4ZI7B

Crystal structure of tubulin-stathmin-ttl-hti286 complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 168
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zi7B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zi7B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zi7B01
3RYHB 1FFXA 5LXTA 3RB8A 3RYCB 3JARB 2RHHA 3N2GB 4U39A 5MN4A 5JQGA 3RYFA 5LOVA 3JALB 4X1IB 4KWEA 4LNUA 4YJ3B 1W581 4O2BB 4ZI7B 3N2GA 4ZHQA 3WGNA 5BMVA 4ZI7A 2R751 3M89A 5LP6A 2RHLA 5J2UA 2RHOA 1RQ2A 3HKEB 3UT5B 5KMGB 4TV9B 5CA0B 4U3JA 3E22A 5IYZA 4EI9A 4B46A 3JARA 4LNUB 4U3JB 4YJ3A 1OFUA 3V3TA 4FFBA 5CB4A 4EI8A 4O4LA 4TUYB 4O2AA 4EI7A 4I55A 3JATB 1RLUA 3VOAA 4O4HB 5LA6A 5J2TB 4IIJB 3N2KA 2BTQA 3WGLA 5LXTB 5C8YA 2BTOA 5IJ9A 3WGMA 3HKEA 4I50A 4X1YA 5EIBD 5JCOA 5CA1A 4I55B 4IHJB 4O4IA 3HKDA 5KMGA 4X20B 1FFXB 3JASB 3JATA 3R4VA 3VPAA 5LYJB 4TV8B 1W5EA 4O4LB 4TUYA 2BTQB 5MN5A 4X1KA 1FSZA 1TUBA 4FFBB 5CB4B 4WBNB 4YJ2A 2VAWA 2XKAA 2Q1XA 4O4HA 4HNAB 3UT5A 4O2BA 2GVIA 5LYJA 3JAWB 4XCQA 1W5BA 5M7EA 4I50B 4X1YB 3RYHA 3HKBA 1TUBB 1TVKA 5EYPA 1W5FA 1SA0A 4ZOLA 3RYIA 4IHJA 3WGKA 5IJ9B 5IJ0B 5MN6A 5EIBC 4X1KB 2VAMA 3CB2A 3VO9A 4DXDA 1TVKB 1Z5WA 4O4IB 4O4JA 5FNVA 4ZHQB 5KX5A 5CA1B 3JASA 1JFFB 5EZYA 3N2KB 3ZBQA 4HNAA 3HKDB 3HKBB 5EYPB 5LP6B 3ZIDA 3JAKA 3RYFB 5JVDA 3JAWA 5C8YB 4B45A 4O4JB 5FNVB 5IJ0A 4O2AB 3HKCB 3ZBPA 4TV8A 5JCOC 5ITZB 2VAPA 4F6RA 1Z5VA 5LA6B 5CA0A 5J2TA 1W5AA 5ITZA 3M8KA 1RQ7A 2VXYA 3E22B 5IYZB 1SA0B 5LP6C 3VOBA 4E6EA 5JH7A 1JFFA 5EZYB 3WGJA 2R6R1 3HKCA 2XKBA 5GONA 4EB6A 4YJ2B 2RHJA 5JVDB 4M8IA 4I4TA 4X20A 4IIJA 1W59A 5LOVB 4DRXA 5KX5B 3JAKB 5JQGB 3VO8A 4ZOLB 3RYIB 4TV9A 2Q1YA 3JALA 4I4TB 4X1IA 4WBNA 5BMVB 4F6RB 4DRXB 3C8LA 5GONB 4EB6B 5J2UB 3RYCA 5JH7B
chains in the Genus database with same CATH superfamily
3HDGA 1VGRA 1YDHA 4WKBA 1AUVA 1DIAA 1Z29A 3G0IA 5GVRA 3UXYA 2UYYA 1X8LA 5D5HA 1A8QA 2JFFA 5A2QA 3MUFA 3KJGA 1G5HA 2H4YA 4FR0A 1DCTA 2PRSA 4S3MA 1ZL0A 2A1TR 4KSBA 5E6SB 1CVIA 1YQ9A 2ECFA 1Y1RA 4GM0A 1P0FA 4QULA 4BN0A 1Q0HA 1EB8A 2G9ZA 1RAGA 3VMFB 4AKTA 2QMZA 1JR9A 1ETHA 4PIPA 2NU8B 4WVFA 1OAPA 3Q40A 2P0AA 2RJ3A 3TNLA 2WZBA 1DAMA 2XNDA 1P2SA 3IEMA 1XXHA 2D7JA 1GYPA 2ATCA 2Q4EA 4UBMA 4CM4A 3L7NA 1F0YA 5B6PA 1FYWA 2EVWX 1J23A 1OCEA 1QIHA 4IQ0A 4IIHA 2C2BA 3K8OE 3QOYA 3LDEA 4CM3A 3FB7C 1EDBA 3RDPA 4POOA 5JS7A 2I2AA 2WTUA 1CQIB 3KR1A 2HIGA 3E9NA 3LC1O 4QJ5A 2ZCVA 1G7RA 2GEJA 2K2WA 4EUHA 5E1DA 2B2NA 4BGVA 2XVXA 3QITA 4TS9A 1YUNA 4RO0A 1HQCA 1K34A 3EN0A 3V6MA 2A9RA 5JSZA 1ZD4A 1RCUA 1E2JA 2PMKA 1ODTC 1BMQA 4C14A 3PGXA 1XLUA 3A6JA 3VC3A 1IXZA 2UU9O 1UPBA 5I7AA 2H5EA 3RSGA 3JVIA 4CC5A 1U94A 2VK1A 4YUVA 4B40A 5L3SB 3LP5A 1DIOB 2IXGA 1UZUA 4EFMA 5KQSA 5D8DA 3NATA 1VA4A 4E33A 4JB2A 3KIZA 4AJNA 2UXBB 4KUEA 3TOSA 2O8CB 3STLC 4Q20A 3VZQA 3ZHOA 3WLAA 4DMKA 2A9FA 3H2ZA 2BMVA 3AKZA 1LNQA 1L9KA 3AR6A 3I32A 3T5DA 4B84A 3E9RA 3ZWQA 5G1PA 1L4KA 4AS3A 2Q8QA 1TFUA 1E6LA 3OTOB 2IYFA 4FDUA 1FJXA 4K9DA 4PDRA 3D3QA 1JAIA 1LA2A 2VWJA 4HYYA 3RARA 3OEWA 3NHLA 1GUYA 1HKUA 1F51E 2VAMA 1RI2A 2R8RA 3GUCA 3DWGA 3HXTA 4KP7A 5REQA 5BV2P 5IDXA 2YIJA 1BW9A 1KI4A 3IUPA 4S1WA 2O1EA 3KELA 4RA6A 4TTVA 4Z8XA 3TTSA 4CM6A 4I1YA 2ZXUA 2OAP1 5DN6A 1K7CA 4W1SA 2G83A 3HKBB 3IP5A 4XIYA 4UU0A 4NCBA 1N6HA 2FU5C 1JHOA 2PLWA 1T4CB 4MV4A 1XWWA 2JJMA 2NO9A 2J3DA 1SC4A 4Z7JA 3AVOA 4JZGA 1DQRA 2KWIA 3DO6A 3COJA 4MUHA 1JYSA 1V1MB 2EFCB 1W46A 2NSDA 2CFOA 2QW1A 3F67A 5KYVA 1KEVA 4MQ5A 4R83A 1FVXA 2CEAA 4M36A 3VPHA 5L4LA 5M04A 3B1ZA 1D5WA 3GRFA 4IX1A 3K8ZA 2CCGA 5IDJA 2WTMA 2R6R1 2FWIA 1JQ5A 3PFCA 4REQA 4DCMA 1VQ7V 3S3XA 4OG2A 4E32A 4EHNA 2YIDA 4O5AA 5A7HA 3SX4A 5F73A 1YUBA 1G20E 2PHNA 1OTXA 1COWA 2G76A 2ZYUX 4KUHA 3RREA 3H1GA 3RSLA 4BDTA 1YGPA 2NG1A 2OZBA 1PT7A 3HB7A 5DCLA 1MRNA 3CCUF 1VG9B 4BAYA 2J41A 2YN4A 5A03A 8OHMA 1FNSA 5HS6A 1V1RB 2VJOA 4G0ZA 4K35A 2I9PA 2QTVA 1V8BA 2BFDB 4W7SA 4AJ4A 2B33A 1ABBA 1KXJA 4DGQA 4UQLA 3CRQA 2JLSA 1CEZA 2FQWA 4GYKA 4AXBA 1W4ZA 3CIFA 1CE8B 1UC9A 2HI0A 3PDHA 3W2IA 2P40A 1UL1X 3PQCA 1XD2B 3QE9Y 2HJVA 1MX5A 2B20A 2IT1A 3ILSA 3MSXA 3P2KA 2BFFB 2JH3A 5FPKA 2X7JA 2WK1A 4KXQA 4IDGA 2BDUA 1TNDA 3OWHA 2YUIA 1HXHA 1FXKC 4M1TA 2ZW9A 1Q6HA 3RODA 3EG9A 5K2MA 3ZWPA 3ANMA 1A7KA 2C95A 2F62A 3NKLA 2FW0A 1CK2A 1GL6A 3FPCA 1BHJA 4YY3O 3ORYA 3PQ6A 1L7MA 3OPYI 3AK4A 3FR8A 1OGJA 2PXCA 4MSUA 5EE1A 1NJ6A 1ZUWA 3L7AA 2R6JA 3D3WA 3HL4A 1CR6A 4TSFA 4LBWA 3WLRA 1KK3A 5KTYA 3U6BA 1IH8A 4LTDA 1VL1A 1E5XA 5CPBA 5TSDA 5KVSA 3QVTA 1KZGB 1JQ3A 1BTOA 3G8BA 2B3TA 4X63A 5E9JA 4BFYA 3U3JA 5JZOA 4MVSA 5EAZA 1PG0A 3ZNOA 2CHGA 4MWBA 5JXGA 1QB8A 2WTXA 2XYVA 3ZV4A 1M1ZA 4A03A 2CLIB 4G4XA 1MX9A 2EKDA 2KW5A 1B0PA 1GRCA 1TZMA 4WUTA 2O23A 2OTJV 2PUHA 3IYLW 1CNMA 4HQLA 5JAPA 3U10A 3MAJA 4TPKA 4LWOA 1FBTA 1VF6C 4NMXB 1UMDA 4RIGA 2YXLA 1N6PA 4N3BA 3I9NA 5A06A 3G1WA 5LQJA 1TO1E 4YRDA 1Y8QB 2VQEO 2DHDA 4CNQA 1VARA 2LKDA 4F5EA 1D9XA 1G5QA 2IH4A 1VM6A 2V4ZA 3NEAA 2OYRA 1I3KA 4P9NA 3X2FA 4LHVA 3T1YB 2WNIA 1QE3A 2UYQA 1NJ5A 1JB1A 1E3IA 1B2LA 4OPAA 3PSAA 5ALYA 2JBAB 4G1VA 1CDDA 1VPVA 1JXAA 3NM5A 4MV0A 4CQMA 4EPYA 1NIJA 3PI7A 2PO7A 2X4IA 1NUQA 1NV8A 3PPXA 4V24A 4OHZA 4ETMA 4OGFA 2ZRBA 2R2GA 5KX5F 3G7UA 4Q47A 3WKCA 5EYPA 1WMBA 1OTYA 1QVFF 3JQPA 4LVUA 1ZICA 1LTQA 1EX7A 2PUWA 3VU0A 3LCCA 4LOIA 3PJDA 4G88A 2VKQA 4HS4A 4IZIA 4PAGA 4EY4A 3DHYA 3MUOA 4MMXB 3RVLA 2RDMA 3HL0A 4Q19A 1GZ4A 2QAJA 2YWFA 1RXYA 2OCYC 3N8KA 2WSBA 1VQ6F 3CCSF 1NMUB 4IXTA 3QV2A 1M56B 1PKEA 4OL0A 1WHSB 5IC6A 2YC4C 1JEEA 1GMGA 4EQ6A 4Q3LA 3ADCA 4JP1A 3EQ8A 2OTLV 2D5LA 2ZIEA 1F2UA 3KYBA 4PGFA 4BGDA 2GETA 2YI8A 4Q7LA 1WQ4A 5ILQA 1ZR2A 1WUTA 3RUDA 3TM5A 4ALJA 3KWFA 1OA1A 1QS0A 3C3PA 2XKJE 5HY1A 4JS0A 5LP6C 4K8OA 1TK9A 4M1ZA 4OV6B 2LW1A 3S0HA 1U3TA 1UMKA 1EHYA 4DKXA 3IEXA 1A9OA 4GXTA 5K3FB 2X5JO 5CA0F 5HKOA 5C4GB 2ZDHA 4N6NA 4EEXA 1HTWA 4JNKA 3KQTA 2ZANA 4C21A 4EG5A 2ZR7A 4FHDA 3JQFC 4OHVA 5JQGB 2XHBA 3NC0C 3MTGA 4NDAA 3T06B 3TSAA 2PXAA 2C5FA 2I65A 3PLRA 3GDOA 4KPUA 4MRAA 4XDGA 1UF9A 4KR9A 4AI8A 3P0IA 4EB8A 5FEUA 5JZSA 5LSAA 1KSGA 4CEHA 1WG8A 5CHYA 1KDRA 4YI5A 2J6BA 1TU3A 2XAGA 2GPNA 4MAFA 3WLKX 4BZWA 4UJ5A 3SPIA 1XFDA 3GGCA 1EX1A 3JAMA 2JFWA 3IC5A 3MEQA 4H3HB 3H2GA 3P0FA 4ENVA 4XPIB 1TAHA 1QLJA 4M9SA 3RAFC 521PA 4KXXA 1XMPA 5B4VA 1M8GA 4NI5A 3H1KH 1SOUA 1XQ8A 5IZCA 2VNAA 2OY0A 5KWSA 3JAMN 1J6UA 1FZTA 3ZEDA 1HE3A 1X77A 4WFAV 4MI1A 2J5KA 4KWTA 5P8WA 2RHOA 3ZS8C 1U5BB 1L8OA 2Q3DA 3IT0A 4TLAA 3UW1A 1JLMA 1R8QA 3KZVA 3FY4A 4XX1A 3ZE9A 1CY8A 4WY2A 3VNVA 2Z1MA 5GJVC 5KINB 1QD9A 3GXOA 1N5IA 5HQTA 3EFFK 3R0PA 2AUNA 4ZVMA 2E1RA 1IYZA 2Q5IA 3R0VA 5KA6A 2FGKA 4ABMA 3ZTYA 3NG1A 3SYLA 1AUXA 1HDRA 4EI8A 1AI5A 1IBKB 3LZCA 3MMPA 3GC6A 1O54A 4I66A 1SBYA 3BJMA 3K09A 2DWDC 4ZIRA 3UN1A 2EKLA 3TOZA 1J9EA 2FX3A 3OF2A 3EQ6A 3OPQA 5H3LA 3W79A 1AF4A 1OREA 1F23A 3DLIA 4I9QA 4H77A 4QGBA 4RS3A 4WESA 4I5GA 2RD2A 1VG8A 3TAXA 3QF4B 2XIQA 3IMFA 3L8MA 2BTUA 4WFBV 2HL6A 2P30A 3GJTA 1QFYA 4N3AA 4WW0A 2DBZA 2PZAA 4XUDA 1H2EA 1QKIA 5AKJA 4BJ1A 2NR5A 3O65A 1M33A 2OHVA 2C5GA 2JCXA 2V9ZA 2Y1KA 2HA2A 5DYWA 1MABG 5FTKA 4Y9UA 1U97A 2ZUFA 1W19A 1ADJA 2GEKA 1SBCA 1M2NA 1MJGA 3HCRA 3D2CA 2AIRA 3H84A 5BSKA 4B82A 2QD2A 3RK0A 2HBRA 2I03A 2IEYA 3DZDA 4ZK7A 1M2OA 2W00A 1DEXA 3L8EA 4PEVA 3UMGA 3A6LA 2ET6A 4WERA 2QTSA 1V9SA 1JG4A 3CRNA 3I2JA 2FMHA 1D9ZA 4NXNB 2IOFA 3CR3C 1V0JA 5I7UA 4Q4JA 2BONA 3G6WA 5K3BA 3OKCA 1QF9A 4J90A 2ZJZA 1GN8A 1OX5A 2YXPX 3MGGA 1VQLV 4B62A 1X7WA 3F47A 3FKQA 4OATA 1Q6UA 2P77A 4TQDA 1PJ4A 2VN8A 3FF4A 3JWGA 4HTFB 1C4OA 1ZI9A 2XITA 4YAOA 3TR6A 5HJEA 3RRMA 2FYTA 4ZCQA 3CB4A 1Z5PA 3TTXA 3H1FA 3RUEA 1DAHA 2WTEA 3TW8B 4H1UA 4U7JA 4DC9A 1AQNA 3DTVD 4RTQA 2GO7A 4B48A 1XBIA 2CVPA 3D3IA 3PNQA 2VRBA 2CGOA 3EF0A 5GIPC 4NMLA 1KETA 2FG5A 3ANYB 3GUUA 3A3YA 1AHNA 1W34A 3H1BA 5L4SA 4Q9JA 4L76A 4BRUA 1FD9A 2VCEA 3SYNA 5IASA 5K6RA 3R3ZA 2C2XA 1C3OB 2NIPA 3W77A 3FYUA 1QHEA 1COWD 4KK3A 4MW9A 3D3NA 4GI5A 4JYAO 2NVWA 1YVRA 1UADA 1N33O 1V9LA 1E7RA 4IOJA 4PSDA 3ZLBA 3ESBA 1DG1G 5IDWA 4O1HA 3CZCA 2QVGA 4GYYA 1AI4A 4JFRA 4HRXA 1WPXA 1FP4A 2FQXA 3NONA 1CJKC 1I33A 3FGZA 4ZA2A 3RAGA 2WYOA 1A2BA 4Z4CA 2QTLA 3E15A 3EEYA 3WRXC 1NR1A 5J2UB 4XWOA 5EC1C 5E2IA 1H94A 5KHHA 1OBCA 1YDXA 3TW0A 4L0QA 3SYCA 5IPFA 4RK5A 4RSHA 1PL4A 3FG9A 3I9LA 3M4XA 2Z3VA 1N78A 3F6SA 3MMSA 2HGZA 4UBLA 5EBLC 1L8LA 3O4HA 5T4EA 1HW7A 2W58A 3TO5A 4M46A 8ADHA 2WT4A 3P3PA 2BH9A 2QXTA 2Y4OA 3M3HA 3FYEB 3R7LA 1PUIA 4D6TH 2FEXA 1K7DA 2YN0A 4QOFA 1N36B 1NUSA 2VPQA 3R9XB 1Q44A 2Z3ZA 5IT5A 1U9ZA 1IY8A 3D5EA 1XTSA 2BBSA 5DE3A 4MO2A 1PLKA 2X5NA 3FUXA 3MWJA 2H8KA 4Y9RA 3UMSA 5CCBA 1XVAA 2CYBA 2R47A 3MMXA 1EVEA 3ME5A 3U7FB 1AP5A 2WY2D 1OLXB 4FCWA 2WU4A 2EBUA 5JJEB 2J45A 2LVBA 1VHAA 5EMLA 3CZ5A 2V0NA 1GLVA 3SZUA 3D8TA 4QU9A 1Z7BA 2RI1A 1QBZA 3C39A 4IG4A 4DIUA 1J9ZA 2P3QA 2WTBA 4JLAA 4R84A 2Z6UA 2HCBA 2CHQA 3DFUA 4YASA 2GVDC 3WJ2A 2QEXF 1JBQA 1Q7EA 1L4UA 4GI7A 1MQAA 1MIOB 3AUTA 3AB3A 4AMVA 4DLTA 1HE4A 5EP2A 1KMHB 1B8UA 1GA4A 1G66A 2CSLA 3ZYCA 4RTKA 1N57A 3KJQA 3N2LA 3ENQA 5EQJB 1NH2B 1EFPA 1AJNA 3EZ7A 2F90A 4ZCSA 4DBLC 2Q7OE 3M9LA 4XQ0A 1CNFA 4KG7A 3ZS8A 4O8CA 5AO9A 3DEKA 3DYIA 2CB9A 3ZD8A 5I3ZA 1TUBA 2QTWB 2VI5A 1AHPA 4TMYA 3EXG2 4HWPA 5DCUA 2GVIA 4TQGA 3PJRA 2J09A 2Q8PA 4AZWA 2PGLA 2ISQA 1O4VA 3QQPA 4Q82A 5ICGA 3HK2A 1IB0A 2O2HA 2B4TO 3HNRA 3KYJB 3HGMA 2CXXA 1II8B 2GHQA 4MV1A 3LUBA 3L6OO 3RG8A 4HVAA 3W7XA 4ZOEA 2RN9A 1SBIA 2VRNA 3GFFA 2Q6IA 4M38A 6REQA 5KYUB 2P4UA 3NBAA 3V7NA 4F4HA 3R3HA 3UWOA 3COSA 4UE3S 1FMTA 5G3ZA 5CLGA 1YDWA 4KTVE 2XDQB 1XCLA 4I3HA 5JS8A 3AR3A 4LPKA 1D8TA 2JHPA 1BWQA 4EZEA 3O4FA 4KE9A 4NXMB 2MSDB 3BSFA 1K68A 3MPOA 1AS2A 1TCUA 2RCYA 2VDWB 3A0RB 4BO4A 4QYTA 1SF9A 3JW8A 3UK7A 2VHCA 3R8CA 8AT1A 3ZWAA 1Q14A 1R9MA 1WZEA 3WKEA 1KI8A 2CUGA 1V8DA 2BR5A 1E3LA 2QMUA 3B7WA 1WW3A 1WXFA 1UBKS 3I0NA 1RACA 3R2JA 5FOUA 2XJ4A 4CWAA 1YJNV 4TV8F 4WI1A 1O97C 3RAEC 3L9WA 3DVRX 5KWJA 3DKIA 1MNAA 2J5BA 3THSA 4IIJA 3ORSA 2EZPA 1ECCA 2NAPA 4WMLA 4DABA 5BYBA 3D7LA 2VHJA 5C3MA 3DAPA 4JD5A 3N7AA 4K6KA 3IXLA 4MXDA 1G2OA 4RD2A 3D2BA 5CLQA 5B1YA 2H8PC 1Q0TA 3GH1A 2AXPA 5L9AA 2DLNA 3CCVF 3P26A 1ZMTA 4O4JF 2HKIA 1V16A 4DEXA 1D4AA 2EG5A 1XVVA 1FFXA 1NUUA 2G17A 1F4PA 2VK2A 4NPHA 2ZRCA 3KVVA 3L7OA 3A70A 3LWBA 3CZRA 4TLBA 3W5HA 4RPKA 3ISVA 1BU8A 3M4ZA 5BR8B 2ZVYA 4WOCA 5HCIA 2PZ8A 4OHXA 1AS0A 1YRWA 3O2SB 4OFBA 2IYZA 2ABWA 4GPD1 4ECEA 2C9OA 3TOCA 1T9GS 2B1RA 3A9TA 4B4OA 2C07A 1KHHA 4FS3A 5KAFZ 5BR4A 2UYCA 4C7OB 1B14A 1E69A 2RHLA 4KMRA 1WOYA 2HQBA 4CEJA 4WZAB 3P9KA 3DT8A 2OV3A 3FAZA 3ELDA 1JVNA 3H75A 1G7TA 4TLDA 3GAMA 1E4YA 3HCNA 3INGA 4Y2VA 2HWYA 4LF4O 1GT91 1SM4A 2Z8XA 3MTIA 3OFJA 2R9IA 4MWOA 3RUCA 4KAJA 4D3SA 1S4MA 4CEJB 3K73O 3B5EA 3TB4A 5AVYA 3OIGA 3BGSA 3SZGA 3UAVA 1DRVA 1FNBA 2HA5A 2J3EA 1SZJG 2BP7B 4INZA 4RJKA 2QW0X 4J16C 5FWXA 5I8ZA 4C4TA 2OCXA 1Z3IX 4O4HB 3N5KA 1DBPA 2C82A 3PGA1 3LSSA 2G63A 4XQEA 3OKPA 1GPNA 2OYSA 5JC1A 4N41A 1XTRA 2XUIA 2PIDA 1NI5A 1MABA 1UPTA 4O2AF 4WCFA 3MVEA 1OLSA 2CE4A 3FDZB 3AG3B 2AN4A 3HJCA 4JEIA 3BCRA 5DK4A 1Z0IA 5ICMA 3GFRA 1EDZA 1FMJA 4M7RA 3HWUA 4M9UA 3KJKA 3NYRA 5B57C 4IHJB 5F52A 2GBOA 5KJ6A 3JD4A 4DMFA 5BXYA 1U0HC 4PQRA 1W8DA 2FAXA 1ZN7A 4QGGA 3SC6A 4CI0B 4YAUA 5KNBH 4LCJA 1GJRA 2WT9A 1W2BU 3DAHA 1GGJA 4MVJP 5ILGA 5IUKC 1CIVA 3G9QA 2YHIA 1XWIA 2EG9A 3QWBA 2PMWB 5FBWB 2NPFA 2VT3A 4DWWA 3PEUA 5LBIA 5BQ3A 1PR2A 2I3DA 4I50B 2H1LA 2RK4A 3RW0A 3R3VA 4G07A 5EZYF 3VTFA 1KEPA 2HK9A 3O2QB 3B4SA 4WCDA 3ROPA 1ND5A 3I4CA 4C7JA 5IT9M 3ZMTA 1A82A 2VNHA 3V46A 2GJSA 4DUZB 4F46A 2B4YA 2QG6A 2RMKA 3A10A 2VYFA 3PXGA 7AT1A 1YRHA 1GZ5A 2VXBA 1Z4PX 1CUJA 4JYZA 4ZHQB 1GL7A 1GU7A 1P19A 4TZZA 3R66A 3G79A 3VNRA 2HZBA 1UXGA 1SIBE 2GDJA 1BROA 2ZBPA 5LP6B 5GIOC 4NAUA 3RTBA 4CKXA 5BYAA 4IDNA 4OX9Y 2AC7A 4LC1A 4MQBA 1UIMA 1WLEA 1MEJA 4HDMA 3R7WB 1FSGA 4GXRA 4LF8B 1RQRA 1XUOA 1TADA 4MYRA 4OI2A 1A2OA 2ZKLA 5AJZA 4MDHA 3OZIA 3TI7A 1PYOA 2H85A 3QE3A 3AVTA 1XHOA 2ZBVA 2I7TA 4WZAA 2CLEB 1FFDA 3UO2A 2BTEA 1MJFA 2NU9A 3TD2A 2JIRA 2AE1A 5I9SA 4B6JA 4BNMA 3AI1A 1V45E 2RHJA 4TWAA 5AKXA 3LIIA 3DWEX 5EL0A 4RMJA 2IPMA 3ZOZA 1N0HA 4LQDA 4TTAA 5K8CA 2O8FA 4PINA 3NIWA 3CVOA 3AEUB 3BGDA 3FWHA 3LY5A 4JGGA 1AKNA 3PQDA 2GZ2A 4KBFA 1PJ2A 1SQ5A 1Y6QA 5LBQA 4OB7A 1O6CA 1RXIA 4CL2A 2ORED 4L51A 4BVQA 2DH6A 3E6AA 2Q3BA 3AIOA 5TC4A 2W6MA 1P45A 1EUCA 2Q2NA 2LIVA 3EGWA 2OK7A 4B3SB 3CWCA 3KHUA 4GGPA 5HMMA 3SHVA 4DO2A 2I4TA 4CU5A 3LT2A 2G1PA 2AD1A 2YNMD 1ZC4A 2ZVDA 1UJMA 5DSZA 3UYLA 3S0YA 2FG6C 2QHXA 1X1BA 1CETA 2WSSA 4MYDA 3TQIA 3TUIC 3BCCH 4I6GA 4FWTA 1FS5A 1D1QA 1XRPA 4WOPA 1LPNA 4Z0PA 3WJ1A 2XGSA 1UMDB 2P6RA 5IBRA 3CKLA 2VHWA 3RFRA 1VE1A 1HA3A 1NN1A 2ZYRA 3CSDA 4JJZA 4RD6A 2WFLA 4U2FA 1CUUA 1Y1PA 1PNVA 1W5TA 2HTEA 1BG6A 3IULA 1KDYA 4DNOA 3FWNA 4EF5A 2EIJB 4RAIA 4TOIA 3T1CA 1IAQA 4GKAA 5CD1A 4JBXA 4KYTA 4G8DA 3U60B 1B1CA 1QZ3A 3R9WA 3HP4A 4MVJF 2QAIA 5DYGA 2PH7A 2JCGA 1VF5B 2XVYA 2EGUA 1MO4A 2D1YA 3K1AB 4MVJM 4WCVA 5HK8A 4OIFA 5HR5A 3SC2B 3TNDA 3V32A 1Q82W 5LBTA 1M0EA 3NK6A 2Q4OA 3RVNA 5JARA 2DOSA 1RFGE 3GDHA 3R3YA 3MCAB 1DKMA 3A7DA 1V37A 4WA8A 1CY2A 4XI9A 2C9ZA 1DAGA 3DOFA 2K6GA 1JA0A 3TTYA 4X9QA 2ZI4A 1X52A 2XY4A 4V2UA 4Y2QA 1XVIA 4HP8A 5JAUA 1XD8A 4US1R 4NENA 1M5UA 1EGVB 4DZTA 1ZLXA 1YVPA 1ECPA 5ALTA 2SICE 2J07A 3VRHA 1C80A 2DH5A 3BRCA 3LBIA 4FLXA 4EKWA 3CMAF 3C3JA 4J76A 4YJGB 3SXUA 1FDWA 3OZBA 3VPSA 1RC8A 4ZIRB 2CC2A 1LZKA 2P7HA 2ZIFA 4H31A 2GHRA 4Q9IA 3UJDA 3O7WA 4EVRA 2B69A 3BX1A 3WYFA 4J0CA 3JWHA 1EI9A 1OJLA 3FNHA 4NBSA 2RGAA 3RR2A 4DVGA 3VHXB 1NI3A 1VQ9V 5CX4A 4KBYA 1JZTA 2DLDA 4CKBA 2Z0MA 1QLEB 3QBDA 1UKEA 4C0BA 3BGIA 2VDQB 2GCGA 3RE1A 5HNKA 2IX3A 2R1VA 4JI3O 4OSOA 1LUWA 1GO1A 2GPYA 5ELMA 3W5BA 1Z2EA 2XAAA 3H3XA 3CR7A 3OCZA 4YJHB 2GD1O 4EZIA 1PF7E 3FYSA 4GOLD 5K3SA 4QOGA 4B3DA 3WNZA 5LFAA 2IPOA 3KOUA 1EFRA 4G4VA 1OASA 2GK6A 4BQOA 1MO6A 4B2IA 4C4RA 1XF1A 1VB5A 3AYZB 1E1RG 1A95A 2XCOA 2LUOA 4CLOA 1MB4A 1NN3A 3AESA 2V7QA 3H7IA 1BCRA 2LBPA 2RJNA 4W7HA 2PWYA 1GPUA 2IQ5A 4HQRA 3PDIB 1ZRMA 5EZQA 5FOVA 3SOPA 1I7SB 2ZR2A 4M21A 1FDVA 1I4WA 1URPA 2HEIA 2QGZA 3NEYA 4GSKA 4WGFA 4UZSA 3IV6A 5EEGA 3D6TB 5GW7A 4HX5A 1EBUA 4I99A 4OHBA 3NI2A 1E3WA 1I01A 3RVPA 3DL4A 4MYCA 3HV0A 1E3QA 1EFUA 5F2KA 2ZBFA 3ORFA 1EK5A 3GLFE 4EW1A 4OA8A 2Z30A 3ABTA 3BSWA 1FKAO 3L04A 4EHLA 3L0YA 3HA5A 4Y2HA 1O89A 2DWUA 3C9TA 2GCOB 2Y2VA 1VHLA 4UVAA 1N9KA 4ZAYA 5BQPA 3FOBA 1KIMA 3L92A 1XQ6A 2WJGA 3AYXB 2IYXA 2YY7A 4HTAA 2X0DA 2DUJA 2VJPA 3IBGA 3HYNA 1Y74B 1GRQA 4I9NA 1W0CA 1BFKA 4LGYA 2E6KA 4WNYA 3W6OA 1A4XA 3FIUA 2VFAA 3EFOB 2YS8A 2IU3A 1ZOSA 3ZVNA 1P84F 3KTAA 4H4EA 1L3CA 3DDWA 4GWKA 3V4SA 4Z54A 1Y74A 1IXSB 1FYEA 1NXVA 1WB4A 2R6CA 3WIOA 4HB3A 2TYSB 4OQNA 1LUVA 1ES9A 2ISSD 2YBEA 4ZYXA 1JQ0A 3OGCC 3WE7A 2WICA 1C8LA 1UPCA 3G4SF 2IKSA 2F8MA 4ZC8A 3NHBA 3USES 3ESDA 2BM9A 5DIFA 5B53A 1T2EA 2YMLA 2BCEA 4FHCA 4OLJA 4Z0NA 4OQEA 1RP1A 1V48A 3DKPA 1XNRB 5FLXA 1VLVA 1COZA 2FF7A 1FS4A 2P6NA 4ZVRA 1NKVA 1Q21A 4DV4O 1O9BA 3GV0A 4Y9DA 1KE2A 3VDXA 2JW5A 5LC1A 3QELA 3W9BA 1JRLA 3T7JA 1MUUA 3WMXA 2CUKA 4X94A 1G5IA 5JJCA 4KAAA 2NUAA 1XEXA 5ADVA 1C81A 4H9GA 2J3LA 2GD0A 3A9SA 4KNWA 2XYRA 4RE5A 3B52X 1LS6A 2YYEA 3ZBUA 4NY1A 3T4DA 1E2UA 3V7YA 4OPMA 3AHHA 3ESYA 4DWJA 1E79G 3H11B 1O2DA 3U4DA 1DRKA 1BH6A 2HFEC 1Y80A 2EATA 4FDLA 4YO7A 4DR7B 5DYIA 1PT6A 1ONNA 5AVQA 3CXCU 1ZW6A 2M6LA 3HY3A 1NVPD 1L2TA 4J7AA 1E94E 1R4AA 5EFZA 4G3XA 3HLTA 1VLZA 5IJ9A 2NO7A 2SKCA 3PI6A 4TSFD 3WGMA 2ZVZA 1E1QD 4BU1A 4D96A 2JGMA 2JGLA 2ZFUA 3HCOA 4WOKA 3DVAA 3RK1A 5CA1A 4IQ8A 2D1QA 4D92A 3I01M 3M2PA 2XV1A 3K5MA 1T0IA 3NHUA 3SS8A 4NTYA 1C4KA 1Z0ZA 3N3AC 3OMWA 3PUJA 2PD4A 4S1OA 4EYOA 5HP8A 3ER8A 3GBVA 4L8JA 4XOIA 5C4MA 4YUZA 5ENVA 1DV1A 3ZVLA 4AX8A 2ZU6A 4GPZA 2NV0A 3EFBA 4MJ7A 1CHNA 2CLMB 1L7VC 2Y93A 2QRGA 2ST1A 3APQA 2QJFA 5AJXA 2FJPA 4H3KB 4RORA 5EC8A 1N32B 3LVQE 1E9DA 2O7RA 3H5RA 4IAOA 2PX6A 3KT0A 5EIBC 4PW0A 1P3DA 3QLUC 3H1EA 3R4CA 2W5UA 4GOND 4I08A 4WKNA 1IN7A 1GM9A 2FK8A 4DXHA 1DIGA 1NXPA 1JYEA 2IBSA 3G49A 4FYWA 1U43A 5LUAA 2YX1A 2WYVA 1OE0A 2HVJC 3G8YA 4KV9A 4TLMB 4ZO7A 4B81A 1Q1ZA 1E89A 5DHRA 5B7QA 4JOSA 1BA3A 4CQLB 4ZAVA 2NADA 5FNVB 1N6RA 4PN3A 1EDOA 3FVRA 1II8A 1ZD3A 3AP1A 3FH0A 4GUDA 2AHZA 4MWEA 4UC0A 2PRJA 5TMDA 1MJNA 4X61A 1PYGA 1U8UA 2ZXWC 2W2PA 1Z0SA 1ZJ6A 4YR7A 1C9YA 2XPCA 1G4AE 3ZGVA 3AUKA 3I72A 2O6HA 2LCIA 2XA1A 2ZYAA 3L1IA 4RFSB 5E8RA 5CVTA 5IM5A 5T4HA 1V1JA 3D02A 4YRKA 3QEAZ 1VBKA 3QUQA 3HTNA 1D8AA 2W2LD 3BFVA 4PHGA 5CVVA 1U3LA 2GI4A 4DCOA 1YIJF 1A9PA 1XZCA 1JYFA 3E9QA 3RKUA 3M9WA 3ZDEA 1PK8A 1J5XA 2FRXA 2INGX 2J85A 3N8HA 5BSGA 1O5TA 1RRGA 1OV9A 4AUEA 3V1NA 4K6MA 4BP3A 2CXQA 2ONYA 4Y7CA 4YAWA 3DQPA 1G8JA 3FZQA 2HPAA 5ALIA 4W99A 2O48X 3R5XA 3W5UA 5FWYA 5F98A 4X8AA 2I78A 2ERXA 1DP4A 1H0HA 2Q21A 5DTJA 5AT1A 1ZLZA 5EVCA 4C06A 1DFGA 1QHHB 2DQ0A 4E08A 2BFDA 3HSSA 5LD2C 2RFLA 5DH9A 2Z6QA 3QIAA 4IHAA 5KWEA 3MIZA 2NV6A 2ODWA 3SZLA 3DT6A 4DR4O 2ZE5A 2IZ0A 1KC3A 2W90A 3EDYA 3A31A 3Q41A 3QY0A 1BVRA 3EIEA 4N5IX 4U9UA 4EHIA 2LGJA 5IMSA 3CC2V 3K3WA 3NHPA 4QVIA 1PN3A 3RBZA 1GQ2A 1Z6YA 3LKZA 1KQSF 1FTYA 1PJBA 4L73A 4X7BA 4AYWA 2QDXA 3AFGA 4EGJA 1L4HA 1QNFA 5FR1A 4N12A 4TV9B 1Z45A 2ENUA 3GJXC 1LSJA 4Q02A 4Q3EA 5CT4A 5G53C 2OA0A 1XIVA 4EBFA 2QKAA 2R7NA 3TCUA 4FZJA 2QP9X 4MGZR 2PYJA 4YQYA 2CHFA 5EHIA 5FTWA 2CVQA 3SR3A 3T1OA 1JI3A 1V4NA 3WSWA 4GKVA 5LQCA 1VJCA 1U8XX 2A0YA 2AUMA 1C3JA 4KZKA 2OHWA 4CEIB 2PKEA 1VI5A 1KI1A 3ZNNA 4BVFA 1CYDA 1KO4A 3UMRA 4EHHA 5B3KA 1XF9A 4ZHSA 2GCPA 4ZJZA 3L8ZA 4S05A 1V7QA 2HJSA 4DA4A 2IYUA 1DFIA 3ECSA 5DHAA 4QNMA 1NLMA 5ECWA 4BLQA 4LF7B 1Z06A 2JDIG 2GH1A 2W0MA 1WMEA 3HWWA 3WL3A 5L3QA 1UBOS 3OZFA 3KU4A 2F93B 1PS9A 5CYFA 2WJVA 5H68A 5EB1B 1KP2A 1XXLA 3FBTA 3VZCA 3E9YA 4FLUA 1YB5A 4HEA1 2WJAA 3ER6A 2L82A 4IJUA 5F7ZA 3SM3A 4B47A 5IWCA 2XRFA 4LZAA 3VH3A 4DQ0A 5FAKA 4IH4A 4WT7A 1JG1A 3JZDA 1FFWA 2RBGA 4CTMA 4K0RA 3G2PA 3OZSA 3ZHZA 3ZHSA 1NVEA 3GRZA 3WMFA 5JW6A 2AZDA 3LA8A 1D6NA 3DC2A 4LJ5A 1E2FA 2QLTA 4F3KA 5I47A 5KYNA 1YIAA 3IUBA 2D3OW 4HLNA 3P20A 3GDGA 5EUBA 2ALEA 4LY6A 4PPYA 1KB9F 2A7XA 3ASUA 4IHJA 3OEHD 1TF5A 2WD9A 2HYDA 3HDHA 3KZKA 4M37A 4IM7A 1XDBA 4YR9A 2DECA 3N8GA 3L0OA 4ERHA 3A2FA 1SUDA 2G5GX 4URVR 1OA0A 4PZPA 2FRDA 4NQRA 1WRBA 2DQKA 3QW4B 2CMFA 5AUNB 4HNSA 4BP1A 2VGNA 3VDNB 1UDCA 3SJCA 3WP1B 1DIBA 2DT5A 3DDUA 4GICA 4K1LA 1ZITA 4EYEA 4MW6A 4TVBA 1FXKB 4Y7DA 3IP1A 3GYQA 2YDYA 1M2VB 2QUKA 4XIGS 5CR9A 5ITZA 4NMWA 2AOUB 1QZXA 2VKTA 3IJEB 4QYXA 3GRCA 5DTIA 1NJIW 2PT9A 4EQ6B 2IJHA 4YPVA 1U9JA 3AOGA 1G2IA 3F4LA 2Q49A 4TWIA 4Q9KA 2XXAA 4G85A 5FRDA 4I7ZB 5L45A 3CCRV 3B3FA 2XQJA 2AOUA 3QO8A 3STZC 2WT8A 3BCUA 4IPTA 2XMQA 1WUIS 3IIJA 3TE7A 2C3YA 2IXBA 1ANKA 4PG7A 3ORHA 4KEAA 3B3JA 2IUSA 5EQTA 5G0SA 4LX0A 5HIJA 4BLOA 2ZATA 4DCPA 3ZD9A 4ZN6A 2CL6X 3UJAA 2JNBA 1XV5A 5FPPA 1Z5OA 4ZYVA 3LTNC 1HQKA 1KZ6A 2F55A 2GXUA 5DLYA 1LC0A 1CN7A 1W5SA 2GWRA 3CUVA 4QLAA 3IR7A 3ZJZA 3MRSA 2CGNA 3IUNA 3LP8A 1N8NA 4FZ5A 4QQRA 4DC1A 1Z6XA 3IHTA 4OQQA 1H0RA 1OLUB 2FA9A 4PV1B 2NTJA 2ZSDA 3O4IA 5H9CA 3PPYA 4YRCA 4HEJA 2HJDA 3MSCA 1YL7A 1HUQA 4JASA 3TSOA 5B1EA 1Y6ZA 1Y6GA 1R0ZA 5JJJB 1QGDA 1V8ZA 3HJAA 2UUCB 4Q3DA 1U3WA 2VQEB 1XL1A 3KWMA 1H5NA 1I0ZA 4QE3A 2X9NA 1GN9A 5TGZA 4OQFA 3M5WA 5KYWA 3GCZA 1BC5A 2GERA 1Y5MA 4KDFA 1WN7A 5HXUA 3BG5A 9LDBA 1SULA 2NU6B 4JIMA 1RJDA 3AR8A 4P4SA 3DD1A 4D0LB 4DPLA 5CB0A 3HN6A 3Q3JB 2I66A 2KE5A 4DV5O 3REGA 4GR9A 1QLEC 1N6IA 2Q5LA 2VP5A 3GGDA 3RIYA 3B6NA 1DKRA 5IHXA 4OGGA 3KV3O 3GGJA 1FMLA 2QTHA 2WIDA 4Q9LA 3WB2A 2NU8A 2GMWA 5CB4A 2NTVA 1JIVA 2AOXA 4LQLA 2XUQA 1M57B 2Z2XA 3QHQA 4RDIA 5AFSA 2WHYA 3ANNA 3PNKA 5E6UB 2PANA 2HTFA 2YVQA 4KDEA 3VIUA 1IZ7A 1U80A 4G5XA 4R3WA 4KXUA 5FTNA 3OZCA 3GLGB 2G36A 2JIBA 3EQ9A 3HEBA 5TDHA 1MHPA 3I8OA 1LTHR 2DN9A 4JBYA 2FMLA 3P4YA 3ZY3A 2ZZMA 2BTOA 3CCMF 4G8JA 4GXQA 3Q8XB 4KIJA 5CB4F 3KSRA 3PL1A 4N49A 2AFVA 5JCOA 3D9QX 2X9VA 3GP8A 3TGPA 1T8RA 3UGTA 4GDFA 3DV2A 5EHGA 4U7DA 3F0FA 1OFTA 2P4EA 4I5EA 2W6JG 2IHBA 4YP1A 4RTSA 1BMFA 1ZL8B 2HV9A 4QEDA 4YHHB 1RFLA 3OONA 2HVYD 3R9IA 3ZWBA 3PUXA 3QVWA 2WWFA 2VUTA 1JFLA 3QJYA 4J9YB 3JQRA 5DEOA 3ZD6A 2CWJA 1O3YA 4ZMBA 4ZT6A 2VSNA 2JGDB 5TF0A 4HSEA 4DIKA 2L19A 3O94A 4MVJE 3RFVA 5C35A 1YFJA 2WYHA 3P4UA 4DF3A 2OILA 4LJSA 3SVLA 3W3AH 1SKVA 1R1DA 5IJ0B 4GPBA 2VHUA 3K0EA 3FLEA 4NK4A 4FBGA 5D1NA 2EKQA 4GMFA 4R9UC 4DVJA 5BV1A 3I6IA 5LLTA 2J30A 2PR7A 2PX4A 1KL7A 3HXMA 4MVQA 1VL8A 5FHRA 3CMAV 2CW4A 3CC8A 3AG2B 1YJWV 3KV1A 3FOCA 5AOBA 4BVLA 1ZTEA 3ZV3A 2JS5A 1XKTA 3FYDA 2Z2IA 3ISJA 1XKQA 5A2QN 4P3OA 4RIHA 1GTRA 1UFVA 4P34A 3S3WA 1RWWA 1DKLA 2E4VA 4ETIA 2LBXA 3NHSA 1PJQA 2AHOA 3AFOA 4KMOA 1ZL2A 2AZMA 1WTAA 3UAXA 4HYEA 2C31A 2G6TA 2P78A 3KKPA 4DYVA 4QATA 1ZCFA 2IOYA 2HDHA 5CIYA 5I3CA 4KSCA 4QQKA 1AQIA 4IWXA 4DLKA 5JWOA 5TLSA 1C3EA 4WNCA 4Y1RB 3JCZA 2O8NA 2NSYA 3B13B 2AR0A 5AHOA 3GEBA 1N7GA 4KHPB 2AJCA 3HACA 3F8TA 1J5EO 4C0JA 4Y2SA 3H9VA 2WF7A 3T3IA 2N46A 4RZXA 4EUNA 1YMUA 1TRHA 3LDGA 3N05A 3W90A 3DLTA 4BXOA 4ZGWA 3EC2A 3TVTA 3HZZA 1PWYE 1E8DA 4QASA 4CBVA 2OBBA 3ZGZA 1OSNA 1GGKA 1N2ZA 2MINB 5FO1A 3NX4A 3NPMA 3G9UA 3WNQA 3UUEA 3PENA 3KC2A 1MNGA 3KE1A 2ZODA 3RFXA 1J2TA 1KK1A 2AHRA 3TOVA 2NMVA 3WLMA 1CQXA 3KZXA 4RVCA 4XPZA 2P7TC 4ND5A 2REXB 2AIFA 4YRNA 1DE0A 4LV5B 1N4DA 3RS4A 2B83A 4LWSB 4JWTA 3MB8A 4CG0A 5BOSA 4YH1A 4GRAA 5CM8B 3BB3A 1BHAA 3HH8A 2R96A 5KCMA 4ZJPA 4PQYA 5BW4A 5KVAA 2EQ5A 4BLPA 4DYLA 1X7XA 4DG9A 4KK4A 3L7LA 1OWMA 3DL7A 4IIYA 2K4MA 1T6XA 1Z08A 2MMCA 1LUAA 1O03A 3ABQB 1HE8B 1DO0A 1NXQA 1PT9A 5IXSA 4KI7A 2PGOA 5K0TA 4IDEA 1JA8A 3E8BA 1NG1A 1EFCA 1M72A 2BFWA 2V7TA 3K2EA 4ZQGA 3G71F 3S27A 3TR0A 2FPIA 4WASA 5GJBA 3OPMA 1FNCA 1T3HA 4BNWA 3K0DA 3R0JA 4F8YA 1GTG1 3Q2KA 4K9QA 5DRTA 3DSQA 2BCGY 2ZOVA 4YUYA 4M99A 1J09A 3G67A 3BOSA 3EVDA 2WWVD 1KYIA 1QRDA 4PBRA 4Z99A 4B4VA 1PFVA 2OV4A 1M5IA 3OQBA 3U4IA 1NUHA 1GKYA 2R44A 3O6VA 1ZMOA 3EASA 3TBHA 5ICCA 2ZI9A 3QVOA 4DM7A 4HC4A 1B76A 1VL0A 3D6UA 2C2MA 4GPTA 4OLAA 1JLRA 4WXMA 3F8WA 2HPVA 1I3NA 1X1DA 1JJVA 2XF8A 4WVLA 1IJEA 3DO5A 2EL9A 3AF5A 4BRZA 2R9VA 1QWSA 1FIUA 1R4NA 4FW8A 3V42A 4TMKA 1ZWLA 3HJFA 4PRLA 4OHUA 5KU1A 3NGLA 3THYB 4MUEA 1MPTA 4G4YA 1QIEA 4JQSA 1L5GB 2ZOSA 5ALWA 1SIOA 1XL0A 2GUZA 1C0IA 1JU9A 1P9LA 2SCUA 3JVEA 4HDNA 4M1SA 1TA8A 3PRYA 1H8EG 2A0KA 2FEKA 2HM7A 1QR8A 1A9YA 1AHIA 1MOQA 1ZG3A 1OAKA 2BHNA 4IWYA 5T64A 4GM1A 5H6QA 1JHXA 2QIPA 4I81A 4RQEA 2QRHA 2FEMA 3G6KA 5FPQA 3MINA 3RHFA 1AJEA 3AF2A 2F95B 1SCNE 2WAOA 2W93A 4PYNA 2IDJA 2WVAA 3U0BA 1FQKA 1GZ6A 3KJEA 2Q8NA 3MJ4A 3TAHA 3KLPX 3HJTA 4BBPA 5IWAB 1U0OC 3USZA 4A92A 3OGIB 3H2JA 1L7EA 1BDJA 4J9VA 1M4UA 1X9GA 3L01A 4J29A 5DSTA 3MDSA 1XTPA 5E3JA 5JSYA 4UNRA 5BXQC 1A1VA 3OE7A 1JSZA 4H33A 2RGUA 4HZIA 3S3TA 3T9CA 1EWTA 3VU9B 1DBVO 5JNLA 4C8EA 2MT9A 4D9FA 2OHOA 4EITA 3B6IA 1ZZGA 4DM3A 2IH2A 4MZXA 2HCRA 1NC1A 3E70C 2AT1A 1CUWA 1ZFNA 1YEWA 1P49A 1D5NA 4LFAO 2VP4A 3RJ9A 1V41E 4DL9A 1J8DA 5EEHA 1E58A 2QGNA 3P5SA 2H9YA 3BKXA 4ZYWA 1QH8B 3H8VA 2GKOA 4EAQA 1L4GA 5CIWA 1SVOA 3TNJA 2QN3A 3VO2A 4DRZA 4YX9A 1QAOA 2O4CA 3INNA 1A8IA 5EFOA 4PA7A 1WIWA 4YRTA 2VOJA 3DG9A 1UWKA 2HR3A 2QA4V 3CLRD 2OVBA 4G41A 1CRZA 1YNOA 2BUBA 2I2CA 5HFAA 2HRYA 4B76A 2F1IA 1P60A 2VTBB 4YDHB 2P9FA 4Z4FA 3CMCO 5CBHA 1E92A 3RYHB 4KODA 3JXEA 2HREA 1YWGO 3PC6A 3TF5A 5IT0A 3MQFA 5JQGA 5KHAA 1UOQA 1QQBA 4P7FA 4RMNA 1A96A 2LGWA 4UEWA 2WSIA 3CPWF 1T1IA 4UVEA 4AAYA 4CDGA 4H6WA 4QU8A 1H42A 3D0QA 3PA6A 4F91B 3FZNA 1VQNV 4EYQA 1WB8A 5KHIA 2F1OA 4QNRA 1S3GA 5FEMA 3STUA 1P7ZA 2AMYA 4YREA 4JSTA 4P7KA 2QEQA 2XXJA 4QNHB 3CXCF 2HRCA 4G4SP 4TVKA 2J0VA 1TKBA 1EP1B 1TU0A 5H80A 4U2CA 3D2AA 3FLAA 2HRDA 2ZIOA 4JI6B 1ZM4A 2IZ6A 1NF8A 5BXZA 1IUOA 1T15A 3LFUA 5M5BA 2ON6A 3GH3A 3VNSA 2DY0A 4OB6A 3DKRA 2R66A 3EC7A 1T4MA 3NUZA 4JZYA 5FOWA 4ONEA 2RSLA 2KYRA 3O9VA 3FHOA 1FPOA 1E3DA 1UFOA 1OVMA 4E2YA 1NF2A 2SKDA 4G4WA 2Q3JA 4HGZA 4UQPA 3R9KA 2VYCA 3JAMM 1L5VA 2V98A 5F77A 1SEVA 1GXSB 2A94A 4F4UA 3MHHC 2O8CA 2GHYA 1M6WA 4KQ9A 3LUAA 2IHTA 3SEZA 1S01A 5IX8A 2QUBA 1AR4A 2P6YA 1JS1X 4K3UA 5FL7G 3HKEA 1EZZA 5TEVA 3TIFA 1ZI8A 721PA 1KQFA 1GXSA 3U61B 4X65O 4M8NE 3P52A 3C90A 3D4IA 4AHCA 1C1XA 4UVHA 5DTRA 5HA5A 4AYXA 4M7OA 3BILA 1AJPA 1L7PA 3AG3C 3FFWA 4DA0A 3A1WA 2Y4TA 1BGVA 1YTLA 3DOEA 4AIRA 4JLWA 4CLHA 1OFVA 2CXTA 3QX9A 1T3SA 5EG5A 1FXUA 2Q3CA 3E8GA 1NDQA 5L53A 4EG8A 1UJNA 3BQ9A 1A72A 3SYTA 1WU8A 3UT5A 3L7IA 1GGMA 2Q5CA 3CZ4A 2F59A 4K0KB 3DWFA 3CO0S 4LJYA 1BJRE 3EZGA 3RRZA 5H1YA 1GN4A 3CYQA 3S1SA 4G1EB 1BDBA 1YR3A 2OXFA 1M1YB 1T8TA 2PTMA 3PIDA 3K4HA 2D1FA 3M9XA 4YXWD 2EYQA 2J6HA 3QQ5A 1DTSA 1RYNA 2ZB3A 2XBUA 5AM2A 4NBKA 4TUYF 4CMGA 2WRZA 4G4JA 2AG8A 4KHPO 3LYLA 4IXDA 1WDWB 1PFQA 2ITDC 4TRJA 2QV7A 5IN5A 3CBGA 5DWDA 1E4OA 5D5QA 2EL7A 3R20A 3WO0A 1A5AB 2OZKA 1EEHA 2GKSA 1WM1A 2ARKA 3NLLA 2VA8A 4HMQA 2OQVA 4ZCIA 5F23A 3LD9A 2CFCA 4DY4A 4ZVVA 2BD0A 2QZZA 4IG9A 3ZQUA 2YHBA 2WHRA 4CODB 1N6LA 2XMPA 1QQAA 5BSUA 1ZNZA 3LQ1A 4MW7A 1C7EA 3RD5A 3TG8A 1YCGA 1UJCA 1WDLA 3QKRB 2YEVB 3IO5A 3FYCA 3V8MA 4UBIA 2HD4A 5DNAA 5HCNA 4LXYA 3G6EF 5BSFA 1C14A 1MTZA 1Y33E 1USVA 3S6JA 4NZZA 1SOAA 3PP8A 1N0WA 1GG2A 4JT9A 1FU4A 2RGGA 2Q3EA 3KLOA 2YEVA 2ZBQA 4I0WB 3E2MA 1HORA 3HPQA 2QORA 3P2JA 3B09A 1MZPA 1K08A 4B3TO 2YFKA 3BHNA 4ZOLB 4LP8A 4TV9A 1WXEA 2XBLA 3I73A 2Q1YA 1TA9A 4GPAA 3OZDA 4QPJC 4RTOA 3A1NA 3CSUA 2ZUTA 2FCRA 1LNZA 4LRQA 3TTUA 5IF3A 4HADA 4DG5A 2BFCB 3D6JA 4UD6A 3ASVA 3RC1A 3PQEA 2H3EA 1YHYA 1NJ1A 2HA6A 2C7RA 3ZKWB 3BCSA 1IUKA 3ZE6A 1NVPB 2QNIA 4YBRA 3TXYA 4NQZA 3UFBA 4D9MA 4UCSA 3JWEA 1D0IA 4BLWA 1WQ3A 2I8AA 1N33B 4KKXB 1OCCC 3RUHA 3LY8A 4XIJA 5TY0A 2OB1A 4BO7A 2OKGA 3V9PA 2B1GA 5TQ2A 4WLVA 1ATIA 3D0OA 3CRRA 1U0LA 1LQUA 5GWXA 3T1HO 4B43A 3O21A 2IYQA 3UT5B 5ILOA 3ZHQA 1FL9A 1Q3HA 3P9RA 3TUZC 3VU1A 4ZMRA 2C83A 3GZJA 3SZOA 3HYLA 2CSUA 3I42A 1T1GA 2GF0A 2FX5A 2H2GA 4HK4A 2YVKA 3C5CA 1N5JA 1QXSA 1VLHA 1YNSA 2ATXA 2KBEA 2ZRGA 3EK2A 3M6XA 4L5YA 1CR1A 4WK0B 1Q0QA 2DYKA 4HDQB 1UXKA 2DYRC 1IEQA 1OD6A 2JLCA 3SKVA 1HE5A 3ZVKA 2C7PA 2Q7EA 1RJ9B 3OT4A 2D1TA 1BJKA 4Q4HB 2ZQYA 4L16A 1P62B 5I7EA 1M6YA 3EVCA 1S5LZ 2GDZA 1JTEA 4U02A 4V39A 2EILB 3S2ZA 4C43A 5H81A 1Q81H 1NFRA 3AU8A 2P4VA 4FJ2A 3TFOA 3L0SA 1EN4A 2QQ0A 4OI4A 2CLKB 2ZJAA 3J7AR 3MZ0A 2E2WA 4NKGB 1GV0A 1I14A 1YKSA 3FLMA 3IGFA 4HN2A 1OLOA 4JB0A 2DT8A 2R1TA 1J0XO 2V7XA 3BTOA 2XVMA 4PRKA 4UUBA 3OZEA 5GJWC 3V1UA 5K9ZA 5EIFA 4UMDA 3UBTA 3M81A 2LPMA 2FLVA 1SBZA 2IF2A 3VPCA 4BIMA 3EXIB 4FE7A 3D8NA 3M99B 1P2TA 4TWJA 4L8GA 3RFCA 3ZP4A 2H6EA 2AFHE 1AUQA 2OHGA 2P9HA 3CT6A 3ENNA 4J03A 4X44A 4YC7A 1UFRA 2QU7A 3TOXA 4E0BA 4ZOLA 1J0DA 3IDZA 3L5KA 1K0FA 1YQUA 4IGFA 1T8WA 3C70A 3UXHA 4BNYA 2AA3A 2UXDO 2CBZA 4L2IB 1WB5A 5HKLA 1IM5A 1I4DD 1AA6A 5DBOA 3ZXUB 1WVMA 1UAGA 3CF6R 2C5LA 4PV7A 2HF8A 3IEQA 1NXTA 3QE4A 5A9SB 5FUQA 4CT4B 1T5EA 1FX1A 1O6FA 4PICA 2VDMB 3EAGA 1QOZA 4JI8O 1J1ZA 1X7ZA 4K3AA 3GLIE 3B9RA 3QXHA 5B5EZ 3WYAA 4MR9B 1A4UA 3WMGA 3MRTA 1M6NA 1F7VA 4LDJA 4EUEA 1K73H 1TUEA 3T9FA 5CD9A 4IIBA 3EY4A 3IDFA 4CGYA 4EJSA 5IT4A 3QFTA 4TS3A 5CW1A 3L73H 1ILWA 1NPDA 4XLLA 3GOQA 5DB4A 3KPWA 3LPNA 1S6YA 1KJYA 3B2NA 3DEJA 1D6JA 3C45A 3WGQA 1TA4A 3JQBC 3CM0A 4DBVO 3NANA 2AJBA 3O75A 4LTMA 1SB9A 2AFHB 2IG8A 3H16A 4HRVA 1GNRA 4BVHA 4TKVA 3GA5A 1L5YA 2CHTA 3NBFA 4TX1A 4NYIR 1KP9A 4WLNA 3SIXA 4FLTA 1TJ4A 5K8LA 3VO8A 1YJWF 3TPFA 4GQAA 1HDGO 3ZG6A 2I4LA 3VQVA 3FVWA 3WHLA 3GX1A 1YTUA 1PHRA 4FP9A 4TXMA 2P5TB 3AKYA 1ECJA 2QL7A 3ESXA 1HT1E 4EW6A 5J2UF 2PGGA 2JIZD 1PV2A 2VTEA 3DNPA 3S2YA 3SYKA 3UHPA 3W3ZB 4YJFB 2Q7HA 5L3DA 1KYVA 1ULAA 3DJYA 2ETVA 4GFDA 4RV4A 3S81A 1M56C 2QYOA 3URMA 1VDMA 1AV6A 1EZ4A 2NVUA 2XNHA 2PZKA 1Y3FE 4LJ4A 3QVJA 3D1LA 1R16A 3QF4A 4LCBA 4A8JC 3ZE0B 5A4AA 2ZYVX 1H1LB 4JITA 5J2UA 4EDHA 5JASA 3D8UA 1PI3A 5DT9A 3FMFA 4HVCA 4BNVA 5BSVA 1WP7A 1YACA 1S3IA 2YIVX 4WKOA 3U3XA 3IBCA 1NWCA 2FXVA 1QDEA 5B1AC 4MA0A 4FYMA 2QKSA 3W34A 5CG1A 2ZS8A 3IL2A 4A15A 3MWEB 4C8IA 1R9GA 4FE3A 5HP7A 3B1JA 3JARA 1YFKA 2PNJA 4DCGA 1N1DA 2YBDA 4KVAA 4PO9A 4B2LA 5JRJA 1D2RA 2C94A 3M33A 4MIYA 2PZMA 4RXUA 1ZUD1 1I7NA 1J56A 4FMDB 3A36A 1DBWA 5JNVA 1NVUQ 4X3LA 2Q3MA 4K7JA 3BD9A 5DHFA 3SSNA 2AMVA 5L3GA 3O8OB 3KRTA 1IRXA 1VPEA 1W36B 5E2BA 3F5MA 4DJAA 3I52A 3ZH9B 3IPCA 3BFJA 1CEEA 1J42A 5EA2A 5IE9A 1N5OX 3C3CA 2ZJ7A 3CN7A 2BGKA 2H52A 2VEOA 3QMVA 5JATA 3T9BA 5J4KA 3TXQA 1UOPA 1SPBS 4JV5O 3AIIA 3BEHA 4A82A 1EUYA 2F8SA 1KEEB 3MJDA 4REOA 4BFLA 5JYCA 3CVUA 1VIDA 2OXRA 3KVRA 2A0UA 4RD0A 1DQPA 2CJPA 3TJTA 1R6VA 2KB0A 3VH4A 1B42A 2DLCX 2X6BA 4ABYA 5B12A 4AZVA 3T35A 1DUIA 1N1EA 2D2VA 4J2TA 3K9BA 3OIFA 5KAMA 3P19A 2EDAA 2O06A 2HBQA 2PZLA 4IDQA 3TW4A 1OAOC 2DZDA 3TPZA 5AK4A 1YZ3A 4C81A 3PNLA 4FMPA 4F38A 2QWPB 4LNAA 5JS2A 4OP3A 1HWYA 3UK6A 4BECA 4Q24A 3COYA 3CGGA 1Z62A 3I55F 2HEPA 3KEGA 5C51B 3C3AA 4RD4A 1LJ8A 1XZNA 3M5PA 5JS1A 3ZV5A 1QTIA 2N9UA 4U7PB 2VH2A 1T5BA 3EIHA 3ZOPA 3M0EA 1FFTB 5FA8A 1NPTO 3WLTA 1BVUA 1J8YF 3CS3A 1BD4A 4PZEA 4EO7A 2OWEA 1UH5A 5LD2B 3THYA 1KUQA 4FSXA 4JJ7A 4OUDA 3C1TA 2ZRFA 2ORWA 3GI1A 3NP9A 1SK8A 1DVRA 2HADA 2A67A 2P91A 4JNCA 4S1NA 4E13A 1OIVA 3QPWA 3SOZA 3FHTA 4X66O 2QT0A 3EZ9A 1LLUA 1RI4A 1UPAA 3MILA 5DJ5A 3ACCA 1DAFA 1R37A 5CXUA 1H0SA 2W42A 3UVEA 4B87A 4EWLA 1VQ1A 2A59A 4PHHA 4R2IA 4HH1A 4WL0A 5GONA 4OOEA 4YIKA 3FSEA 4Y6OA 2XUOA 5DI3B 3PEWA 1FPQA 1HNXB 2GRAA 3N6RA 2O8DB 3FD5A 3RS2A 3ETHA 4RHAA 4IDAA 4EG6A 4ZZIA 1V8PA 4AKHA 3FGPA 3QWHA 2ZETA 2A3RA 2XD9A 1IONA 1WMDA 4OJNA 3NBQA 1XQ1A 3IX7A 3KHKA 1J22A 2UKDA 4BB0A 5HW0A 1HX7A 2XWJI 1DADA 1K4KA 2R9AA 3KETA 2IBTA 4XRGA 2NM0A 2PGNA 2RHDA 5CT8A 1JGTA 4QGHA 4OM8A 1TQ8A 5EVJA 4DCNA 1B43A 3TJRA 3RW9A 3IP6A 2DMXA 5H9WA 2OMKA 2A0XA 4BFUA 3CMMA 3Q98A 3HWX1 1U7WA 3M70A 4WK6A 2VT7A 3WAGA 1JEQA 2GK4A 1ODSA 1KEEA 1VQ4F 1E7KA 4RHEA 3FB4A 3PC2A 3GPLA 2EYUA 3OPYA 4HYOA 2W2KB 4WPGA 5DP1A 3KKZA 3I9JA 5HOQA 3RGGA 3DEIA 4E7PA 2OZPA 2H1SA 5G41A 5A1JA 2QN1A 1NZFA 3CTPA 3O3OB 3MB5A 3VU3A 3A8TA 3DE1X 2FMFA 5CA0B 4YLYA 5CX1B 1VEWA 1WXHA 2VJNA 1HFJA 3I92A 3P9YA 5CP8A 1NNEA 2CLCX 2IV7A 3TJMA 4NICA 3OTOO 3GLGE 4WF9V 4D99A 4GOMD 2QP3A 4LWPA 3R6LA 5CM2Z 3RO7A 3VAAA 1SZQA 1D7OA 4O4LA 1NBIA 3E2PA 3LGSA 1GGFA 2ADFA 2ZIAA 4ESEA 3AVUA 3TLCA 3G7NA 3EW7A 2JJYA 3KQSA 2FZ5A 3OLWA 4MLPA 1CLUA 1P4RA 1LI4A 1U3UA 2FPPB 3CHXA 3IQEA 3EZYA 4O63O 3VR5A 4ZZ1A 2WHPB 2IA5A 1DZIA 2GAJA 1GPBA 1Z2DA 1S7CA 3DF7A 2JD0A 5E9WA 2QSZA 1E8NA 2BEWB 2R48A 2V9PA 4GW3A 3UJCA 5H8WA 1LBSA 3WBBA 3C6ZA 4QPKA 1AOXA 4IHJF 4QNNA 3B9PA 1NXOA 3CEIA 4QBFA 3BABA 2WG1A 1SNYA 1GNVA 1NI4A 2MMGA 2XRYA 2UXCB 3PQ2A 2UVPB 3MWFA 4G84A 2PGIA 3IIMA 4GZMA 5ESDA 3ZWCA 3X2QB 1N25A 2VNSA 2H0QA 4NJEA 1E1CB 4DT1B 5HKAA 5D6NA 3NV7A 2X5OA 2GN8A 5JYBA 1KWKA 1OMOA 2G9VA 3DYVA 2D62A 4NESA 2VH5R 3O26A 4CM8B 3T3NA 1X13A 1HFKA 2ZRQA 3U7IA 1EIWA 3OQPA 1E1CA 3VSCA 4DT1A 2VJMA 5LZ9A 3Q7EA 4AJJA 4HB2A 3EIFA 5KJ1A 4MGHA 4IOKA 5SY6A 1W0KD 1T4DA 4O4JA 2L69A 4C4OA 1QC5B 4TZ6A 2WVGA 3JSXA 4JOQA 4JI0O 2ROQA 5ADUS 4KH1A 1QHHA 2CDYA 2P0YA 3CCQF 1G38A 1E2LA 4H18A 4HFJA 4NG4A 4P86A 3HBAA 5C8YB 1KKUA 5F4ZA 1H2LA 1Y5LA 2GFIA 4PWTA 4CF7A 3O85A 2X7HA 1P5ZB 1JKFA 1C41A 1PR5A 3S2EA 1SUIA 5E2AA 4BNZA 2RHCA 5FR2A 2WKPA 4WK4B 3WFJA 5ABPA 2HWUA 3AG1C 2BM8A 3HUDA 3ZQ6A 2G08A 5LNK1 1J2UA 1P4AA 4C4AA 1AUOA 1CT9A 5DHTA 5ALNA 3G68A 5BRNA 5A71A 4CMAA 1F38A 1GY8A 1MC8A 1KI6A 5C31A 2P11A 1B0ZA 1UKVY 4Y0AA 1R5BA 4AURA 2FN9A 3LDCA 4LJRA 1THZA 1W47A 1VQ7F 1KEZA 1W44A 3LUKA 3PFGA 1JU4A 4EBBA 2BHLA 3WMWA 3RKRA 2Q6VA 1E98A 4L6AA 4PX2A 5BMVB 2DQ4A 1XXHE 1G55A 4QLOA 5K51A 3ER9A 4KX5A 5AW0A 4UCWA 1GRNA 2QJWA 3LWPC 1SOVA 2P4HX 2QPTA 2RH8A 2YCBA 4PHFA 3SYRA 2JLRA 1YBMA 4C22A 4JC8A 2WV7A 1VJ5A 4HAWA 4ZVNA 2LJ2A 1IX9A 2BFFA 4D43A 2DWEC 1A98A 1XLTC 1PM9A 2ZU0C 4PG8A 5L3RA 3I9V6 3P97A 1RWVA 1YQDA 2OZEA 4M98A 4OH1A 2O19A 1NVGA 2EZUA 1PDVA 1JDSA 4BAZA 1A4RA 4YPOA 2ZIGA 1U65A 3Q8MA 1FPMA 1BDIA 1ZD1A 3L1KA 4XDJA 4EMUA 6ABPA 3I34X 1D6MA 4PE5B 2PNFA 1TAQA 3RC8A 2CXUA 1N2CA 4ZV7A 2JFHA 3F98A 1VHQA 1ODEA 1YQQA 2IEBA 3KJHA 2HX1A 3DW3X 3BRSA 2XNCA 2WR8A 3WL6A 1PJRA 1ZUNA 1NAHA 1FJ2A 1EQAA 2LGQA 4H0CA 3V8NA 5JEEA 5JJ5A 1ENVA 1IQ0A 3HR4A 1H2MA 3D0KA 1E9VA 3EWSA 1T0AA 2FW6A 1LQTA 2HT1A 4TTRA 3A04A 3OU7A 2JLWA 1XXHB 2YHAA 3JVUA 1EXMA 1LPOA 3X44A 2HJWA 3VXKA 3S28A 1A8HA 4KO8A 3T3PB 3FKJA 3OZ7A 3EEOA 3V8EA 2NP7A 4KCGA 3IC9A 1DEAA 1UXIA 3DBLA 4F7DA 4ZANA 4YAJA 5JCZA 1VQOF 2YJZA 4IV0A 4RVUA 3UUFA 4I5FA 1DTOA 1Q2UA 4WLEA 5J59A 2V3CC 4DTCA 1T3GA 4Z9XA 2PVPA 3B78A 4YWHA 2X6QA 4ZI5A 3WA7A 2GCEA 5BNWA 1XU9A 2SECE 4BN5A 1XDCA 3H18A 3G2MA 4GUAA 4MUAA 4ZYZA 2NZUG 1J7HA 3NVIB 1J07A 1GV1A 3QU7A 1GP2A 4TL7A 2PU5A 2VK4A 3WTCA 5EJ5A 4JXZA 2XWBF 4FYYA 3K20A 1E5DA 3SF8B 3K0CC 4BJ3A 1JIJA 5ALHA 3IALA 3O84A 1UI9A 5E9AA 1PX2A 1PR1A 2F9LA 4BO3A 4P8RA 4IJ5A 2HSWA 2JHFA 4G2NA 2RGEA 3VI4B 4YRIA 4LRXA 1DC5A 5DN6G 1Z2OX 5IEBA 2HK7A 5BWMA 4QDTA 3N75A 1VI6A 4W5JA 3TDNA 1E3TA 1EGQA 1MJ5A 4DK1A 4MYUA 3LK7A 1KJ9A 2WJPA 4ZXPA 4DGSA 1CY4A 5KWVA 4BY9E 1N3YA 3K6JA 1KP3A 3LYUA 4YP9A 1UK7A 1WHTB 1T10A 2IY7A 3D3EA 5CNMA 3AG7A 1SBHA 3A3PA 3MTAA 5F5XA 4AECA 4J7UA 3NEPX 4CIWA 5LQAA 2VZEA 3WQRA 1GGEA 1M8FA 2QWQB 2FFHA 5AW3A 4D8WA 2GM3A 2G5CA 5AI9A 2QTGA 1RVDA 3MHPA 3QVVA 4J91A 4LKRA 4WWHA 4W5RA 5A9SA 3SQXA 1XN4A 5DBEX 3ETCA 4V03A 3I56V 4JUFA 3V4ZA 1ZO8A 4BY9D 2YZGA 2OBNA 4IX9A 3UMCA 2V65A 3NHAA 5KZMB 5I48A 2O2EA 2WYWA 3OD4A 4N7JA 1P9NA 3AZQA 2GSMB 1HNZO 1NF3A 3VQXA 2BEVA 1WY7A 1S2DA 4FYPA 3DVQX 4GLBA 2O14A 1YB4A 1X3LA 2G7MC 2QVZX 4FXOA 3VAYA 4BNDB 2FSVA 3KJZA 3NCHA 4TLLB 3KUCA 4LF8O 3QEKA 2O57A 5FNVF 1VL6A 2C54A 5FADA 4D3ZA 1GPKA 2ATVA 4UNNA 3D36C 4CR7A 1VCNA 1P2FA 2HLDG 4NCHA 2JAPA 4C4PA 4L9RA 2JLQA 1BYUA 2A9PA 4KTTE 3VJKA 3VZBA 1PNRA 3GRKA 4F97A 4NLLA 1D3AA 3R1IA 3HVKA 3K57A 1J8MF 3WOVA 4PNHA 1RBZA 1LLFA 1V6AA 1L9XA 1JT2A 1HRKA 3LX4A 2UZHA 2C7BA 3AX6A 1EINA 1GFZA 2IU4A 4PDMA 4CLDA 1M75A 3M89A 3AXTA 2XAUA 4DTIA 2W8ZA 2J4CA 1Q3KA 1Z12A 3PFBA 3IS3A 5AICA 2EGGA 5KKAA 1RYBA 3SD7A 3UB2A 1Y3DE 4LFAB 4FC7A 4D0SA 1SKBA 1Z6AA 2CYAA 1NZJA 4AXXA 1NOKA 4PHCA 3D31A 3SBEA 3W5IA 3GEHA 4L1KA 3KWLA 3VBCA 1TU4A 4DQUA 4KQXA 1F60A 1MMFB 4LEIA 4EA6A 1JAZA 1EK0A 1WS6A 2ZBEA 3CS5A 1NRIA 2NXNA 4F9GA 4ZCMA 1B3BA 1ISHA 1SUAA 3G5UA 4MS1B 5F9MA 3K70C 1ECGA 5JSKA 4OBEA 4GRIA 1YJCA 1NT4A 3ESJA 3GLKA 3IQIX 3IV9A 4DBLE 5IABA 1H2KA 1IBLO 2OUIA 5EJIA 1J8FA 2VQ6A 3ZY6A 4BKQA 4I9GA 4DHWA 2D1SA 4K6GA 4PYJA 1VI2A 1VMEA 5J43A 4PLFA 4EO4A 4MRMA 1D2EA 2ZT6A 5DGXA 1SBTA 1UP4A 1VRWA 2JGFA 3HCFA 4C9BA 1JG2A 1NN0A 2WKSA 4X20B 3BE6A 3DTTA 3DV9A 2YHUA 3HCDA 3TJZA 4FSDA 1E2IA 1S76D 2QI9C 3UANA 4ZOBA 4A2CA 1UP6A 4D81A 1ZAKA 3K9FC 5FWXB 1CDOA 2CVHA 2F43G 5L3QB 1K3TA 1IC6A 5LKAA 5DGDA 1ISSA 1QHTA 1E7WA 3C2QA 3G2QA 1FJGO 4AP6A 2HP8A 1NVKA 4WLOA 2YIMA 1W25A 2II6A 2JFQA 4QTTB 3H1AA 2W2LA 4BWGA 2DWOA 1IHPA 1Z6TA 1X1QA 2G8NA 1ULTA 4DBZA 3MOSA 1ISRA 2AYYA 3SF0A 1VL5A 2X41A 4BGIA 4BT2A 3VAZA 2HP0A 2WPDG 2YOHA 1CS0B 3CCJV 4LPSA 4OM7A 1BMTA 1AG9A 5LGTA 2IJKA 4N21A 4X1KB 2PX8A 2HHLA 1MA0A 1EHIA 3A9UA 4B7UA 1E9SA 1GTL1 3PFNA 2LFRA 5IJWA 1IPEA 2EIHA 4LSWA 3RCBA 2YFQA 3EXFB 3L43A 1T5IA 1V7PC 4LSGA 1X59A 1AV7A 3DZHA 3RYFB 5IYDO 1DIHA 2ZUUA 4ABTA 4MV5A 4O2AB 1X9HA 4UVDA 1PNMA 5A2QM 4M89A 3TFWA 3U3KA 3V8VA 4P0QB 2I0FA 2Z3YA 2ZRIA 4DLBA 1LX6A 2AX3A 4OHWA 4YMGA 3I5XA 3HDTA 2PVCA 3UH1A 3RI3A 2IYOA 1FRVA 1CFJA 1IAVA 1RIIA 2AXQA 4BT4A 3JPWA 3D01A 1II9A 1R88A 4ZIBA 3QEOA 1QCYA 3S2IA 1YF3A 5GINC 5J4VA 4TGLA 5FWDA 3HM2A 2C2ZA 4PO8A 4G28B 1YZLA 1LQ2A 1J97A 5ALPA 3N8NA 4FZ0A 3OD5A 4FFSA 1NZ6A 4DV5B 3OT7A 4YCCA 3K14A 1A9RA 2QXYA 4LFCB 4BW5A 3E9DA 2NUAB 5B2FA 3EH2A 1ZDMA 1H65A 1CEYA 2C5HA 1EFVB 2IOFK 3ZY4A 1KDVA 4YRFA 4E22A 2N75A 2RHHA 2J6CA 5EJFA 2OLKA 4ZHQF 3CP1A 4WCFC 4FU0A 3I5AA 2H1WA 3EVBA 2HLPA 3ENKA 3FIJA 3S0WA 3IRVA 3DEZA 4CIXA 5LQRA 3HNPA 3LGAA 1LI7A 3I2HA 1F8XA 1ZEJA 3IAM1 4N4AA 1W94A 4QT4A 3G13A 3SS7X 4EW2A 1NASA 4TL8A 4L28A 4Q12A 5IAEA 5BO5A 1RNLA 3QXGA 2HA3A 1NBEA 2OOKA 2A4MA 2P69A 2X4DA 4LHZA 1Y9ZA 4CQNA 1RQ2A 3NC1C 4OU4A 3ABKB 5DX8A 4JQYA 3VHQA 3UENA 3BMNA 3MQ4A 4F11A 3DP7A 5JXHA 1JWLA 1U3DA 3VMMA 4BR6A 2RJZA 3OMNB 2QSYA 2GJ8A 2WWIA 3B8HA 4OJQA 5ED4A 5ICSA 4GF5A 1BHO1 4G63A 1I3MA 3BGWA 4DR2O 1CR4A 1ZSYA 4H2DA 1Y37A 2YW2A 5DOZA 1RKQA 4MRNA 2DYSB 1VGVA 4LGVA 3PJSK 3PHIA 2PQ6A 3PRJA 3H6HA 3ZBQA 2UYPA 4YAGA 4J3FA 5EQDA 3EIXA 1S96A 3B89A 1H93A 5JWHA 3TQHA 2L0XA 4BIIA 4C05A 4HLCA 5E7JA 1MXFA 1TMKA 1MC1A 5IY5B 4PAMA 5A4FS 1G2PA 1NA5A 1OAAA 4N65A 3C3WA 2O0LA 4NARA 4JGIA 3LCVB 5FWNA 1GADO 3BA1A 3AVPA 4TM7A 2VTKA 3DE7X 4R6ZA 4G0NA 4DCSA 2H48A 5EIBD 2IYPA 3KTFA 3IAS6 2IDZA 2BELA 1N92A 1KYWA 3N58A 2ZLBA 4Q18A 4ZQCB 4NNPA 3GLGA 3I53A 2JLXA 5MFZA 1YITF 1KAMA 3FLBA 1QZTA 3GP3A 4NE2A 4AN0A 4CN8A 2X76A 3CPQA 5SYAA 4ZVPA 1E9CA 2XCLA 4O3MA 3FWZA 4TUYA 1BGXT 3HMQA 4QBGB 4CKEA 3PFFA 5E1OA 2TSYB 1FSZA 1G1AA 5CBFA 2J9GA 3P2YA 1X92A 3D1VA 3E9EA 1WULS 1EK1A 4EMTA 2ECQA 2GLUA 2OMEA 4W8OA 3BWCA 1M0SA 5D5PA 1QRTA 7MDHA 5BNIA 1J7KA 4NCIA 2HVKC 2PV7A 4MW2A 4YMSA 1OZAA 3AK3A 5MN6A 1HFEL 2FPKA 4M76B 5DW3A 3U80A 1EUZA 1JEOA 1PL7A 2AN1A 2CLSA 2DTXA 3NTOA 1JDBB 5F1OA 3MLAA 1WCWA 3ETEA 3BC1A 2HU2A 4MPDA 2EU8A 4UOZA 2O07A 4NS4A 1BKDR 1MW9X 4RE6A 1LD3A 2EWVA 2V7GA 2PDAA 4UEQA 3OZXA 3MA0A 4UAVA 3P2IA 1X7OA 4ID3A 4QUGA 5K3DA 3RANA 5IJ0A 3AGQA 2EGHA 3TW6A 4TT8A 5C0OE 1FY2A 4MMZB 1EM6A 2PXXA 1NVFA 1YDMA 3EUAA 5F76A 3ZU3A 1C1YA 3I61A 1P9OA 1QFJA 2BFNA 4G0OA 5EHNA 4QBKA 1XI1A 4DQLA 4AY4A 1M1KW 2LZ0A 2RHRA 1TZJA 2ZAGA 3GPCA 3L7DA 2CE2X 1EPUA 4BTLA 3ZDDA 2Z8YA 1HNWO 1LRKA 2Z01A 2HNBA 4XWGA 2J31A 5FWYB 1XILA 4QODA 2PA3A 4AS1A 1NDHA 2ODQA 3DZBA 4L72A 1SQPH 1NNLA 1G6Q1 3GEEA 1E66A 2A5GA 3GL9A 2XGMA 3GVHA 4GWLA 4KXYA 4IGAA 1C30A 1CY6A 1X2EA 1ZJJA 2PVSA 4W5OA 1W49A 2C4UA 3DM9B 2QIOA 3TXSA 4FKZA 4F2PA 4ZK6A 4AD8A 5TIIA 2PAAA 3FNRA 3KPVA 4U1RA 1RPAA 5BUQA 1GDDA 2GRJA 4FCVA 4GBGA 1XMSA 4TXJA 3LFOA 4UCVA 2ZSKA 3HZHA 1E6UA 2Z5FA 3G9TA 4A8HA 4E31A 1F5SA 4ICIA 4DMHA 1V7ZA 2HCFA 3K8YA 3KBOA 3LRXA 4JI7O 4GVPA 2B35A 3O4GA 5EXEA 2QR4A 2XTNA 3LDDA 5FYQA 3V9AA 2WEKA 3TEFA 4BUZA 5JSUA 1TEZA 3JWPA 1YCDA 4Q03A 3FOEC 4Q16A 3ML0A 3QM1A 1SQFA 5BMVA 2Y8EA 5BW5A 3RJTA 2BHSA 1ORVA 1U0JA 2I3BA 3T5MA 1XYVA 1Z0KA 3M6UA 4BQIA 4B3BA 3ZWWA 1XHXA 2FCAA 3JWIA 4KW7A 4M6WB 1YI2V 2ZJ8A 4HG2A 1VCOA 3EGEA 2JL1A 2AEEA 3BEDA 2W8BB 4A4DA 2Z4SA 4A6PA 1ZNYA 1W1IA 4MUXA 4MMYB 1DB3A 2QWNB 4NH4A 1I5OA 2W98A 2A4KA 3KXDA 4NTXA 1V55C 2VXOA 3DE5X 3B40A 3K16A 5DM60 5CG2A 1X7XB 5FXMA 5T4FA 4DA9A 5JQWA 1IMOA 3Q1KA 3BD7A 1GPWB 2A9OA 4GEGA 2JVJA 2XNDD 2P62A 3C3KA 5BN3A 5KC9A 3LF1A 3CCBA 4N0EA 4GDMA 4JCOA 4P3KA 4AMBA 1J0CA 4BHTA 3CU5A 1JPXA 1KHTA 1X38A 3EQ7A 4BT3A 1TJ5A 2UUCO 1NW5A 3H5AA 4Q7JB 4X1YA 4R41A 2PJRA 1XRSB 5FFFA 2ILTA 1LTKA 2IHVA 3SMVA 3T4EA 5EWMA 3N3BC 4EGSA 2XDYA 1UQRA 3F7TA 1I0HA 3SLGA 3VMFA 4RQTA 4WDRA 1SXIA 3KUDA 2WWYA 3HCCA 3EA4A 4HY3A 4REMA 2XKAA 1MQ8B 3EMBA 3GJ8A 3CC7F 2ZTHA 3M4NA 4OREX 4C2UA 3QVLA 4FX2A 3FTFA 3A58B 4JYPA 3Q4HA 2PSFA 3FPIA 1XMQO 1VYVA 3NRJA 4PM4A 1SXJE 4HJRA 1IZ3A 2FSGA 4UTVA 1A32A 2BEUA 1XQYA 3GARA 1HZJA 3OZUA 1AN0A 2XT6A 4PTLA 3WRXA 1TM2A 3TL6A 1Q7CA 3K6SA 1LDNA 1YR9A 3GJYA 5TPZD 4RAQA 5TPWB 3OR6C 2BEUB 3A37A 4E5SA 3GN1A 3E2IA 1T2UA 4PHZA 4D7TA 2NZXA 2NZ8A 3SKYA 1KECA 3C7KA 4V1CB 2BKAA 4IIDA 4ASUD 2XXAB 3M6MD 4R50A 3L0PA 2ZGVA 3U3ZA 5JY1A 1LW7A 2PO5A 3OUFA 1G4UR 1X1RA 1URFA 2CHVA 1XDWA 2E7ZA 3VPGA 3VSBA 2QBYB 3SIPA 5H83A 2FB9A 3QO7A 3M8KA 2DPMA 4OHOA 1FNMA 2GJAA 1CJTC 1V4BA 4WBXC 4J10A 1U2ZA 1JL3A 4PIMA 1EP9A 1HT0A 3D54A 2R6GA 3ND5A 5T57A 3FUWA 4RBNA 1FMFA 4ZAGA 4BO8A 1A9SA 1RABA 3N28A 2KMLA 2X0LA 2Y1EA 1ZJ4A 3GCGA 3HFRA 3KIPA 4OQYA 4B3MO 4HGRA 1TQ2A 2BMFA 2DBYA 4FCCA 4MUKA 5HXAA 4IP0A 1WHTA 4UB6Z 1EFAA 3ICWA 1MVNA 1W88B 6GPBA 3C43A 1R3UA 1V4VA 2YOGA 4EJ6A 1N7HA 2YIBA 1M8JA 1CRPA 1L4NA 2FLWA 3ASNC 1W88A 4OAQA 3BIWA 4N40A 4YV1A 5JECA 5E7QA 3LNCA 4RTPA 3WP0A 1Y63A 5AW8A 1B7GO 4HB4A 4LY0A 1T25A 2NO6A 2DGDA 3R5TA 2FP4B 4YROA 2X6TA 3CNHA 5AKLA 5HOEA 3U4QA 3KSAC 1KOLA 5PGMA 4RZ3A 5K0EA 5CEJA 3A4IA 4B35A 3UM7A 3NTRA 2ZJ6A 2ZVQX 1VKOA 4UBJA 2OM6A 4YJFA 5SZJA 3A4NA 4EECA 1ODLA 5C18A 3W78A 4NZ9A 4MKFA 3WMRA 4XYLA 2WTAA 1PTKA 1GZ7A 4JL6A 4MS4A 1S8NA 1M90W 2XE7A 3E8FA 4NECA 2ZWOA 1HDOA 2OT3B 2PRKA 3KB2A 4C29A 3DJFA 4Q3AA 1IHOA 1IJFA 1E4EB 1V3TA 1PFKA 3D7NA 2FN3A 3WI7A 2P1DA 1CE8A 3O8QA 1Z4QA 5HFJA 4GEKA 2G28A 5SYNA 4ASUA 2IX9A 2E82A 5EKTA 2ZR3A 3K8QA 3OQIA 5CH5A 1Y6XA 1I2CA 3C3DA 4B09A 1P2GA 1FBNA 3BWVA 5J1TB 1CQPA 2IY8A 3BXHA 3PXXA 2YZKA 3C7AA 4FFMA 2BTQA 2BZSA 4P1ZA 4YONB 3VTZA 3OA0A 3AR4A 4JUCA 2OWOA 3AOEC 3V7FA 1PVOA 1NQAO 1U2EA 2EFGA 2NPIA 1Q15A 4DDKA 4AJ1A 4EG7A 2W6CX 1P1KA 4MR9A 5FPHA 1CR2A 4I55F 1L3IA 1F20A 1PVDA 3D3WB 4KRFA 4JI6O 3LMKA 1K6JA 2O4UX 1QHNA