4ZI7B

Crystal structure of tubulin-stathmin-ttl-hti286 complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 168
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zi7B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zi7B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zi7B01
4YJ2A 3RB8A 5MN5A 3HKEA 4IIJA 5JQGA 4O2BB 4E6EA 3JARA 4DRXB 5KX5B 2VAMA 5LOVB 3JASB 4X20A 4O4IA 2XKAA 4EI8A 4TV8A 5CB4B 3RYHB 4WBNA 5GONA 4ZOLB 3ZBPA 3WGLA 1TVKA 3N2KB 4O4JA 5J2TA 1JFFB 4O4HB 4LNUB 2RHOA 3N2GB 5EYPB 4YJ3A 1SA0A 5M7EA 1W5FA 1FFXA 5IJ0B 3E22B 5CA1B 4M8IA 4TV9B 5LA6A 5LXTA 2VAWA 4X1KB 3JALB 3C8LA 4X1IB 4EI7A 4O2BA 4DRXA 5KX5A 3M8KA 4HNAB 3JASA 5ITZA 5J2UA 2VXYA 5CA0B 4DXDA 4TUYB 5LP6B 4I55B 2RHHA 5LYJA 2XKBA 1OFUA 4FFBB 3RYHA 3V3TA 4KWEA 4ZOLA 1W581 3N2KA 3HKBB 1JFFA 4O4HA 3HKCB 5IJ9B 4LNUA 2VAPA 4O2AB 5KMGB 3JAKA 3N2GA 5EYPA 2RHJA 4X1YA 4ZHQB 5FNVB 5IJ0A 4B46A 1TUBA 3WGMA 3JATB 3E22A 5CA1A 3R4VA 4TV9A 4IHJA 4U3JB 4I4TB 4F6RB 2GVIA 5EIBD 3JALA 3RYIB 4X1IA 3WGKA 5C8YB 4XCQA 3VPAA 4HNAA 5JCOC 4TUYA 5LP6A 4I55A 4ZI7B 4FFBA 1RQ2A 5JCOA 3UT5B 1W59A 5LOVA 4O4LB 1W5EA 2RHLA 2R751 5JVDB 2R6R1 3HKBA 3HKCA 4I50B 5IJ9A 2BTQB 4O2AA 5KMGA 5EZYB 5CB4A 1FSZA 3CB2A 4ZHQA 5FNVA 5JH7B 3JAWB 3JATA 1Z5WA 5BMVB 3RYFB 3RYIA 3ZBQA 5IYZB 3M89A 5C8YA 3WGNA 4X1KA 3HKDB 4EB6B 4YJ3B 4U39A 1RLUA 1W5AA 4ZI7A 5LP6C 1W5BA 3UT5A 4O4LA 3RYCB 5JVDA 5CA0A 3VO8A 2Q1YA 4I50A 2BTQA 2Q1XA 5EZYA 4YJ2B 5ITZB 5J2UB 5JH7A 5MN4A 3JAWA 3HKEB 2BTOA 1Z5VA 4IIJB 5LYJB 5MN6A 5JQGB 5BMVA 3RYFA 3JARB 4EI9A 4X20B 4O4IB 5IYZA 3VOBA 4B45A 4TV8B 4U3JA 3JAKB 4I4TA 4F6RA 3HKDA 5GONB 4EB6A 4WBNB 3ZIDA 4X1YB 5EIBC 3VO9A 1TVKB 4O4JB 1TUBB 5J2TB 4IHJB 3RYCA 1SA0B 1FFXB 3WGJA 1RQ7A 3VOAA 5LXTB 5LA6B
chains in the Genus database with same CATH superfamily
2QG9A 4LF9B 1SUDA 3ILSA 3NHUA 1IDSA 4C2BA 1TJPB 2C0QA 4G0VA 2G9VA 1LLFA 1W25A 1VP7A 1EQUA 4JI3O 4G2KA 2WVJA 2DFNA 4PY2A 3CF4G 1D03A 4R16A 5CFZA 1URPA 1CIVA 1GGHA 2RHHA 2WALA 1ZG3A 4HDKA 3NK6A 1KKDA 3B20A 3QEOA 3M6VA 4K87A 4B5CA 4PZEA 2HA3A 4D2IA 4YACA 1VA5A 3RABA 3Q40A 4KNYA 2HCJB 5K4GA 3W5HA 2PUVA 3D54D 3N8DA 1BXRA 3L6EA 4WXYB 4MV5A 4C5AA 1B6RA 2QPAA 3TUIC 3PR2B 2KI5A 2NSDA 4DV7B 4RIGA 4E03A 3K96A 4P7BA 3C3BA 4U9HS 5CMUA 5LCXA 2ZYDA 2IU6A 5FXMA 2B36A 3DZBA 4DBVO 1G20A 1U81A 1Z07A 1WHTA 5BOVA 4K26A 1JAHA 4WL0A 3SVTA 2ZDIC 3EAGA 3T1QA 1CB0A 3TQCA 3H99A 3HPQA 1ESDA 4BQSA 3GG9A 2XVZA 1KAGA 5AJYA 1JIJA 4D3YA 2WT8A 5HWSA 2MR5A 3DC7A 2VPXA 2X7JA 4UC0A 4PRKA 1T4DA 3CXCU 4E1BA 4LBWA 3AVYA 2PKYX 4LXUA 3WGMA 2VQ3A 1Y7LA 3N74A 2ZM5A 3FVRA 5A06A 3MNFA 5DM4A 1R1BA 3CXCF 1NASA 4D8VA 1JE1A 1Y6XA 4COOA 2E3CA 3QMMA 1VJ0A 3WZLA 4PM4A 3F6EX 3A4VA 3QENA 4C0KA 2O1SA 4FLUA 4LZOA 1Q16A 1QRRA 1THMA 1J5EO 2G1PA 4P9NA 3MJRA 1Q77A 2O4CA 3ICOA 1Z2OX 1FCJA 4XGQA 1FXVA 3HV2A 3BORA 4JLBA 2QBYB 1OTYA 1IHUA 2BCCH 4CLXA 4X1IB 2P6PA 3IBFA 1I7SB 1NI4A 2P35A 3D5EA 4H9GA 3WYCA 4TVBA 1N2XA 2I4NA 4BEBA 1AQ6A 4HNGA 1NJ6A 4LCJA 1YL6A 1GSAA 3C3SA 3TD2A 2YASA 3WTCA 4GL2A 4W9NC 2HQBA 1WTCA 4IGEA 3D1JA 1HUQA 4HNSA 4MDHA 1HNWO 4WPGA 3Q2KA 1E6KA 4G9BA 3DT8A 2CBZA 4D4MA 1V1JA 3IESA 4N47A 4MV6A 4Q1FA 1JDSA 3NXKA 4QYIA 2Z58A 4DLXA 4RUKA 3ESXA 3ASNC 2I65A 5JQWA 3SR3A 5B3KA 4HFJA 3C87A 1QUEA 2D62A 2DHCA 3DZJA 3R7FA 1WTAA 1SZQA 1Y82A 5B1NA 1OLSA 1DT5A 2AOTB 5AHXA 1WZCA 4JUFA 1IUKA 2POCA 4KG7A 4MGZR 3I2JA 3UHJA 4Q01A 1RU3A 4GKAA 4YJ2F 3O4JA 4LHVA 5DT9A 5D00A 2XGJA 2GPJA 1ENYA 4PBRA 3SF0A 2Q5OA 4GKKB 3AY6A 1NFFA 2Q0AA 2QS9A 2HX1A 1JDPA 1RFGE 1Q3KA 2J45A 1P2GA 3JAWB 3O90A 3O8LA 5JSUA 2VGMA 3CRRA 3R66A 1M34E 1XCLA 3H3JA 1Z8NA 1MX1A 2Q7HA 4O6VA 4PZCA 2VSOA 3L6BA 1K34A 3OZAA 1N6KA 1QV9A 4FOPA 1KWGA 4BFSA 2WLHA 4RH0A 4WKOA 1DTSA 3AUFA 1KEKA 4L8VA 1BHQ1 4O8ZA 4CMCA 1E79G 3OICA 4PD4F 4YMUA 3PC6A 2DYSB 2NU6B 4BR6A 3ZIAA 1MVNA 1WSWA 4UXNA 2YQ4A 4HAOA 4JBYA 4MQEA 1EDBA 2WTAA 3S2UA 1ZH8A 2VJMA 4P7JA 2GMWA 1UC9A 1KQPA 1Y7PA 3HTNA 3FX7A 4KC0A 1UDWA 3R76A 3R8FA 1ZNWA 1C30A 1T34A 5IDWA 2YRXA 3GCWA 3DXRA 1XZNA 2LDBA 2B20A 1KO8A 3O2JA 3MRTA 4FYYA 1GCAA 1HA3A 1B0UA 2WM8A 4GBGA 2EP7A 2QQ5A 3GPCA 3LRTA 3WG7B 2WJIA 2NYRA 4IFTA 2BMWA 4MV0A 4ZICA 5U1PA 1M1NB 4MVYA 4ALMA 3KD3A 4OEHA 3WFZA 4Q15A 3HTXA 2EULA 5DLPA 2EINC 2RKOA 3LXUX 1U7ZA 4EY5A 4GH5A 1L0LH 3OJCA 1LQUA 1Y1PA 3AF3A 1YB1A 1I2MA 4WY8A 4JI2O 5DEDA 3FYUC 1JVBA 3GGJA 1GM9A 2X8WA 3ICQB 1W1WA 2Q29A 5KDLA 1XMXA 1U1IA 2WAXA 4MQFB 1DIBA 2ZB8A 3V9AA 3BWVA 2HHAA 1Y76B 3I9OA 3FLMA 2Y69C 1M6EX 1IY9A 2ZAMA 5FBRB 2XLCA 4V0OA 1X38A 1ZNQO 4JJ7A 4GOJA 1QHSA 3R7WA 1DDGA 1YMVA 4ZVVA 1WN7A 3KHSA 5IDQA 2RHGB 2FR0A 2I55A 4GGPA 5CM9C 3S81A 1G6HA 3STUA 4MUMA 3QXGA 1PTJA 1YDGA 2XTAA 1FXWF 3F0GA 3CBQA 1BFDA 2JVIA 1W52X 1FNJA 4US2R 2WJ6A 4CS4A 1KZ9A 2VRBA 1IBSA 2FVXA 3FKQA 2C7VA 5GTDA 3GIWA 3WNZA 1O95D 1QLEB 2VJYA 2LO1A 1DC8A 2Y48A 4Y98A 2BMFA 2PKQO 1YA4A 1N2GA 3I1JA 3HCRA 2PRKA 4GZRB 3MBMA 2ZYSA 3L7BA 4RQBA 4LNUB 1QVZA 3FD8A 5M7EA 1GNSA 3BOSA 4Z0PA 4P4GA 1U7HA 2PU5A 2GPTA 1RRKA 3IYLW 1GTZA 2JARA 3FZYA 2PZGA 1X74A 3EZXA 3TRFA 1PEYA 4MV3A 1WIWA 3KB1A 4F3CA 3BPSA 1LDYA 3PQ4A 3RJ5A 1ADBA 4L0CA 5JAPA 1BH6A 1YRBA 3W5AA 4AJPA 5HY2A 1GZHB 5JAZA 4MWDA 5JCZA 1KH2A 1XHXA 4ZHQA 3JR3A 1L5LA 5DTQA 1JEQB 1JW9B 2FV8A 3Q7RA 4YXWD 2QRGA 3AFNA 3BH7A 5A3QA 1USGA 4GR9A 2JDID 4PQEA 3TOXA 2BZ1A 4CKCA 4UCVA 4RUFA 1RXUA 3UJ8A 3DBLB 4H27A 3GLTA 3B9BA 3LOUA 3S28A 4WZBA 1XUQA 5FV4A 4GMFA 3TSZA 1ICIA 4JJ4A 5J47A 4HVAA 3UNXA 3LX6A 3TJZA 1DO2A 3VDMA 1JKJA 2OGSA 3G8YA 5BN4B 1CLIA 5ELXA 5ECWA 1V3UA 3QJYA 2YV5A 4Z3KA 1GPNA 3HC7A 3W8NA 3TGUH 3C5WP 5EWJB 4UU8A 3VOSA 3U31A 2D6FA 1TCVA 2YYEA 4KMSA 4RY9A 4JYAO 1XQ9A 1HMYA 2BSKA 3K2QA 1FAFA 4IUCS 1GYQA 1WV0A 4CG0A 3EMBA 1FRQA 1SZJG 3K5HA 1NVEA 1P2UA 3RUCA 4MDFA 2VSQA 2Y0PA 3ONDA 5DBGA 1H1LB 3DOUA 3LX4A 2GBOA 1QYRA 1K75A 5BSVA 4QLAA 2ZUFA 3CRZA 2ZRCA 2NWQA 3WWEA 1O9HA 1R6XA 4RK5A 3L4BA 1KBQA 2QX7A 1XRMA 2A9HA 5DBHX 1RBYA 3IPCA 1AR1B 3D4OA 3AI2A 4OJKA 3NVKI 3SC2B 2YY5A 5E79Z 1JJ7A 2PO5A 3OCCA 5I8ZA 3C8LA 4ZK2A 1J21A 3WLQA 4JTCB 4DZRA 5E8JA 4PIVA 2EF1A 4MINA 1I6LA 2Y8EA 3UMGA 2J3LA 5K4AA 1F0YA 2LNDA 2ZRGA 2GN6A 3BL8A 1FTYA 3I58A 2QRNA 3I04M 1XZHA 2H0QA 2BV3A 4AO8A 2E75B 2OAQ1 3FSJX 1KSHA 2IRWA 4HTFB 1THZA 4BLUA 5DCWA 3TNLA 5CNKA 5I9LA 4C2AA 1PBTA 3T7KA 1E6CA 3K0CA 4CQMB 5TQ2B 2JLSA 2FX2A 3H1TA 1BMDA 4EZIA 1FRNA 5TT1A 3G9QA 4DMFA 3FKSG 4MI9A 3BD8A 4OQNA 2BH2A 1JI3A 2V7PA 4XX1A 5FEUA 2EJUA 2CXTA 3EEOA 2FEAA 2YMPA 2HF9A 4F6CA 3QU2A 1D4FA 1ZL8B 4N21A 1FDRA 2X19A 1V3VA 4Z7OB 3GRRA 7MDHA 4NDAA 3WA6A 1U02A 2PVSA 1MRZA 4RLSA 1FYJA 2VO1A 1EXNA 4EFMA 4E6PA 3WRYA 4DV6O 1H22A 1GOTA 5SY4A 1B43A 4IY1A 4GM1A 2R70A 3HR7A 4AZVA 2Q7OE 1T3SA 5HE9A 4R0NA 5KJ6A 3TQQA 3MLAA 1RXCA 3L6UA 3F5DA 4X6LA 3A1DA 3DE1X 1KC1A 1CY4A 3WWOA 5KSWB 2WUEA 5I48A 3ZGZA 1QX4A 1OTHA 3NIFB 1CQZA 1CQIB 2A94A 2FPGB 3DEAA 2ATKC 3H04A 2QU7A 1PWHA 1JU4A 2NT4A 4YV1A 5C51B 1HE4A 5IXJA 1SCNE 2G08A 4TMKA 2ZE7A 1VL8A 1H0KA 3TQIA 4LN1A 3W6UA 1ZH0A 4DA9A 1JWLA 3HB7A 3Q9NA 4XIYA 1P18A 3EXAA 5H6QA 5M2QA 1VJGA 1ORRA 1XSEA 2G7MC 3JWEA 3UH1A 3DBHB 2D1TA 3CKKA 4RQEA 9MHTA 1WHSB 1J33A 1UBKS 3AIKA 5JBNA 1XRSB 3MG9A 3VHRA 2HI0A 3F8WA 4N54A 2GLTA 2HS3A 4A6DA 1BXZA 3ZHXA 2IQIA 3NRJA 1L1EA 2DSNA 3CH7A 1I2BA 1Q81H 4GXRA 3N0WA 5G0SA 4ZDIA 5AVXA 2BSAA 1AI4A 1ZY2A 4EO9A 1OCZC 4MUKA 3O83A 4L22A 3M49A 2NUPB 4F5DA 1LSOA 1H8HA 2EFJA 1BDJA 5DEIA 3DL4A 2WF7A 4B4UA 5LP1A 4D7AA 3P4EA 2HK7A 2EDAA 1ZICA 1GMGA 3I9V6 4YGYA 1QMGA 5FTLA 4PX2A 1T1RA 3JQEA 3SHFA 3K9LA 3OPYA 1EVZA 1XVIA 1AQYA 4WACA 2W6OA 1VBKA 4GKBA 3DTNA 2XZLA 1RP7A 3IC7A 2HDNB 1QFZA 1BEEA 4TWRA 2XB4A 2G8LA 1X80B 1T8WA 5ECGC 3C4JA 2GD2A 1U9JA 4DV2O 1X86B 4HG2A 5CA0B 3LBYA 1MG5A 3HU1A 3ILHA 4DV5O 1VQNV 1EMDA 1OI2A 4QIWF 1QQ7A 1PGOA 3WR5A 3UMSA 2OLJA 3VCZA 4FJ0A 1OB2A 3L75H 1HDOA 4MGYR 4D99A 3IKFA 4C5CA 1NKVA 2F1KA 5A4DA 3IQIX 1MC8A 1FDTA 4ZO6A 3A26A 4RWZA 4LJ6A 4TKUA 4Q4LA 4GMDA 3R4CA 5F52A 4LGVA 3AEZA 1TDJA 4J1SA 2GEKA 5KWIA 1I3CA 2HHCA 4I6GA 5IWAO 3ZWAA 2NGRA 4QVGA 3DONA 4D56A 4Q24A 3SF8B 2VQFB 4KQIA 2V03A 3ZVRA 5K0EA 3N9IA 1OAKA 3BEOA 3TIFA 2YYSA 1NVWQ 1T2FA 5ARDA 3DXYA 1GV0A 3BXGA 3TG8A 3PC3A 1M9NA 2E49A 2BGMA 3AKCA 2D2XA 3ZY5A 3FRJA 3WICA 4KWEA 1G1MA 2BKLA 2LWIA 3CCCA 6GPBA 2HP0A 1VE6A 4AKTA 5CA1A 3JQAB 4FNOA 1PP9H 5J23A 2RIRA 2WE8A 3BSSA 3TSWA 4K05A 1E3DA 5C2JB 2ZJ0A 4ZKDA 1N6RA 3ZWYA 1T0KB 4KXLA 2NU8A 3CX7A 3FTNA 3FZQA 1NSFA 3EZLA 4BVQA 3G8AA 1W88B 1SG6A 1ANKA 3R7NA 4ZQEA 1X92A 1XC7A 2C1XA 1RS0A 3ED1A 4QKQA 2XTNA 4X1YB 4B09A 4A0RA 1J22A 3L1KA 2JLAA 1YCFA 3C24A 4RK6A 1XF9A 1DBSA 2REQB 1M56C 4LH7A 3IQXA 4F9EA 4RTRA 1GPKA 1ZMXA 1GIAA 2Y1KA 1IN4A 1Z7GA 1E2JA 4CTMA 3A7DA 2C2GA 4KR2A 5H9VA 4IQ8A 1YT5A 3Q8MA 3EFEA 3DNMA 3RTBA 1NVMB 2R1VB 1Y5IA 2QRZA 3LP5A 1U0RA 3DLBA 3LUTB 3T1OA 1JR3A 1Z0JA 2BSXA 1NVAA 1RSZA 4H31A 1G5QA 5EVCA 3IR7A 3HVIA 3WDKA 4NC9A 5J59A 3CG6A 1J1ZA 2HGZA 5ALQA 1K86A 4O2BF 3UAGA 5ERYA 4M88A 1DCTA 4AF7A 3BSYA 3C1OA 4RHAA 1AG9A 4EJ2A 1XZAA 4PV7A 4H1HA 5BQOA 3A6KA 3M3PA 3RVBA 4EW2A 4Q3BA 3M4JA 1J8FA 2XODA 3TS1A 2CKMA 2WUWE 1TM2A 1S9HA 2CFOA 1LRLA 4HZIA 2J31A 4OYHA 4Y2XA 4R51A 1J8YF 3HPRA 4CNQA 5EXDA 1NH2D 1Z37A 1ST3A 4EOGA 3M6MD 3H0KA 3SSMA 2H18A 3P96A 1QU9A 5E6SA 1K9MW 3G2MA 4R6ZA 1P77A 2VWHA 3HEMA 1ODEA 1IJBA 2FHSA 4ZQHA 3ODGA 3IDZA 4CDGA 4E7PA 4HXYA 4HRAA 1M8PA 4IV5A 4AF8A 1JIUA 3MWYW 2O2CA 2PR7A 4JI8O 2I1QA 2HHHO 2TRSB 1JLMA 3G13A 4X3PA 4K1XA 4DPLA 2O2JA 4R1PA 1L4HA 3S1AA 4DW1A 4BT5A 3PVCA 4MJ3A 4I50A 4CLEA 3AIOA 2WJ4A 2ATXA 2XUPA 1PFWA 3NS7A 3ANLA 1GPBA 3HWSA 3HCAA 3KKYA 5A9SA 1Z74A 3CCFA 2CB9A 3SM9A 2ISSD 5F35A 3ZHVA 1LPMA 1Z9BA 3V4VB 1H9CA 1VQLV 5FL7A 4XJSA 4CRWB 5B1AC 1JEQA 2Q4PA 3D3IA 2XHZA 4MUEA 5HM6A 2QN3A 5IT9A 2R8PA 1HDEA 1G3RA 3FRIA 1KMCA 4HAUA 2WSBA 4R83A 2YJNA 3GO4A 1KDYA 3VPBA 3O4HA 2QTMA 3G2KA 2B7LA 5J43A 2G5PA 3TL3A 2EIMC 4DANA 2VTDA 3QKTA 2AUMA 3LKDA 3V3KA 1P9RA 4GMXA 4Y2HA 3CLTD 4BLPA 1RSOA 3AVOA 1QIEA 5DCLA 1KQ3A 1G8SA 5I9MA 3BRQA 1VG8A 1E1RA 5I8PA 2J4FA 1OAAA 4XDZA 3ITKA 1LVHA 3K5MA 4BBPA 5KHJA 4D98A 3MT0A 3NVDA 4B9EA 2AOWA 2FZLA 5TQ0B 1D4ZA 1LBEA 1JJVA 1SQ5A 1EHCA 2ZWMA 3NAZA 2PVPA 1CXZA 4NTXA 5ICSA 2W6QA 5DK4A 4PA7A 1UL1X 1Y66A 3UHPA 2VA8A 4LJKA 1T2AA 4KWTA 3G1TA 1NW4A 4ZI2A 2M98A 2O5CA 4IIXA 1J0BA 4MVCA 3DOOA 1NBMG 4PX9A 3WLAA 2AN1A 3H9BA 1ABFA 2QX4A 3GY0A 1I1QB 4ZEMA 4TQFA 3C3PA 5KTOA 3EGXA 2V7VA 3K9SA 4FFBA 3R0ZA 4ZO8A 3V7YA 3CISA 5L40A 2Q69A 1RYBA 4MUNA 4NBKA 2P5SA 2E5LB 4HHEA 3W5SA 4XEUA 3VU0A 4FGWA 4OAOA 2GK6A 1S5PA 2VUIB 5BSKA 1D8TA 1UJ2A 3CF4A 3ASVA 4UJ5A 3RT1A 3CONA 1A5BB 2RGXA 4O4JB 3LWNA 3E03A 3ISJA 1M6VB 1QHEA 2ZJFA 4BGVA 1V4BA 1O95C 2V7BA 2E37A 5E1AC 1M1UA 1NONA 1BYUA 1P4AA 3BEHA 2D3WA 2H2FA 2PT5A 3NUQA 4Q18A 2R7LA 3JWGA 1L4MA 1AP6A 3JSLA 5TQ2A 1YACA 2ZVJA 4MW7A 4C0LA 4FX5A 1WBBA 5HGJA 2MSEB 3CD6V 2XNJA 5FH9A 3N2NA 2UYNB 4DEYA 4RU1A 4NABA 1Q43A 1PT6A 1YNOA 2YN2A 1TEZA 2YFYA 4HNVA 4E2ZA 2X9VA 2V1DA 4HEA1 3V33A 2GA8A 3SIPA 5CBPA 4M0KA 1JG4A 1LNZA 2GEJA 3TR5A 4W82A 3B70A 4IVPA 4MIOA 3MGAA 3DTYA 2A3NA 3PPIA 4YRRA 3Q98A 5K0GA 4B6RA 4PG8A 2PMPA 2H7VA 5LN1A 4RAQA 1WX1A 3VGJA 5FLEX 1UFOA 2FW8A 1YR8A 2P8JA 4LE1A 4ZHVA 2QVXX 5BO5A 4M3NA 2ADMA 4J75A 4UOEA 2AGVA 3OC6A 3WLRA 3QK7A 1V3QE 3ROMA 4H6PA 4MSUA 2H1WA 3CCVV 2CSXA 2NU9A 2W6PA 3TDMA 4MV9A 4A2CA 4XEHA 4L4YA 1AKYA 2PAFA 1Z29A 1OAPA 2HO4A 2X4IA 4JEMA 1R9NA 2EKQA 2H07A 1V54C 1W5EA 4HS9A 1XA4A 3M9XA 4R7TA 4UHEA 1FFSA 4RVHA 3ZR4B 4BDTA 2IPXA 4R3NA 1CF2O 3CA8A 3ZE6A 1I7PA 2O0LA 1YIDA 3W34A 4KX5A 4M21A 4L5BA 3RFUA 3D7KA 3RO7A 2DWDC 4PNHA 4MRAA 5EMMA 3FROA 1GO3F 1U04A 2OAGA 1RLTA 2IHJA 2GF2A 2Q21A 1TC1A 3SYOA 1DRWA 1MSDA 3KZKA 1GPLA 1I5EA 3LT1A 4PZAA 1ICEA 2RGWA 3H1GA 2P6MA 2Q50A 3LT4A 5BW4A 4BB5A 4BN5A 2XOKA 2FZCA 3F8TA 5LDHA 3ZK8A 3SCZA 1QHHB 2FOLA 4YR9A 4DDHA 5AT1A 2IYTA 1KI1A 2NPFA 1WB5A 2DWQA 1F2UB 3RREA 3FJOA 3NWBA 5AKHA 3O8OB 1KEEA 3HKBA 1EJ2A 1JA1A 3OESA 1JAZA 4JUBA 3K0HA 4ADSG 4YONB 2AUNA 3QITA 3STHA 1X80A 3KYDB 3Q9LA 4EHKA 2VDVE 4O1HA 3I5UA 5CA0A 1Q91A 3KBOA 4UAUA 1TCBA 2ST1A 2GK4A 5GZ1A 4C0HA 3OFKA 3CNBA 3JW8A 1NBIA 1CY2A 1QK5A 4UM9D 2Q6LA 3G49A 1PEDA 2YR0A 4TWIA 2X0RA 5BXZA 2PY5A 3MDOA 1UADA 1HE8B 2GHIA 1D4OA 3OLXA 1YI0A 1I1OA 3ASOC 2P2NA 3T7TA 3TH5A 4P4TA 2HU5A 4J41A 3FB6C 2BR5A 4AFNA 4TTTS 5J5AA 1F7VA 5LPNA 2AZXA 3DWFA 2JGFA 3EBOA 2JIOA 3AK4A 5AHRA 1P7GA 1R0WA 1KTIA 2NSLA 3H9VA 3O73A 4JI6O 3M7MX 1AUQA 1JEYB 2ZK7A 5D3ZA 1YZVA 5F12A 4QPPA 4DK1A 2HD4A 3GJTA 1WB9A 1R5BA 2EIXA 4KGXA 4V1CA 1STOA 3K5WA 2B3TA 1S4QA 1C9MA 2JK0A 1W85B 3CSXA 3I9NA 5FQNA 2KSDA 4AYXA 2JJMA 1QO0D 4JQZA 4MEAA 3SQDA 1XPOA 3M5WA 4JAVA 3VQVA 1E0AA 5HS6A 3FCYA 1YR2A 5DCUA 2C8LA 2HSZA 4WXEA 4Z1MD 3TQHA 4DTCA 3GPLA 2WIJA 1VQ5V 5EYPA 3R0PA 4X1YA 1OX4A 3EDYA 2D1SA 4OKNA 2AF4C 1KJWA 2IBMA 4URHA 1XDDA 4PPQA 5FEMA 1SC4A 3GVIA 3ZS9A 2PY6A 1SXQA 2O3UA 1T6YA 3H5RA 4HADA 1FFTB 4TRJA 4IWXA 3CU5A 3DLAA 5IT9N 3K16A 2JAWA 2WKQA 5AI6A 2BDTA 1WXIA 1A4RA 2CDAA 4RMJA 5E9JA 1HDCA 2ECOA 4D82A 2Q27A 3ANSA 1RACA 3FCCA 2G17A 4AMGA 1MPXA 3K0AA 3PYLA 1WQ3A 1Y5LA 5GJBA 2JIDA 3H5WA 3CYOA 4WBNA 2H7XA 1UJBA 1FQWA 2E4WA 1XPJA 4DRZA 3A06A 2VDOB 1FFWA 1SUFA 4XJVA 4JYPA 4I4NA 1MT3A 1ZBDA 3MRVA 2AW9A 1RLIA 4DIBA 1AV7A 5F7XA 3ORRA 4TTJA 3OT1B 1XVVA 3RTDA 3G82C 4BBJA 3OU7A 1IXRC 2WFMA 1F2TB 1JJFA 4PAQA 5GPBA 4X94A 1VQ9V 1DT9A 1IAQA 4BLVA 3R7SA 1PCXA 1Y3BE 4G5SA 2HWUA 1U9ZA 1V6SA 3V7UA 3I4FA 3FNEA 1KK1A 4RACA 3JYQA 5K09A 2ZKIA 2FE1A 2NYUA 2BN4A 2ZYTX 3HI4A 5LNK6 4GMGA 2C7OA 3MMZA 1AKWA 3MQ4A 2Y92A 4B3SB 5K8VA 2Y2UA 1NNUA 4WOBA 1QBZA 2OG1A 1L7AA 5IBRA 1NRXA 3Q7SA 1IPFA 2YIBD 1AJEA 4HGZA 2AMLA 4OHBA 3WBFA 2Y1OA 2B8WA 5EGNA 1BAPA 4FOSA 5JS2A 4OI0A 3D4LA 1XTTA 5KYXB 1DE0A 3S2GA 1EVKA 3JALA 3KQNA 6REQA 1YQTA 4S2UA 1LW6E 4PA9A 3E0QA 4MYUA 1FP2A 4NUTA 4D1YA 2HP3A 1RBZA 1NUTA 1Q82W 1XE3A 1FXHA 3ABMC 4XQ0A 3ABTA 4Y9RA 3TBFA 1JFRA 1DX9A 5DP1A 1E2HA 3F67A 3EULA 4UEKA 4MW4A 5CX4A 3WLEA 3FXAA 3CZ4A 3IVCA 4DYVA 3WP0A 4EB3A 1DWUA 4XYEA 1X7YB 1UBUS 3IVGA 5HW0A 1FSGA 3F3SA 4XWOA 1XZEA 3BS4A 4E07A 3WFVA 4MS3B 3ZW8A 3FWYA 4EG8A 3UKJA 2AC7A 1KNKA 3PFKA 5B12A 3WYFA 2J5BA 4A91A 1K9SA 1KK3A 4I9HA 2VAPA 2P9CA 2XTMA 2HPZA 3FCOA 2BM8A 1R6AA 3MHSC 3PRHA 1B3RA 3WIDA 2QQGA 2P9ZA 3AUKA 1XQ6A 3AG3B 4FM0A 2Y1CA 3EUWA 3AG1B 4RKWA 4MMZB 1BQ3A 4MLZA 3HKDB 5DNCA 1KR5A 1CEYA 4ENUA 3DV9A 4V2IA 5JISA 4BO3A 4IYJA 3DW3X 2H2AA 4YCSA 5KYYA 5AW9A 2P7TC 1GLGA 4INPA 2PQMA 3FFTA 1UFVA 1BS9A 3S2FA 2OLEA 2UXXA 2Y1EA 3UJ6A 1NUSA 16PKA 4PAMA 3WISA 3RYHB 2ORYA 4Z7QB 3ZLUA 5HMMA 3VYTB 1M34B 4JEHA 1BCRB 1HF3A 1NT2B 3L7IA 3UMRA 4PS1A 3UCFA 2G36A 4L9WA 4CU5A 2B69A 5JARA 1G4HA 4MVWA 4MRMA 4BT6A 2ZU0C 3CX8A 3FKSA 3AF1A 2YXYA 1YZTA 2B33A 4P9PA 4BFTA 4JBXA 3GLKA 4XWAA 1ZC3A 1YGYA 4JEUA 4DILA 3C5CA 1U1EA 1E1RG 2N47A 1NJ2A 4RVGA 3ZU5A 1I0IA 4P0QB 3LD9A 4IRXA 5B1YA 1H9AA 1ZVJA 2ZAIA 4UHCA 4IF4A 3ECCA 2NUTA 3ORYA 3PV0A 4Q93A 1IBMO 1XZCA 2AG0A 1DHTA 5IBQA 3VNQA 4CF3A 4B79A 3OURA 3QEMA 1EZVH 3QQ5A 2VYVD 5KJ1A 1UFYA 4BATA 2VKTA 3DAGA 1U1GA 1E3IA 3RR2A 5K99A 1QR8A 3GRPA 5HKBA 1FNBA 5BSMA 5ALOA 1CR1A 2FG6C 3PIIA 2YWBA 1FKAO 2K9PA 2F1IA 2CNNA 3UGTA 2ICAA 3E7WA 3KCQA 3OJWA 3L7YA 3FDIA 4BBAA 1JDBB 2ZBEA 4DR1B 3QTCA 4CG1A 4GI5A 4OB6A 3R0QA 3CLTC 4ZP1A 1OA1A 1LB1B 2DHDA 1ZMRA 2XMZA 4B2PA 2ZXWC 2ZR2A 5M3BA 1E3TA 1UKAA 3K5OA 4NNOA 3LVBA 2UZIR 1QC5B 2BFCA 2NLJC 3WOHA 4KXUA 2XI4A 4MKIA 1N1GA 1ZJJA 1Q14A 5KUTA 3LPLA 7AT1A 4NG5A 3UTDA 2FMIA 3PT9A 4PTLA 2PQ0A 2WG2A 1OROA 1QVVA 4G0YA 3G2QA 3CRMA 3HB5X 2XLBA 2ZTMA 1W7AA 4F93B 2R85A 3AZPA 3TIXB 3DVQX 3E18A 4PLCA 2G88A 3I5DA 3V8QA 3U17A 4Y2SA 2MQEA 1USVA 4G0WA 2TMDA 1AGXA 1SC3A 4C20A 3EVZA 1N5JA 3JQGA 5COQA 3LS2A 3CMAF 4NZNA 1RAEA 4WXRA 1LI5A 2YCLA 1XFDA 4ZQCB 5EAIA 9ABPA 4ZZ0A 4DSOA 1TU0A 4OHRA 5DSZA 4HDQB 3MTAA 1A77A 1E3QA 2ZXEA 4DV3O 2APJA 1BE1A 4BO4A 4L8LA 4ICIA 4HWRA 4G9GA 4P0PB 3OIGA 5HZMA 2WT9A 1YQ9A 1YIJV 4WE3A 5DFAA 1RI1A 5A4IS 1C4KA 3QVXA 2Q6TA 1R6DA 3AP1A 4J0EA 5B30A 4DLLA 1IOZA 4RQAA 2QN8A 2J5KA 3RBVA 3ESAA 2BGGA 2BP7B 1NMYA 4DABA 4X97A 3HNPA 1AQUA 3S44A 3HS3A 2AEFA 3C5VA 2YN0A 1YRHA 2QDKA 2QMOA 5GTIZ 2EL7A 1TPZA 4M87A 4FR5A 4QULA 1NZ6A 5IPFA 3PJSK 4UKDA 1ADGA 1E94E 2DJ5A 4PYNA 2VA9A 5LXTF 5LLDA 3K6KA 3ZXXA 1JJAA 4C43A 3UB4A 4D9IA 2YZMA 3IPRA 1GTL1 3KCXA 5JNLA 2F3PA 1XGKA 2XSZD 1A9SA 5DM60 4ZYTA 4G3XA 5C53B 3I9JA 2BTQA 3ZJZA 5DHSA 1UEIA 1NQTA 4KLRA 1N0WA 3E7DA 3IPAA 4B44A 1PVOA 4DXWA 2RD2A 2ZEJA 2ZJOA 1PWYE 4E4YA 2F3TA 2J0VA 2Z9BA 2GJSA 3F7YC 1JYFA 5FPHA 2QTLA 4N3NA 4UU1A 1CP2A 2QN9A 4BFYA 3RVDA 1YZYA 3PL1A 4O4HB 1KDPA 2OO5C 3GG2A 3NYWA 3NTUA 3MINB 1A9YA 5L53A 2R6CA 4X95A 4UCQA 3RT9A 4EFNA 2XYGA 1D8AA 3OGIB 3LWOC 4QBGB 2BUAA 2XOKG 3L1IA 1VYHA 2ES4A 1SQ0A 1BMFD 4J0IA 5MGNA 4K9DA 2RDMA 3C8MA 4EGFA 1FPOA 4LBZA 2UXDB 4B3DA 1OSNA 3SQMA 1JV2B 3LWVC 3LY5A 2NV6A 5LBQA 2OECA 1HI9A 4S1VA 5CYFA 4WXMA 4W5QA 3G2NA 2ZYAA 1DT3A 3RYCB 1MOSA 2VCHA 2XWJI 1Z13A 4NMWA 2PH7A 4UVGA 5CDFA 4I6JA 8ABPA 4I8IA 2PS3A 5FV7A 1OGIA 1J49A 1VE3A 5DIFA 5D8DA 3O82A 4UTVA 1VL1A 3ND5A 1VLJA 3OT5A 1W36D 4GX1A 1YJNF 4CCYB 1UJ4A 3EIEA 4RMGA 2WU4A 2QSJA 5FBZA 2VQEB 1TKRA 2I1VB 4BRSA 1FVOA 3FYDA 2DHEA 4DCMA 1L5QA 1V6AA 3UK0A 4KNVA 5LJIA 1TIPA 5H82A 1YVDA 1UMKA 1XYGA 1XMQO 3HO1A 3ABKB 1IBCA 3EGOA 3LK6A 4ND3A 1ZA2A 2AKYA 4MVJG 2UYHA 4D9HA 3ABRB 4KGZA 3KQOA 4GI1A 3WYBA 1S5HC 1VCMA 4R2MA 4UV8A 4QT4A 3KHKA 1ZX3A 1M66A 1XVLA 4R8LA 2CXXA 2A9JA 3DCJA 3QXCA 2PH3A 2GD1O 3AMVA 1VF6A 4HWGA 2Z3WA 1L8QA 3C6BA 1JMKC 4MLCA 4UARA 4HB2A 1N2CA 1F2TA 3NYIA 5AKGA 3DMTC 3IDQA 2AJCA 3LTEA 4XDLA 3RVOA 1Z5OA 3CWQA 1QQTA 1ADYA 4G1VA 3LUFA 3LLUA 4JEIA 3FD5A 1UKYA 1Z4JA 1V7CA 1U9CA 1WY7A 1JPVA 1XCGB 4AU1A 1KRWA 1RAHA 2WHYA 1QKKA 1K4CC 2VRWA 1MW8X 4GWKA 2G40A 1GL3A 2PUJA 3ZBHA 4ESOA 4GEGA 1K6JA 1AVTA 3L40A 2C8VA 4K40A 4NJEA 3ESYA 2BFBB 3NM4A 3IR6A 2EFEB 3VV2A 2DY0A 3AONB 2HMUA 2HA4A 3QO8A 1KO4A 3IKJA 2HK6A 5FOUA 2OOSA 2FSFA 3R3XA 2ZI9A 1XZJA 1ORDA 4QBIA 4I5SA 1ND5A 3FIJA 1V5GA 3LCVB 2RH8A 1MFPA 121PA 4GPBA 2NQ8A 5AJWA 2AKEA 3F0FA 4LSGA 4F4LA 3OEWA 1MJ5A 2VEOA 2W2KB 1XTQA 1K7CA 2CLMB 5HPYB 5GIOC 7REQB 2P06A 1T4CA 4ZT4A 2MSDB 3S1SA 3TVDA 2ZB4A 3H19A 5CT6A 5ULLA 3NHSA 4O8CA 3BTUA 2VCEA 5ISMA 3G59A 5B3AA 2H51A 4BO6A 3E8HA 3TQSA 2AHZA 2AWNA 3V8RA 2XRFA 2CLHB 3U39A 1NNSA 1OC2A 4DO2A 1H2LA 3D8UA 3EA5A 3FMGA 3QYJA 3SJCC 3ZZ1A 1H2FA 2CH7A 1E4VA 4RZUA 3LF2A 3A3YA 1T3GA 4YV2A 4G8BA 2CTRA 1NBMA 2IS6A 1EUCA 3E3AA 1POWA 4FE4A 5ILGA 3I53A 1YOVB 1P62B 5M5BA 3OZIA 3HL4A 2WYUA 5CM2Z 2DTDA 1U8YA 1U2PA 2D0IA 5AESA 3JD2A 2VH1A 1IEVA 4DJFC 4E94A 1C0LA 5DBEX 3MM4A 2G5CA 5F2KA 2C82A 3WZ2A 1IVYA 3CRNA 5CT5A 4C89A 2JLRA 3NALA 2QRLA 3KPUA 2OLKA 3C1TA 1F1JA 3ONWA 3AJ9A 4NBUA 2FU5C 4HQLA 4RV5A 4LXHA 3KT6A 2R8EA 1PR6A 2YXPX 5HTOA 2ROQA 4TWAA 2WJHA 2AIRA 3S2EA 2J08A 5HXUA 2QKYA 2CZCA 2HJ9A 3ZE0B 1XJ5A 3WHIA 1E3LA 3SXUB 4JJGA 2NZ8A 4BVJA 2D7CA 2RJOA 5L3CA 4HQOA 2NR5A 4FMCB 4QUAA 3MTDA 4AW9A 2EIJC 1KMQA 4YFVA 4EK9A 1NL3A 3U10A 2OQRA 1L8LA 4X62O 3KSDO 3VOBA 3OH8A 5ITSA 3SXJA 4P82A 3Q3JB 3CZQA 1N7IA 3HN2A 2PG3A 2FUG1 2O2ZA 4QE3A 1WCWA 3AJEA 4D8XA 3W5UA 4HX2A 1HT3A 1PFKA 4OF4A 3HO8A 3INGA 5LQCA 2HQSA 1XHZA 4DZTA 2V0GA 5KNLA 1O6ZA 4DL9A 1JDVA 1U90A 3UVEA 5B1EA 2CDRA 1QLNA 4BEVA 2CL5A 5SZHB 4DE5A 4OLFA 2W6ZA 4LY9A 5DSTA 4WN9B 5CCEA 2C57A 1THGA 4HN4B 3ZU4A 1MB4A 5T4EA 2WSIA 4XQCA 4JJ6A 3UXEA 2WBLC 4GUAA 1TM7E 4WINA 5I9TA 2GFIA 5E38A 2DFVA 4BKOA 3C6KA 1AS3A 2GQ0A 2I7TA 1YDXA 3TRJA 3AHJA 1N33B 3VO8A 1RJFA 2Q5JA 1QPZA 3QU5A 4WCFA 1U65A 2DW4A 1VLVA 3AESA 3DHVA 4IZHA 4TMWA 3SDLA 3H2BA 5T6BA 1VHWA 2HDOA 2HQOA 3R0JA 2JIMA 1YGPA 2ZYRA 2AX4A 4PHZA 2YZGA 1NX9A 2CUKA 4HO1X 2YFKA 4KRXA 3EVNA 1ZGJA 2VP5A 1U0BB 1FS4A 1KKCA 3W7BA 3AR8A 2VC2B 1HK7A 4F6LA 1WSBA 1WETA 4NULA 4AZTA 4B8WA 4FD3A 3BIOA 4QICA 3CVWA 3O9ZA 5AW7A 1H2BA 3HRKA 2QUZA 3AR7A 4NIMA 2WWVD 5CD1A 1UWKA 3OOWA 4K46A 1R4MB 3U4QB 2YS7A 2QRUA 4BFUA 1MX9A 2CNKA 1Q7YH 1V2GA 2Q0XA 1LUAA 3BRSA 2NVBA 3IEMA 5IN5A 1KMIZ 3UW1A 2B2XA 2PKXA 2QYTA 2IEDA 4L16A 4V3CA 1J7HA 3B5JA 3IJ4A 3RBAA 4MV1A 3RJ9A 2N1MA 1QQ5A 4M60A 2HLDD 3HCWA 3OO1A 2C2WA 1OASA 4M22A 5AI0A 4DG9A 3Q2IA 4A03A 2IP1A 4G56A 3HK2A 5FOXA 4DR3B 3CMCO 1MOZA 3OTOO 5LHHA 4BJ1A 3RG2A 5HZGA 4HDAA 4DLNA 2W90A 4RLFA 3U37A 3BWEA 5ARBA 1U0LA 5ALNA 1Q6YA 2I76A 4F9FA 2XBUA 2BE3A 4O0LA 2GJ9A 2WICA 3C3WA 2IV7A 1DBFA 2WLMA 4M0UA 1F23A 5BR8O 3VQYA 4PO3X 3KQMA 1QCZA 1M10A 1YHQF 5G3ZA 2QN1A 1E2EA 2YHBA 1A9TA 4IQGA 1BG6A 3BERA 4EUSA 3EPRA 3W7AA 2RB5A 4E2YA 2FEWB 2IITA 5L7TA 2CMDA 5LOVB 2Q5QA 2PWPA 4X88A 3VYUC 5EIXA 5K3OA 1RLOA 3B7WA 3PC4A 4FWTA 2QBYA 1DQYA 4CT0A 1C3VA 2X7HA 4X1IA 3MA0A 1EJBA 2F3UA 3PNPA 3ND8A 2UKDA 3K0GA 5MDHA 3CZ9A 4HR7A 2F4VO 1XMOO 5L95A 2YYYA 2JFGA 2GWRA 1UK7A 1WDWB 1E8DA 4ZO4A 4BVGA 1Y6QA 1T4BA 2H7YA 4DA7A 3WWYA 2X2OA 4K88A 1XD8A 2W0XA 4KDEA 3JSXA 4WWHA 2H29A 1MOPA 3PFBA 1MC5A 2CLLB 4D9NA 1AXRA 1H2EA 1LCIA 2WSSG 2OV2A 4KR6A 3TOSA 4TT3G 4EB0A 1OH7A 1F5NA 5F7OA 1G2IA 3O8NA 2PGAA 2C9MA 1JKMA 2ZOSA 4U6NA 3LLSA 3FH0A 1AVMA 3DL0A 4GO1A 5G1PA 5HJEA 5DU2A 2ID9A 1S6YA 1IJFA 2IYEA 3CNLA 3I45A 2QRPA 4F1JA 3GP8A 2KE5A 3FTQA 3WNVA 2AOTA 2Y77A 4PGFA 1UFRA 2RARA 3HMQA 1RYMA 4EPYA 1YHYA 4N65A 1IUNA 4OBEA 5BMVB 4EKGA 4BU0A 2GSWA 4CCYA 1WNTA 2Q3DA 3B2QA 4DQVA 3GLSA 2YY7A 2WLLB 2OB2A 4IIHA 2DQ3A 5FI5A 2PS0A 3EPKA 3JAWA 5BWLA 3M81A 2PHNA 2KLHA 1F51A 4P34A 4DR5O 2QG6A 4GZ5A 3SLKA 4OM8A 3TJTA 3QNUA 2C2XA 3OCZA 1HYHA 1SJ9A 1MV8A 5C8ZA 4GBED 1J20A 4YQZA 3GLGE 5FPTA 2NU6A 2PL3A 5EHGA 3TIGA 1MEEA 5HHTA 4B3MB 3WDSA 2EKPA 2WG1A 3IJ5A 3B2EE 2PDAA 3B5IA 1P1HA 4OGWA 2BMAA 3S40A 1UBSB 1Z5PA 2AXEA 2E4AA 3EAFA 1NVPD 4GYYA 2JGJA 4RZSA 2QX9A 4XPIB 2GTAA 3BHIA 5K01A 1SXJE 4FINA 1DG1G 2X0NA 3QPVA 3ZWQA 3FTCA 3EIWA 4C0JA 2WMYA 4F9TA 3ENKA 2LV8A 4DUYB 1EM1A 1VKZA 2ZLBA 2WNHA 3B8HA 1JA8A 3AHIA 3NOQA 4DLPA 1M1NA 4XASA 3H0EA 1E1QG 1V37A 5DN9A 1WU7A 4UVDA 5CB4F 4RTOA 2AMVA 3JCMM 4KREA 1E69A 1FU8A 3R5FA 1AZWA 4CU2A 1CUWA 3PI6A 3AG6A 3BFKA 4G86A 5EL0A 3ZUGA 3LDTA 2W7TA 4IBOA 5DHUA 1XKXA 1MABB 1N7GA 4IJQA 1B1AA 4MQFA 1Q6ZA 1BDHA 3DYBA 3CLSD 2ZR0A 3FMPB 4D25A 2VUTA 1Y76A 4DKJA 5KIAA 1RYHA 4GWLA 1M0EA 2WU0A 1VKJA 2PYJA 3IEKA 2OORC 4HQNA 1Y4UA 4A8TA 3BJZA 1ENZA 4WBXC 3HR4A 5L3DA 5JVDB 2R6R1 4DBLE 1RBMA 1TA9A 2DPGA 5JC1A 1VZ3A 2PGNA 1P31A 4RQTA 3FD9A 3H83A 4L73A 1Z0IA 4BZZA 2C4VA 3JARB 3U7JA 7REQA 1Z34A 1T43A 5KSYA 4MLDA 3QHDA 2AC2A 1K8XB 3NEYA 2QE7D 3L9XA 3UMJA 2Q7EA 3HXTA 2IYYA 5EWLB 3HJBA 5EKUA 1D1QA 2RHOA 5C5DA 2I6GA 1OCCC 1CU1A 5HQ3B 5FBWB 4QAQA 4CCAA 1M8JA 10MHA 2C9YA 1RXEA 1U7WA 4BQNA 4GT1A 4LFAB 1D7AA 4LNUA 4NU6A 1W36C 1N5IA 1V55C 4WFJA 3KSBC 3SJBA 4FDVA 3BCUA 2J7PA 1ZXXA 3EC1A 3LUPA 3FNQA 4O4LB 3CEIA 3CG4A 5D3QA 5LMCA 5B1SA 2VK2A 4OQMA 2O20A 1X9GA 2DUWA 3DVLA 1TMKA 3RPEA 3B1FA 3NATA 1GEGA 3BHMA 2Q9BA 1N0IA 1BS1A 1JHOA 4S05A 3BMXA 2B6NA 3X0DA 3L7CA 3SHWA 3OJOA 2UAGA 5C46F 3BXXA 2OCXA 3PQ8A 3LBAA 1G8JA 4RWUA 3DBLA 4JKOA 5FL7D 1GR1A 5B57C 3PITA 1SCKA 3ZE8A 1ISSA 5C0OE 1KBZA 5IVDA 2BMJA 2DF8A 3IT2A 1UWCA 5BR7A 2J41A 2ODPA 2ZETA 3ZTYA 2G04A 3CLKA 2TECE 5F7JA 1WOYA 3RI3A 2JGDB 1ULHA 5BN4A 1LBSA 5B4VA 3WO0A 3Q15C 3ZNNA 3E15A 3EEQA 2OHJA 3L43A 1V3TA 1Y1TA 5EWJA 3H5OA 4C01A 5F1YA 5AVTA 5HP7A 2WM9B 3N0TA 3O4GA 2HDHA 5HIIA 2XV1A 2QTAA 4RORA 3BICA 3D6NB 4MKGA 3TDNA 1XPRA 4NH0A 4DV4O 3MJTA 2C9CA 5ER9A 1YQQA 1GUBA 1TT5B 1MUUA 3OW2U 2L17A 5D7BA 1UF9A 1H1LA 1J8VA 1KEUA 3P2EA 4NXNO 3F0TA 1L3BA 2OYCA 1XTKA 1CR2A 2UUOA 2VJDA 1EGAA 3OW2F 2VPTA 2D0OB 3MAQA 4GUNA 1XEWX 2Z08A 1W6RA 3FOCA 3E8SA 1ZDMA 1FDSA 2RKBA 2JAQA 3SC2A 3SX0A 1NXTA 2NG1A 4FIZA 4OHMA 3GVHA 3EMVA 4CH6A 2H63A 2C31A 3NHFA 3KD2A 4EGQA 4FN5A 4CF5A 4YUWA 4BNDB 3VR2D 3NTLA 1KYQA 4Y2UA 2A1IA 2HS0A 1YQXA 1Q1EA 3OECA 1NUPA 1XCJA 2GHYA 2IOFA 4JUAA 5IFKA 3LCJA 1DXHA 5CXSA 3OAAD 1X13A 4LSZA 1KYVA 5B6PA 4DM4A 4RXTA 2ZE6A 1PR4A 3OE5A 3TN7A 1F0PA 4ZJUA 2Q1YA 4U2FA 1HORA 2VWQA 1PTJC 4HTFA 3ADCA 5JRDS 4A0QA 3SIRA 2BHRA 2YWEA 4NB5A 4QPJA 1RD4A 2J1LA 2VWGA 2J3JA 1PV2A 2CN1A 1NJGA 4QSMA 2AMFA 2FN4A 4CQMA 2F00A 3IUSA 1JB9A 3GNQA 2VF2A 4CM9A 4RE5A 3NK7A 1EFRD 3LKVA 2NSJA 2HNBA 1Z7EA 4PSUA 1OCOC 4J3JA 3WK4A 2PSEA 1ZL8A 4XQEA 2JJYA 4DBZA 1E4OA 4PCAA 1B0PA 3BB3A 1TU3A 1VK3A 1MIHA 1PNQA 4X71A 4IF6A 1VCNA 2BF4A 3ZVLA 2GBGA 4MYTA 3VDQA 2DX7A 4OHXA 1ZK0A 1AJQA 5FQOA 1HQDA 2WLJA 1C7RA 1BXGB 1SUPA 4YCMA 1XCPA 3OCUA 2OMEA 4E1VA 1FDWA 3GP3A 3ADDA 3EHEA 5A2QM 1DBWA 3LO8A 1RPJA 3PQ2A 3TBHA 3VHXB 4BJ5A 4UDNA 3DR3A 2F9FA 1JWAB 3GUCA 5C81A 1R3JC 3SGLA 4H3SA 4X84A 5CNIA 3KUKA 1H93A 1CQIA 1NF2A 4H1UA 2FPGA 1BMTA 1ZZGA 2X5OA 5DM70 4BASA 1NN3A 3RB8A 2PSJA 4BX3A 1ZQ1A 2N1BA 4BNZA 5K1PA 3KZIZ 4E1AA 4IXTA 4MT8A 2P2YA 4A6PA 4RM2A 3T3HA 1J8QA 3D6FA 2LW1A 1E32A 1LRJA 1H2NA 1E96A 3D1LA 4F4FA 3L4JA 3D81A 4DW0A 3DBHA 4M9ZA 1N78A 2JGAA 1T8UA 2P69A 4JB0A 2FA9A 1WHSA 3GLHE 1E3MA 3F6RA 3EGEA 4OHUA 5LOVA 3K4PA 2RK6A 2MU1A 2R72A 3IVMA 3GAZA 3IHKA 4R31A 2G1JA 5CVJA 2GETA 3H8WA 2AW3A 3RVNA 4FE7A 3PP8A 1Z63A 1O8BA 2J5XA 3H1BA 2ZM6O 4LBEC 4O25A 1WL8A 2PZBA 3GHYA 3RSGA 3OEYA 3A10A 3W8DA 4I5EA 2UUBB 2FGKA 3LA6A 1A9QA 4JGBA 3QWBA 2NUPA 1KJZA 3UTCA 3U19A 3TEFA 1QFJA 5GIPE 1I51A 3E83A 2WJAA 4XGIA 3WJAA 4JCCA 3L4BC 1RM1B 3LDHA 4R8MA 3TTXA 2EBHX 1JQ0A 4TWKA 3RD5A 1XZMA 2ZKLA 3VR1A 4FCVA 2R5FA 2VL7A 2C7GA 3GDFA 3W7WA 3VR0A 2J6IA 2PUBA 3E70C 5JCXA 2OESA 1ZR2A 4LF4B 4KHPO 4Z2AA 1DARA 1KNXA 3GJYA 3D36C 2IY8A 2HU2A 1YJ5A 4E5UA 2QXUA 3FTDA 2UUAO 4YBRA 2BD0A 4HB4A 1GQYA 4PC1A 1T1EA 5CFPA 3UQZA 1YZNA 1L9KA 3U3DA 5C7IO 1I94B 3GOHA 1RJDA 2P9GA 1GLNA 1Q0SA 4QQ8A 1J7JA 3PQ3A 3S0HA 3IH5A 4Q0MA 3BT7A 2ZIAA 1ZGAA 1YTFD 4R0MA 5TPWB 5K2OA 2IYUA 2PCJA 5G02A 4JROA 4YYEA 5ESWA 3K0CC 3IAXA 2J9GA 4X65O 1KSFX 1I2AA 3WB2A 3NWJA 3CUWA 4QHSA 3TPZA 4GMHA 4LSWA 1ZGZA 4MI6A 1IY0A 3D5QA 5EJIA 3W7XA 3SF8A 1R74A 2WLLA 4MVJA 3OLVA 3V4OA 3T3MB 1Y9EA 3VR4A 4K5QA 2PCLA 1VQOF 2RNBA 4UCFA 3T9DA 3N6RA 4AJ1A 4K9MA 1MGPA 1BNCA 4L72A 3QV1A 1CUFA 1UZLA 1E79D 4DHWA 3N28A 3WJ2A 1LSJA 4HNUA 3WRYC 2OVFA 2WHPB 2XA2A 2EEZA 4KQ1A 3JQAA 3ZBTA 4J90A 2Q28A 2GPWA 3RODA 4KXRA 3N6VA 2AB0A 2W6MA 4I19A 3B53X 4U4AA 1KJQA 1A2KC 5K1ZA 5CFQA 1FNSA 5E4TA 3VOTA 5IKPA 4RMHA 1TTPB 1W88A 1X70A 2NYVA 4CIBA 1EFTA 4E2LA 2PUWA 3RS9A 2EJCA 5JAIA 3QOYA 5AK5A 1Y8CA 3SBEA 3JPWA 4AT1A 4M55A 4XLZA 4RVDA 1Z12A 5K4HA 4D9KA 5IAJA 1AGRA 2WIDA 1H2RS 1PV0A 3M84A 5C32A 3TUZC 2REQA 4TQUS 3KHNA 1ESEA 4R2KA 1M8GA 4ZOAA 4M1EA 2H16A 4XAQA 1VI2A 1JQAA 2WG0A 2X5XA 1ZK2A 1SQSA 2D4AA 2F1HA 1V5IA 3OOYA 4HD8A 4JI7B 2R1VA 3NVMB 5LU8A 1T2VA 2X58A 2X4LA 1JDZA 2GRUA 5TVGA 1MABA 1O54A 4QFBA 3RBXA 4OQ4A 5KTSA 3PWTA 2V7QG 4TV9F 1CJCA 1E0JA 4R9RA 1QWOA 3SWWA 3DAPA 4GKVA 3RVZA 1Q7CA 4LJ5A 4G0NA 1E2QA 4C03A 2C2MA 3P7MA 3SIWA 3LX5A 3ZRVA 1IZ8A 3ELWA 4I1IA 5EJ7A 4J3FA 4BCCA 1KH3A 4H6WA 5AH0A 3BABA 1VBMA 3OQHA 4B3RO 3OHPA 4JPRA 3KJKA 1TLTA 3LUJA 2AI3A 4XQ9A 3KPVA 1DU4A 5T7BA 5DYGA 3GYGA 2GNOA 1KS9A 1GNVA 1QANA 1HLPA 5C5IA 5D3MB 2RHJA 1YJAA 4M99A 3JATB 4OOEA 4BUCA 1LW7A 1WO8A 1P73A 2OAEA 5MFZA 2IODA 4RKFA 1QF7A 2ZTLA 5DHQA 4B6FA 3L1HA 5B2FA 2VP6A 3QVGB 5TJ9A 2I2CA 1RAGA 1OYOA 4WNAB 1DOAA 4E32A 1W96A 2ISQA 3TGPA 3L7KA 3ASZA 3BX1A 3SJUA 4OX9O 1G4UR 2IKQA 1GGFA 3V55A 1B2LA 2Z09A 4F4IA 3T7SA 1XP5A 3OFND 1ZIXA 3NI2A 5IC6A 3ENNA 3OU2A 4NXMB 4KTVE 1KECA 1ZU5A 1UBHS 2XWQA 2X0FA 2EX0A 2I7DA 5FX2A 1I3KA 3GFTA 3OZFA 4DLTA 5TX7A 4RZ2A 3G5MA 5DECA 1UFQA 3PRJA 4BFLA 5K0BA 1HFJA 4J0HA 4LHWA 4G1EB 4DKXA 2RGNA 1RDFA 2NPIA 1B15A 4ZMRA 3R8CA 3L8ZA 3DE6X 1WR8A 4MPJA 2VXOA 4XOUA 2OXFA 3GZJA 3ZNQA 1ZLYA 1EXMA 5KNCA 3H6GA 3NNSA 5JD6A 3CH6A 4IH9A 1P6UA 4B3GA 3CUYA 5IE9A 1EHYA 1VQMF 1W4CA 3ULKA 1D0VA 3CCMV 3LYLA 3UAVA 1TJNA 1R6VA 2X3YA 3GYBA 4M7PA 2RE8A 2AHOA 4Q39A 5E3JA 4PQYA 1DIHA 4EP1A 2QX8A 3ZXUB 4RNDB 3WGHA 3P2IA 1RHRA 4BQEA 3URMA 3G0CA 2FZEA 2XAAA 1DKNA 4DUPA 4BYMA 5TQ0A 4RD6A 5ICCA 5JFOA 3A8TA 1LK0A 1G64A 4Q48A 3PXXA 4I1UA 4CMAA 2Y3IA 2QGNA 3SDBA 3WYNA 1ZTEA 1XKTA 3RYTC 2Q3MA 2LZ0A 5I7UA 2XXAB 4K8RB 1H5UA 2HBQA 4LISA 2FSSA 1CRWG 2BFEB 4F60A 1J39A 3CLSC 4BFZA 2ONKA 5KYUB 1Q0ZA 5F2OA 1P2SA 3HSYA 4TMYA 1TE2A 1BWRA 4PX3A 3AEXA 4FKBA 3VYSC 5EA2A 3T9EA 4ZZ3A 1M75A 3HGQA 3JYNA 4OIMA 4KUGA 3ME5A 4LQ4A 3HDHA 2EYUA 4HX5A 1XIVA 2F67A 1N34O 3M1LA 1W8IA 5EXSA 3E3LA 2YXBA 3FGOA 3V8NA 3DHEA 4GZMA 4O4JA 1FUIA 5HMLA 1I7LA 3HN6A 4I4CA 1M6VA 4U2DA 2MTBA 2NO0A 1JSRA 1EZ4A 2QL6A 2P7HA 1ECJA 2YJZA 4Q19A 3WLNA 1X1CA 4HEQA 3Q41A 1NDQA 2DP4E 1BD4A 2QM0A 1ELOA 3IAS6 3AIMA 2X3FA 3HRIA 4Z2YA 4RH3A 3QU7A 3T5BA 4AILC 1U11A 2CNDA 2VHZA 3I5XA 1S72V 2YICA 4NU0A 2UYNA 1GNPA 5C37A 4PC2A 2B4TO 3B09A 4BC1A 2GILA 2IY9A 3OCXA 3A28A 2MYPA 3U81A 2Y66A 3ABUA 2I87A 3KCYA 1MQSA 1Q1GA 3KV1A 1I7FA 3SZ3A 1P3JA 1BXGA 5IFLA 4KDCA 5EIHA 3WP1B 3M6AA 5A3SA 2VJLA 1ECPA 1HTBA 4MICA 3FGZA 4TZKA 4W7IA 4YWHA 3AOEA 5F9FA 1QYXA 2OFOA 4CE6A 1G38A 5HFMA 3F98A 4LHZA 4KE8A 3EWAA 4IAOA 1DX4A 2O3JA 4RMIA 2CLSA 3LH5A 3FNIA 4W5NA 2VPQA 1DJLA 4QWMA 2XMGA 4TPKA 4Q3DA 2G06A 1E6EA 3P26A 3V7FA 1VG0B 1FP1D 1BJKA 4LCEA 3RIYA 5HA5A 1GU1A 3V48A 4NV3A 1RABA 1ODFA 1XMSA 3JYPA 2NNWB 2J5RA 1S02A 1X1QA 4YALA 4F38A 3R09A 4E4RA 2JLBA 3FOAA 1NF8A 3IA7A 3BCHA 4PI0A 2PWAA 1CNMA 4IRUB 2FWPA 5J63A 3DZ8A 1SEVA 4FUTA 1QRSA 3HSKA 1PZMA 4RV9A 4CV3A 5LL6Y 1FBNA 2P78A 2GM9A 1O94A 2QD4A 5LHIA 1D09A 1N7JA 2N0SA 3IRUA 3A1WA 1QNMA 3E8FA 3OG9A 1N2BA 4K6OA 1S2LA 4UPDA 3C9TA 1Y4ZA 4ZT2A 3TCKA 1GQFA 2QI9F 1TFUA 2J5QA 4D9JA 4LHXA 4WASA 4HV4A 5K5EA 3FIUA 3O4VA 4CFYA 3C90A 3BXPA 4RESA 2IHVA 4CZZA 2YINC 1TKBA 4EY3A 4JSRA 5LZ9A 3RA6A 3RC8A 2V65A 2H5IA 3Q0IA 4IRMA 2PX8A 1W47A 2WSSA 1QHHA 5ETJA 4A16A 2BEVB 4TT3A 1VI5A 3HU3A 5DTJA 5IT4A 4FMBB 2JFBA 1K33A 1F2UA 1YQUA 4JVSB 3KUCA 2HJWA 3O8OA 2A5GA 2B21A 4PLTA 4PYQA 1GQRA 4GI2A 4B32A 2WD8A 5HK9A 4CEIB 3AG2C 5LP6F 3AKDA 3JQ6A 1X9HA 4CT4B 2R1ZA 4QUJA 4DMKA 3STLC 3KYDA 1OBCA 4Z4FA 2Q3BA 4DCSA 3N4ZA 1ZRMA 3VVLA 2BJHA 2ZUUA 2EHDA 3FPFA 2XQGA 1IONA 3PHJA 1ZIYA 2QLLA 4GLLA 2PD6A 5IUNC 2F90A 2GCOB 4LG1A 4N0EA 3UO8B 3ZDRA 2AXTZ 2FPPB 1QDEA 1QIIA 4A5SA 4IIBA 1WJZA 3PLAC 2G38A 4MVJH 3VR4H 4YNBA 4M1ZA 2FPSA 5J2TF 5B1IA 4EVIA 3H5NA 3IBSA 1AC5A 1N5KA 4BE9A 1CY8A 3JV7A 3T99A 1T4GA 3LCRA 1YI1A 1C1HA 1CD5A 1GFSA 3CJTA 4PLYA 4TZZA 2PRJA 4NNJA 3DT6A 4IQ4A 4AMYA 3KZXA 2IKSA 3NHZA 2OXTA 2V9CA 2XUAA 1D2NA 3BDVA 4X66B 1MJNA 1YL7A 1QV7A 3NH9A 3T5CA 1F60A 1HE3A 3PDWA 3HH8A 1JEYA 1WXGA 3QOWA 3UUEA 1LGYA 3L02A 5E1MA 5F51A 2HSWA 2QTSA 3NTOA 4E3ZA 4ZMBA 2LGQA 1SUBA 2OHGA 1J0EA 1IN6A 1YVRA 4QNMA 1YRYE 2MJLA 4MOWA 4WKNA 1W85A 3G4SV 1U3VA 4P31A 1E1QA 4QGSA 2VT3A 1SCJA 2O2DA 5KDDA 4NWOB 4Y1GA 4FGKA 2I2WA 3R7LA 4IDBA 2XNDG 1Q6IA 1OCRC 4UCUA 3LFOA 1R88A 2XVYA 1H2ZA 1AROP 4YRDA 2XB9A 3R6WA 1NVUQ 4DXAA 2O50A 3ETHA 1PJ4A 2ZZMA 4GEKA 1BKSB 4OHZA 5MHTA 1JEEA 3VYVA 4YCAA 4HATA 2PLNA 2G1AA 4K0KB 5FLYA 2VHWA 1R4NB 1DJOA 3WU2Z 3ENVA 4LQLA 4N39A 1QIDA 1TO2E 2PKWA 3U60B 2OKCA 3IUYA 5T67A 2O0HA 3VKGA 1J5PA 1E5LA 5LDDC 4QUIA 2EG5A 3QO7A 1BCSB 2FRDA 3WL5A 1F12A 3JZFA 2A7QA 2GPSA 4DIMA 5AJXA 3IAEA 2OBFA 3ZV5A 4KLNA 2EERA 1F3LA 4O08A 1JRLA 1U2GC 2JK1A 3DTUB 2JS3A 3L73H 4AY2A 2XXBA 1J0CA 1B0ZA 2ESRA 3ZCQA 3RYFB 2X6BA 2RI6A 1ODKA 3QKSB 1Q95A 2BI4A 3OCVA 3RS8A 3OT1A 3ZIAD 3VSAA 1SVSA 1A8PA 2FQ1A 2IDMA 5ALWA 4JLDA 3OLCX 2Z57A 1W0JG 3OQIB 4PDRA 3G5TA 4Y2QA 4F5WA 5B6JA 2PLFA 3LPDA 2YSUB 5JEEA 4BKMA 3ZD7A 5FNVF 4I1YA 2AFHE 1KZ4A 4X89A 3KPJA 1U0JA 4UCXA 4DZZA 3GGDA 3L4SO 4HL6A 1ZA1A 4YP7A 4BECA 4WNAA 4AIIA 4WFGA 2UUCB 3MPOA 7GPBA 3BJIC 1PFGA 3SE0A 4NYJQ 1ILEA 4HDMB 2OWEA 5B1OA 3DOCA 4EW1A 3B6KA 3LCCA 1IHXA 1AHIA 4PNPA 2IX3A 1Y4MA 4X85A 1AT1A 2ZXUA 2NMVA 4U2KA 3VRHA 3O74A 1SC5B 3PK0A 2I6XA 3SOZA 5KYXA 5KNCH 1G2QA 5IYCO 4HC4A 1I13A 1MABG 3U61B 1BW9B 5EE3A 3PXDA 3R5KA 4OBWA 1DSSG 4ZMSA 3DHYA 4BPRA 1ZCAA 4LOIA 4W9MC 3OOEA 1J09A 1VE5A 4XDKA 4KYIB 1ZIOA 1CDDA 3WTBA 3C3KA 2WZBA 4EI8A 1W29A 2HWWA 5JO9A 1QZ3A 5KOYA 2A5FA 1PX0A 2DPHA 2V1XA 4EA9A 4B85A 4ZYWA 5AJVB 3REOA 2FK7A 2FFBA 2VAWA 3LVFO 5EJ4A 4QFCA 5CH5A 3T1HB 1X7YA 3AUYA 2EV9A 4MUBA 1M2NA 3JQQA 2JA2A 2Y1XA 4MS3A 2D8AA 2WE7A 3MWGA 2OFFA 3X3HA 5FFNA 4JAVC 1T6BY 2AQKA 1VHLA 5HXAA 5K3DA 4WY5A 2V54A 2Q2QA 2XPCA 3AUJB 4GRIA 2CXUA 5HIKA 3ELBA 1IN7A 3DGEA 3ZJYA 3U4HA 4KO3S 3SC3A 4EUKA 1NTOA 2GJ8A 3U1TA 1EGMB 2B2CA 4X3MA 2SKDA 1MOFA 1EJ0A 1HR0O 3WAJA 3W05A 1IIRA 1CEEA 3KKQA 3LP6A 5I7SA 3HKDA 4TLEA 2BFEA 4WZ6A 4NE7A 2WU1A 5KYUA 2P90A 4EM6A 4ZCMA 1YDMA 4OSPA 4I7EA 3ZE7A 4OQZA 1QS0B 2ZPTX 1CUXA 2QZZA 3OZVA 4OQQA 1SD2A 1EBUA 1M5UA 2Z2JA 3Q3IA 4GOMD 1UPBA 3M2TA 4J4BA 3QUTA 2L2QA 3SE7A 3QZUA 1YZGA 1I9GA 5FLXA 5C8DA 2AD1A 2PA0A 3RYHA 3UXHA 1YF2A 4CQNA 1M34A 5EKDA 1BCRA 3ZDBA 1H85A 1NT2A 3IP5A 3WMGA 4UHBA 1Z7WA 1IN8A 5JPCA 1E3EA 5H9WA 4KAAA 1GO0A 1UEJA 2RB9A 4OL9A 3ZDZB 4IIEA 3EK2A 3KU4A 5DGDA 3GRAA 3GLGB 1USUA 1NIPA 5JJCA 3PUWA 4B6OA 2E4YA 3W6ZA 3R65A 1Y6GA 4KYTA 1P39A 4AJ9A 1XDCA 4G1CA 1NTMH 3AKYA 5AWFC 1IJKA 1SXJB 4YHBA 3FDJA 2R4UA 5DYNA 3W7UA 3PZBA 1U0NA 3VKVA 2B4RO 3MMPA 5B55A 3TXQA 4WUTA 4CR6A 3RWOA 3DGFC 2G0TA 2IOYA 1XDZA 1W44A 1W30A 5BSWA 4BAUA 4H16A 4EIWA 2O8FB 1QF6A 2IHTA 2PS9A 3P0EA 4I4TB 5GONF 2X5KO 2HRCA 4BY9D 1AZTA 3IXQA 3JQBA 4U6SA 4LGCA 4DC1A 3ZKWB 3X1DA 1RKBA 3LE8A 1ZSYA 2YIMA 4ZAZA 3GEGA 3MD0A 1XZ8A 4MPTA 3OPXA 1OUMA 4NOMA 3BZUA 1VIYA 5D6OA 4IWYA 3EGVA 1YQWA 4LCUC 1KSGA 3HN7A 2QX6A 3H7IA 1EGQA 2VDWB 1DBQA 3O26A 4Y8VA 4GWGA 1OVMA 2VSFA 4RUEA 5IMBA 4PPGA 4W63A 1KAEA 1CY1A 1Z56C 2Z3YA 1FMCA 3KQTA 3I32A 4UDYX 5A71A 4BAZA 1FJ2A 3LGXA 3GXOA 3C4VA 1QC5A 1NA5A 2PWBA 3DFFA 4PYLA 2C9ZA 5EQJB 4ZOCA 1A9OA 4WKGA 2Z2IA 1WAMA 4DQUA 4E12A 5LD2B 4FYHA 1MX3A 4CYMA 4CG3A 2IYOA 2GAFA 1Q6HA 1E2PA 3WKEA 1T1IA 2HKOA 1ADFA 1GV1A 2WSMA 3GEMA 2IHBA 4KFUA 3F8SA 2MHCA 2P4KA 2QEXF 4K3AA 4RETA 2JLVA 1I3NA 1PR9A 1MV5A 4WXPA 1IFXA 5FPOA 5DM6V 3FVWA 3BE5A 1IDN1 3NRBA 3LLMA 2OT3B 4NK4A 3ESQA 1UQTA 1XNHA 4KEAA 5FTKA 2O7QA 2FFRA 1YBHA 1KJNA 2CHTA 3OUSA 1DAGA 1JKIA 2FWIA 4NS1A 4P53A 2GVZC 3MQFA 1IV4A 1K73H 5GM1A 3LSQA 3M7IA 2BEVA 1NBWB 1ESNA 3EVDA 2HVYD 3DLTA 5BPHA 1M7BA 2ZRKA 2Q5CA 1IULA 1X7GA 4FYWA 3FJ1A 3PXEA 3NR2A 1YONA 3F1LA 4X6UA 2BP7A 1JS1X 3TKLA 2B61A 2ADPA 2C3YA 4NFYA 4BIOA 1ZI8A 4TZTA 3VZPA 1TJ4A 1TJ3A 2ZTVA 3CRQA 5E95A 4MA4A 4EPXA 4UBKA 3WPXA 2H92A 4I4LA 1R5OA 2QA4V 1G6UA 3BF7A 3M34A 2QK4A 4MYDA 4ZREA 2CHSA 3K9WA 1S2NA 4URUR 4RHXA 3LWPC 3MBIA 1UPFA 4YCJA 4P38A 1T8TA 3AETB 4FZJA 4G5GA 4E5VA 3G2HA 2R9AA 3Q72A 2MT9A 4JASB 1U0FA 2F8SA 1ULSA 2V6FA 4ZVLA 1XAGA 3UMCA 2XAGA 2HCTA 2GUGA 5JANA 4QOHA 4C7JA 1M57B 4ZYYA 1R9MA 4C30A 2A4MA 1A5AB 4BO8A 1RJEA 4BB0A 2KW5A 4CKXA 4R50A 4O4HA 4V0LA 4C3VA 5CITA 3IP9A 3LRXA 2D1FA 1KXZA 4QODA 1YZHA 3MINA 3IBCA 4DSNA 1RPZA 2OBLA 1U8AA 3TRDA 1OKKA 4N7RA 1H8HD 3I62A 1NR5A 2FZ5A 3HY4A 2O9JA 4PINA 1TYBE 4L75A 4CM6A 1MB2A 4DYLA 2HS4A 3QFCA 4GNRA 1T5TA 4KL1A 5A62A 3CVOA 2A0KA 4YAGA 2QROA 3K5IA 4G67A 4P81A 1E9CA 2OQ2A 2Y76A 3I4CA 3CUKA 4WFKA 1SK9A 3DXZA 3RYCA 2BMEA 4ZRNA 1XMJA 2WOOA 5LLSA 4JI1B 4LFBO 4M7OA 3WAKA 2A78A 3P9CA 1GPYA 4Y2JA 3UJHA 4JP3A 3UENA 2XRZA 1QWSA 1AI6A 5M29A 3QMWA 4HLUA 1JHAA 2YS8A 3B40A 2DEUA 3RTCA 1RW4A 2V7QA 4QYXA 4DHEA 4LNHA 4QPCA 5ICGA 3C97A 4N82A 2ORIA 3BAZA 1XBLA 4BZXA 2ZT9B 1IXYA 3HYSA 4MW9A 3T5DA 1ARZA 2V9ZA 3HB0A 1WXWA 2IIBA 2FYUH 4EKWA 4AY4A 4II7A 1OR8A 4AJIA 1KYXA 2E1RA 2IVZA 3C1UA 1O6BA 1XK7A 1BCSA 2ZRJA 3GD5A 3DE4X 1IV3A 4G09A 4U6QA 1I9CA 5G4LA 4FLZA 1YSCA 2ZINA 3FNHA 1L8OA 5CPFA 4CCWA 4KP4A 5KSOA 3SHOA 5IW8A 4UQLA 2PKQP 3T9AA 4K9RA 3E8BA 5IRCD 1EFPB 2XZTA 2EVWX 5AI5A 3WJ7A 3UM9A 2WYWA 4QRHA 2ECQA 4TS1A 4AS1A 1FFAA 4L9AA 3D6TB 3QBTA 2NAPA 3OQIA 1RYEA 4TKZA 3RU3A 1MX5A 1M8FA 4MWOA 4J0DA 5F9MA 2DJIA 2FZ4A 3OPMA 2QM8A 5ALZA 2ONYA 3BWXA 2O0MA 5TMDA 3KSAC 2WC1A 1RWOA 3V4DA 4RZHA 5LSAA 3X2SA 1QE5A 4QYSA 4XVCA 4CT5A 1D0SA 1KFBB 3LQ4A 5EG5A 4WLOA 1ZAKA 3NBYC 5CHEA 3MB5A 4MO9A 3M5CA 2BFWA 2GM3A 3NYQA 2BFBA 3PGKA 1L4NA 4IUDS 5AJZA 3DHWC 3F5SA 4JODA 4MCIA 3DEJA 5JBIA 3RFRA 1PZFA 5CFNA 2X0EA 4ZK7A 2OT5A 1L7BA 2MYNA 2RAVA 1P1FA 3SZOA 4BGDA 4OHWA 2RGBA 4X3OA 4LHSA 1JR3D 1ZPDA 4ZGBA 1VXRA 1QGED 4K6HA 1DC3A 1RQXA 2QXTA 1JY8A 4M1YA 3P9KA 5IP5A 5EGSA 3EG9B 2P9TA 1N8TA 4HEHA 2B83A 2H1RA 4JGSA 4Z9XA 2OM6A 2QN7A 1H6AA 3NDJA 1BGWA 3HLTA 2W2KA 5D3KA 3KETA 4BEWA 5I5EA 5JPIA 1MW9X 1SVNA 2BR4A 3GJ8A 3U49A 1GCIA 4FPXA 1FL9A 2JKZA 3AW9A 1Q7RA 3GA5A 1D04A 3I8OA 2XDAA 3ZY6A 5EERA 2C9BA 4C3ZA 4AZ0B 2UUPA 4I8XA 4JN6B 3B1XA 1RPTA 5CLLA 5C93A 4O4IB 1QD9A 1TCAA 2GYWA 4Q1VA 3DPIA 1DVRA 4M1KA 3A1UA 1HGXA 3WG9A 2XT9A 3R3UA 3DTTA 3ZCVA 1DIAA 2C94A 1G8FA 1J2YA 4G65A 2XMSA 4PI2A 1JLSA 1T8YA 4ZKEA 4LF7B 1BN7A 1YOVA 4UCRA 2AG1A 3P9RA 2CT8A 1MKYA 3BE6A 1SVIA 1UAGA 3QKRB 5BV7A 3IUNA 4I81A 4KI0A 2WD9A 3O93A 1KFJB 3R3YA 1GZ6A 1XLVA 2D5CA 3K8YA 4EUNA 2YDXA 4F5EA 2DPMA 3DOIA 2DBYA 4ZU6X 3SPIA 1HM5A 3QEKA 1AE1A 3DL2A 4L28A 2EP5A 4ANFA 1R1MA 4P3XA 1TW3A 4D6TH 4XUCA 3WGOA 3WA7A 2KM1A 1QO9A 3SXUA 5HRAA 4HWSA 3AINA 5JFGA 5H3LA 4KQKA 3IBYA 3BHNA 1GRVA 1KFCB 4J1NA 1NI8A 2WMNB 1BE6A 4BQRA 4UUBA 2QUBA 2PBFA 2VT2A 4DLBA 1A95A 3DYIA 1VF6C 3O47A 1L4YA 2ZYVX 3QLUA 4WKCA 2IYAA 3C8UA 2UZ0A 1FU4A 2ORWA 1ZOLA 3RKSA 1SHJA 4BX0A 2OR3A 1E1RD 3DVRX 4B6SA 4JDUA 4OQXA 1V9LA 1KK2A 3VZRA 5L8VA 4KXXA 1T5IA 3ELDA 4WN9A 3ZZ0A 3P0FA 1F6DA 1VXOA 4FI3C 4BX8A 3L07A 2CXOA 1RKVA 4CIYA 4PF1A 4IIJB 3N0VA 1A8SA 2W8BB 1H6DA 1BE8A 3X1MA 3CC7V 3ANNA 3LZ6A 4I4TA 2OK8A 4JAUA 4DDWA 4G4GA 2VF7A 4IEEA 2WPNA 1W4BA 1YR1A 4D74A 4G4XA 2X4GA 2IUFA 1R0YA 2HK8A 4I5FA 3ZMUA 3RK4A 4LF8B 5DGIA 3D5TA 1I80A 4LOLA 2XA9A 3FUUA 1S5LZ 1W75A 4UVEA 2VDWA 1Q8RA 2IA5A 2GJAA 3AEUB 3FHLA 3VU1A 4DA0A 1E61A 4QATA 3Q6MA 4S1OA 1ZD9A 4G6ZA 2FFJA 3DZHA 2Q4TA 5G41A 3WWCA 5SY9A 2C88A 1PWZA 6YASA 1JZQA 2QQFA 2OA0A 1DFIA 1CQJB 1MEOA 2J6CA 4EI9A 4Q66C 1R4MA 1BO6A 5DYTA 4YT4A 4QNHB 3G5UA 2AN4A 3GEDA 3J7TA 3U4QA 5DP2A 4C8EA 3O03A 4B3TB 1K8QA 4P2GA 4X44A 1QRUA 1MZVA 5K1XA 2PHZA 3CRW1 2E4VA 4HCJA 5D1NA 2W58A 1K88A 1VBNA 4IOLA 5A7FA 5TPZA 4EG3A 2OBXA 3KE9A 3RWRD 1FY2A 4JMPA 4LR3A 1Z6YA 4JTAB 2PXXA 4PW0A 1VQ7V 2ZYIA 3WKDA 3FPIA 3FETA 4L3VA 4ALLA 4YHHO 2DKOA 1KR2A 3ON5A 5C3UA 1KY3A 1LY1A 4M0EA 2A0LA 2LCIA 1O8CA 2OMKA 4LS3A 5TEVA 2XVMA 2BAGA 1BA3A 2BGIA 4MYCA 4V0ME 1R64A 2WJZB 4KBYA 1PRYA 1FX0B 4RTJA 5LZ2A 5BV8A 2EIKC 1KYIA 3OQOA 1GZ7A 1K92A 1V1RB 3SZRA 3PEVA 1J70A 1BA2A 3F97A 5IY5B 5I01A 1U8CB 1NLZA 1XA3A 2ZE8A 2PXAA 1O57A 1QP8A 4IDFA 4JGIA 4AYTA 3B8MA 5GJCA 2VSNA 1E2IA 4LTNA 3RM3A 5LB4A 1P49A 3RS3A 1NPDA 2EZPA 3I92A 3MJVA 2XMRA 2VBFA 3CCUV 2C4KA 3JQPA 4E0BA 1VCHA 2IK8A 3KB2A 3IE2A 5IU6A 5JXWA 4PAGA 2HQSC 4S3MA 4BKRA 3O4IA 4E2WA 3T9BA 4QBTA 3KKOA 4ETNA 4NCBA 1E62A 1U3UA 1IMJA 1H2KA 3AKEA 2GN0A 4YUYA 2JLXA 1RFLA 1ZD3A 1ZCZA 1GAWA 1RPOA 2OIEA 1FYFA 2FH5B 1L4KA 3IAM6 2YVKA 3GBPA 1ZJ5A 3GLFE 4YX9A 2XNHA 1TUEB 1JDUA 2WQ6A 1YFJA 5EKTA 4Q00A 3QBJA 4WT7A 5E7MA 2ONZA 3NXSA 2GTHA 3PWKA 4KXFB 4XX0B 4KDRA 2H5LA 2XOKD 4WCFC 5EZYF 2AIFA 2XNDA 4MHTA 1OLXB 5NULA 4QJ4A 4CL2A 1SBIA 3N2GB 2FXIA 4FLXA 4L76A 4J0FA 2OKGA 3IR5A 2E74B 1OH5A 4RXUA 3TW4A 3APQA 1BJTA 3GQBB 3TTWA 1TUGA 3FOBA 4FUQA 1J95A 3ERNA 3PJFA 3TEMA 1VQ6V 3QHPA 4IS2A 4QDTA 5ALTA 2D7JA 1TMOA 3D8CA 4KIWA 3WK5A 4BQOA 3I73A 3RVKA 1L7VC 4LF9O 3VXKA 4H18A 4C22A 5ICMA 3G6BA 4GQBA 3H9QA 2WSLA 2ZIFA 2ATCA 2LTAA 1E1CB 1ULAA 1HYGA 5DWVA 2G77B 3J7AC 4ZK6A 2A9QA 3U0BA 4YCDA 1GK9A 3VC3A 5BOSB 3W8EA 3EF3A 2DKFA 4L87A 2BHSA 4BN4A 5BMVA 3L1UA 2DTEA 2IZOA 1A27A 1KJIA 1K7DA 2X9LA 2ZQMA 1YJWV 1RMYA 4W9RA 4XB2A 5F7ZA 3WMFA 4WKPA 3QI7A 2WWFA 2CL7X 1GRJA 1GPUA 4QA9A 2O8VA 4KAXA 1P7ZA 1LKZA 2DSTA 4Q1DA 1JU9A 4OFWA 3HQ4O 1QYIA 1RM4A 1OWNA 4EEZA 1SXPA 3CCQV 1JTEA 1ZD1A 2IDJA 4EF6A 3ZOPA 2JRCA 3ZDFA 2I4IA 1ILWA 5LMUB 3EIXA 1NW6A 3GJ6A 2GBPA 1LTKA 1W0JA 4JBHA 3VNAA 4MCJA 1ZI9A 1PFQA 4O3FA 4ETMA 4EL0A 4QSHA 1KOLA 4CIVA 4WH0A 5JBQA 1Z6GA 2XQIA 4XPIA 4UU0A 2R44A 4PAOA 1B93A 1L5FA 4RF2A 1WDLA 4CS2A 3JQAD 5KWVA 4JI0B 4MYSA 2MMCA 1PBNA 4OQDA 4Q9AA 4MKRA 3TZCA 3U16A 1VTKA 4CIAA 1MAWA 3FWPA 2YEVB 2WTNA 1XG5A 1Z28A 3JRWA 3DF7A 4KK4A 4CI9A 1RXYA 4AQ7A 4FIDA 4G5HA 1Z36A 4J2OA 1F4NA 2ACWA 2LFSA 1S3SA 3TVYA 2IX9A 2ZCUA 3W7SA 1UXIA 5JH7F 2LKCA 1USWA 3ERCA 2IH1C 2J3QA 4TLAA 2A5LA 2CWDA 4O1MA 4EHHA 1EXDA 4BJ3A 2A5YB 4OHCA 3IALA 4NZMA 3B6MA 1SD5A 4QOSA 2G6BA 4CV0A 1G291 1NKDA 1L8DA 1XQ8A 1M72A 3VJLA 3DAHA 2O5VA 2P3QA 2CDBA 4HN2A 1WKCA 2JJQA 4IQFA 1BX0A 1XQYA 2QMQA 1VA4A 3CCRF 3E81A 1E2BA 1B0AA 5JWRA 3EPHA 5JHHB 5J9FA 5HY0A 4P3NA 5IUKC 2XX3A 1RIFA 2VJPA 3DE2X 3OMAB 5JVDA 3KQQA 2O8DB 4JCOA 1RCTE 4YJ2B 4DS3A 1H42A 4IIVA 2XITA 4RK7A 3A05A 3PQEA 1EH5A 4EY4A 1PL8A 4OQEA 3G0IA 1Q7TA 4PR3A 4LFCB 2GNPA 4XFKA 1V41E 2YWCA 4KN9S 5JAHA 4OXYA 1WZNA 1G41A 2WYVA 3AO0B 3JARA 1Z4KA 3QVVA 4ZOBA 1WA8B 1OGJA 3BFPA 1MB0A 3SNKA 3RU2A 2AG6A 2XWB