 1CQWA 3JYPA 1N1GA 3MSCA 2D0OB 1N4AA 4FD3A 2Q5IA 4URYR 3FBAA 4KX5A 5F3WB 2W5UA 1TAEA 5FNVB 5HFAA 5B1IA 2C7QA 5LGUA 3R0IA 2WPDG 4G5RA 1HDIA 2CDBA 3ZCUA 5LKAA 1PYOA 2VRWA 1B93A 3QYFA 3L9DA 3OESA 3ZZMA 2Y1WA 2JJMA 5H70A 5ECGC 1SK9A 2Y66A 1TUBA 3L05A 4MW5A 3PFNA 3RRNA 5K99A 1KI9A 2C7RA 1RKXA 1R3KC 2PYJA 2ECKA 2PD4A 4H27A 3QF4A 1IYZA 2A9HA 5CR9A 2GPBA 2IY7A 3HLTA 5SZJA 4KITB 3AVTA 2MYPA 4KPEC 4LCUC 4LJKA 4QG7A 2MSNA 2YIBA 3G2MA 3TFOA 2FGYA 4H4EA 1IN6A 3SIRA 2AGAA 1J00A 4HNRA 4ZVKA 5HP8A 3LUPA 3G2IA 3KQVA 1OXSC 3G0GA 1G5QA 2BLNA 2UZAA 3RREA 1P7PA 3KUUA 3V32A 2G4VA 3RYIA 3OCZA 5KJFA 2EKZA 1IQ0A 1I0HA 5B7QA 1Y1LA 4F6RA 3MRXA 5H5JA 5HDQA 3KQPA 2FJUA 4O6VA 3UJDA 1JH9A 1MJ5A 4QREA 4RH1A 5CN0A 2KTVA 4A1OA 2QG4A 3TN7A 3ERNA 4CS3A 3GRRA 3R40A 3A1DA 2XCQA 4N40A 3K2QA 3KD3A 2TMDA 2CLKB 3DM5A 2W2XA 2QS9A 3I2IA 3KPYA 4UFNA 1K92A 4HGRA 1U02A 3NYWA 4BNYA 1XOUA 3ME5A 2X8WA 1WCXA 2IQQA 2Z8YM 5TPZA 4EK9A 2XCRB 2UZHA 4TS3A 4DJAA 4QBHA 2F6RA 1RZRD 1TXGA 5IYBO 3DOUA 4HPXB 1L5FA 5ALHA 1N8RW 1ZG3A 1HMYA 4BIMA 4BVFA 5E2IA 1K89A 4CHTA 3CEIA 4L6AA 4NATA 2W8BB 3M9LA 5IDYA 4E12A 1T2AA 4M36A 1QIEA 5CXQA 3T5TA 4DXWA 2ZSIA 1JPXA 4EQZA 3J7AR 3ZHSA 1H8HA 1YQXA 4JI5O 4J0FA 2PEZA 1NONA 4H7FA 4D9EA 2VDJA 4ZAZA 3BILA 4LCBA 4NWIA 5BMVF 2SICE 1MR3F 2XHZA 2JJYA 5A6SA 3TEMA 3W1VA 3LUDA 3ZBTA 4HNAA 5JS1A 2YVKA 1U2QA 4KYIB 2IEIA 2QX7A 1DTSA 3VH1A 1QRTA 2UZ1B 1JQ5A 4KYVA 3MCUA 1PQWA 1NVEA 4BNGA 1S8FA 1GAEO 4IDHA 3TR0A 5HS6A 1OSNA 2P2LA 3AG2B 5AK0A 5CB4B 1T0AA 1ML4A 3IQEA 5EE3A 4O4IF 4YUVA 3R3XA 4UVDA 2FR8A 1E96A 5DN6D 3BWVA 4Z0PA 5LD2C 1ND5A 3NIDB 5FXMA 4JWTA 5C5DA 4YB8A 4ZU3A 1QOZA 4D43A 3DOOA 3WRVA 1QF6A 1M3SA 2RHMA 2CK3D 3TFWA 2ZCJA 4BLTA 3HBNA 4QOIA 3OZDA 3BWBA 4NZYA 3TAHA 3KQLA 2IYEA 4MCIA 3R75A 4X89A 1RABA 2ZRKA 5GM2A 5HILA 1NVFA 3FB5C 3SGIA 2NO4A 3V4RA 3JD0A 1MAHA 3CX8A 1GKIA 4OJMX 3BHNA 2LCIA 4Q37A 4EX7A 3ACBA 4YQFA 1I1QB 5IBPA 5JS8A 3AV3A 3PS9A 2WUDA 1J7HA 1ZLXA 5LYJA 5FBWB 5D86A 4MQEB 4MZXA 5CU7A 4YDSA 3JASB 4I14A 2QEXV 5GONF 1XEXB 3EVAA 1VJCA 3GL9A 4C1BA 3IIMA 1NBMA 1VM6A 3BL5A 3AFNA 1E9BA 2PVCA 1KQNA 5H9VA 4CVNA 3O73A 3DEKA 3BOSA 3U37A 4F3TA 5KDLA 4M0UA 5TGTA 4OHZA 2VAWA 1TKCA 5EJEA 4QFMA 1NQWA 1V96A 3U44A 1W46A 1ODTC 3ZYCA 4ARZA 2X40A 4OX9B 3SMVA 3JALB 5TJHA 4HS4A 4V0MA 4AJ9A 3ZYZA 3T1NA 2WUWE 3T7EA 4Q16A 2QMUA 2LW7A 1NYLA 5K0ZA 5HXAA 3TOXA 2QMYA 3CCBA 4U7FA 1V11A 2ZS7A 1KY3A 2UUCB 3T3NA 3E15A 3HA5A 3K5LA 4V24A 1VFPA 5I8ZA 4KQXA 4O3MA 1U7UA 2R0QC 4B5LA 3HR7A 2Q7XA 3UWPA 3QI7A 1K0UA 1AGRA 5AKLA 2AIZP 1D6JA 1RR6A 3KKOA 5DGTA 4FW8A 1RBZA 3QXCA 3TMKA 4GX2A 3S2EA 1TU3A 1FP2A 3G2LA 4MB6A 3K9SA 2GXSA 4U7DA 3DMYA 1WXGA 5ADWA 2XNCA 1OAOA 1UPXA 3P30A 3D3WB 3THRA 1FZQA 5EFZA 1TIPA 4LC0A 3NNSA 1NXPA 5KHHA 2IY9A 3I9KA 4BAUA 1KOFA 2E2WA 3FHLA 3FNGA 1T0BA 5DNEA 2ZSUA 4F9EA 4B0PA 1RMTA 3HXQA 4C8GA 2PH7A 1ZIXA 4QPCA 2ZIXB 1LRJA 4DCMA 3IP6A 4DM3A 2G82A 1IN5A 2B8JA 1A2QA 1DDOA 5GGXA 3DFKA 2WSSA 3IMCA 2WJGA 3S3XA 3DKPA 1E2QA 4L02A 1E2IA 2UU9B 2Q2NA 3C1OA 3UMVA 2YC2C 2XWQA 2IHZA 2YFQA 1MQ9A 2CKDA 1G6OA 3UNXA 2JIZG 5AI8A 2GR9A 3ZW7A 2RONA 3K9NA 1GRRA 5ED0A 4JC4A 3QBVA 3B1XA 1TGYA 3RA6A 2F55A 1JN1A 3WKDA 4S2UA 3DL2A 1Z5ZA 2FHSA 3WBFA 1J22A 1E1NA 3VV3A 1CIPA 2A5DA 3OD5A 1JEJA 3OFKA 3TSCA 1WQ1R 1KYXA 4IDGA 2EINC 1KEEA 3T9FA 4UEJA 2AR9A 8ATCA 4NOLA 4MEJA 2A2ZA 2Z09A 4WADA 1CC1S 3GP5A 1YCGA 3WC4A 2HF9A 5ER6A 1DC7A 4ML3A 2VP2A 2OD2A 4HNVA 2E6UX 3R6TA 4G23A 1EFRD 5G53C 5B1BB 3FOFC 2PH3A 4RNCA 2I91A 1TO6A 5JBQA 4MUBA 5LD2B 1KY4A 4LJ9A 1NL3A 3OQBA 1TM5E 3RS8A 3WLKX 2YZNA 3FFQA 3IDFA 4FBLA 1DQPA 1W41A 3K09A 4I4NA 4IIBA 2VH5R 1J5EO 1ANKA 3WKBA 4Y6OA 2I76A 3AUYA 1NG1A 1ZCBA 3FOZA 3N87A 3N59A 4HDQB 2CFTA 2A86A 1B0AA 1R5BA 1Z4IA 4H9GA 2ETNA 4IQ4A 1Q83A 2NZWA 3VNQA 2Z08A 3PPVA 5L9AA 4CM3A 2AFHA 4FM0A 2F9FA 1J90A 1I8TA 1BS1A 1IG0A 1FZTA 5HG0A 4PLWA 3GHHA 1T91A 3GGSA 4HEQA 3MT9A 2PT7A 1FUEA 5IABA 3SXPA 3T3GA 3OTOB 4KYTA 3BGOS 2Q46A 2XXAA 4MO9A 4NBRA 4GQIA 3QG5A 4BIOA 3IIIA 5BYKA 2XB9A 2G6TA 1PJZA 3GA0A 2KG7A 3GPBA 4NPAA 5FQOA 2HMAA 1IV4A 3B8HA 4YPFA 3P45A 2XSZD 1E64A 3VSAA 4CV2A 3HYLA 1RP3B 1TYEB 1WXQA 3CNNA 4P36A 3LOQA 1NVAA 4X97A 4WLVA 5JY6A 2BBTA 2PGLA 3C41J 3RODA 1MZFA 2UXBB 2Q3EA 3QLUC 1ZAKA 3A2FA 3PD1A 1UBTS 4CKZA 2JJ8A 4WOPA 5AW4A 3FB8C 3ZHZA 2QVCA 3F47A 4EH1A 1MA0A 3JWHA 1JIJA 4TROA 3CUSA 3KE1A 3CCMF 2GYWA 4UE2A 1Z08A 1DAGA 2I3DA 1SKBA 1Y5MA 1H9BA 4MCAA 4YP9A 1KZ9A 3K0FA 1L5GB 1Q3TA 4J3NA 2EDCA 3PKZA 2ZSEA 5E1MA 5B30A 3AOEC 2GFQA 1CNFA 2I6GA 2DR2A 3RUFA 2RGUA 4UEOA 3HI4A 3VO8A 2ZJ8A 4OOFA 5CHYA 3NUGA 3A1FA 1QGOA 2QWQB 1YTUA 3FLEA 2XUAA 3DL0A 4BEVA 1B3QA 2IS1A 3RR2A 1JAIA 4JI6B 3LQKA 1T5LA 3ZV5A 4OJQA 1QONA 4MUFA 2LIPA 4A8JC 2FN8A 5G3YA 4FVTA 3LBNA 3WYNA 2DU8A 2VDMB 4ZRDA 3ZLBA 1AKMA 1RXCA 3C6ZA 3ZJUA 4KMSA 2WM3A 4OQYA 1ZD2P 2F4NA 2HU7A 1D1TA 3HUEA 3UIEA 2QWOB 1JX9A 1QRUA 3OLCX 2PHZA 4JQZA 1CUGA 2QUHA 4QEKA 1KQPA 3IXMA 4Q4HB 1M1YE 1B26A 2W98A 5JRZA 1P2TA 4LXUA 2XGJA 1P4RA 3R9XB 3WMRA 2WU8A 1JMVA 2BR3A 4L5AA 2CJXA 1N34O 2GFHA 4TYWA 2BL4A 2DYSC 2O1EA 2HX1A 3F3SA 5JY1A 3K9HA 5LQMA 1LI4A 2V59A 3R9KA 3MDSA 1DCFA 2EINB 2ZGVA 4H7JA 2NUTA 3M0EA 1OFGA 3L7IA 1OTHA 3ETNA 3K1AB 1KNXA 5HZMA 1ZBDA 3RAGA 1SQFA 1T8SA 3LT0A 2BEKA 2H65A 4U2EA 3IC5A 4OHFA 5BN4B 5B2FA 1BT8A 1ORRA 1N7HA 3AF4A 2ITCC 1E66A 4K9DA 3E2PA 4FC6A 1KKLA 2EFHB 1Y4MA 4Q47A 4N39A 3A3YA 3IMGA 3ZNPA 4S1WA 2HKOA 4HF7A 4E22A 2YL2A 5J4KA 5LDDC 2FUNB 3UB2A 2DTXA 1JN0A 1C3VA 5F12A 3GDWA 3AK4A 4R9SA 3I23A 2BGIA 4KFCA 2BM0A 3F3YA 5AXAA 2B8WA 3ZRXA 3VNRA 1G1MA 2DYYA 2ZIWB 5EOVA 2X5XA 3D0QA 1LR1A 5TLSA 2A1TS 3ZD6A 1PZFA 4J10A 3JWPA 5L3SA 1PR5A 1SIBE 1PK8A 1XZPA 3A6JA 4I50F 4Y2YA 2QSYA 4A5UB 4XYMA 3DHWC 4GU5A 4Q1CA 4PG5A 2ZATA 4X65O 3ZJVA 4F86A 4GKKB 2ZRJA 1FQOA 1YQGA 2ODWA 1WAMA 4D2IA 1LSJA 1RQRA 3VR4H 5TQJA 5LP1A 3EE6A 1MORA 1HY3A 5CLGA 5L4LA 4RORA 1DCTA 1FLNA 1JDJA 4EL0A 4IMIB 4Y2VA 2Q6KA 2QD1A 1FXKA 5FR2A 2QEQA 3H0CA 1T9BA 2XDYA 2JLBA 2B1RA 1UBNA 1CP3A 3NOXA 1TM4E 4W9RA 4Q3KA 1DC6A 1NOIA 2YWJA 1E58A 3PQ5A 1J2UA 3OZIA 7ADHA 1N32O 5BXQC 1EE9A 3SDLA 2VCEA 5LPNA 1FRZA 2F1KA 2IYQA 3BK7A 2ZR0A 3FUWA 3DBHA 2NXJA 4LV5B 4JQSA 2J3EA 2HSDA 2Z3ZA 4C43A 1H69A 4ZRNA 4OXIA 3CLTC 2FUKA 2RB5A 1Z39A 4XIYA 2MDTA 4G85A 3V7EA 2P6JA 2CLEB 3FUXA 5KI6A 2A7XA 4RIFA 2G09A 4PGHA 3LYHA 1K27A 4DMCA 1DADA 1NU6A 1GZVA 2R1VA 3GCDA 4IUCS 3CUWA 3AEKB 1EGVB 2XB8A 1U6IA 3F8WA 3F3KA 3K0CA 3H8SA 3HCPA 2V58A 4IHAA 1ZD5A 4WXMA 4ZD6A 2KMLA 3ZY3A 1C7FA 5KC9A 4XTCS 4CEHA 4N21A 3APOA 4RC9A 1IZ7A 1IEXA 5T4BA 5KHJA 5T3YA 2HJFC 2YW9A 4C07A 2R6CA 3QEJA 1K33A 1Z3IX 2QUJA 4A8JB 1NHWA 2FEKA 4R9UC 3ELYA 4KWCA 2P3OA 2R1TA 1VL0A 1VJ0A 2O1XA 3Q3GE 1ESDA 3DKVA 4MYSA 3J81M 2V6FA 3L1KA 3DULA 1CP9A 4M0PA 1SBIA 1FJGO 1Y1SA 1AP6A 3OZBA 3B09A 1Y3FE 2QZZA 2RG7A 1W9HA 4CW7A 3DQZA 3UV6A 3LIIA 2JK1A 3L8GA 3E9CA 2DF8A 2GNAA 1EHIA 3MTJA 4MJXA 2BBWA 3D4PA 2MK3A 4P4UA 1I2CA 4AD8A 1R6NA 2VGNA 2XMZA 1JDTA 3CF2A 2HFKA 4JP2A 2VSFA 5IVPA 1MTZA 2O4UX 4HAVA 1D5CA 4WBXC 1G5FA 4G24A 4HLQB 4WESB 4YMTA 4ACAA 3C6YA 3VTAA 3G9QA 5ALRA 3BT7A 2OFPA 2DYKA 2HRZA 4V0LA 2MSWA 1H2GA 2P2NA 2ODTX 1K5DA 7MDHA 5BPFA 5KJEA 3I56F 1YR6A 2W4IA 3RAPR 5HMMA 1KJJA 2RFLA 3TTXA 4C03A 2Q8NA 1TEVA 4MCHA 2ZYIA 1Z0ZA 3O2SB 1Y1KE 2OCIA 5AVRA 3F7VC 1W5BA 1OXKB 3EAQA 1QYIA 1F8UA 2YVQ