4ZI7B

Crystal structure of tubulin-stathmin-ttl-hti286 complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
430
structure length
430
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 168
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zi7B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zi7B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zi7B01
3WGNA 3UT5B 5JVDB 2VAMA 4FFBA 3RB8A 1RQ7A 3VO9A 5LP6B 5LYJA 5IYZB 4TV8B 4KWEA 4O4JB 5KX5B 1OFUA 3VPAA 3VOBA 1W5AA 3C8LA 3N2GA 5J2TB 3HKCB 4O4LA 3JAWA 4LNUB 4O2AB 1SA0B 1TVKA 3WGKA 4EB6A 1TUBB 3ZIDA 5JCOA 5JQGA 3HKEB 5EIBD 4ZI7A 3JATA 4U39A 4O4HA 5J2UB 4F6RB 4ZHQB 3VO8A 5JCOC 3RYCA 2XKAA 3RYFB 4WBNA 5LYJB 4O2BA 2RHHA 5CB4A 5ITZB 2XKBA 3E22B 5MN6A 3CB2A 2BTQA 4X1IB 4IHJA 2RHLA 4X1YA 3N2KB 3N2GB 3RYHA 5IJ0A 5JH7B 4I50B 5IJ9B 5LOVA 3JASA 2RHJA 5BMVA 3JAKB 5CA1A 1Z5WA 3R4VA 4TUYB 4I55B 4B45A 4U3JA 4TV9B 5GONA 4EB6B 3JALA 4YJ2A 5FNVA 3RYIB 5JQGB 3HKBA 4HNAB 5EYPA 4I4TB 5LA6A 1FFXA 3HKDA 4O4HB 4O4IB 4DRXB 1W5EA 4YJ3B 3JARB 4EI8A 5EZYA 3RYCB 5C8YB 4X1KA 4ZOLA 4O2BB 5M7EA 2BTOA 5CA0A 1W59A 4FFBB 5KMGA 5IJ0B 4EI7A 4IIJA 4EI9A 4M8IA 5CA1B 5LXTA 1W5FA 4X20A 3UT5A 5JVDA 3ZBPA 2Q1YA 3JALB 5FNVB 5MN5A 5LP6A 4O4LB 4TV8A 5IYZA 2VAWA 3JAWB 4O4JA 5KX5A 3M8KA 3WGMA 1TVKB 5LP6C 2RHOA 3M89A 4X1KB 2R6R1 1JFFA 4ZI7B 5J2TA 3HKCA 3JATB 4LNUA 4O2AA 1SA0A 4XCQA 2VAPA 1RLUA 1TUBA 1W581 5KMGB 4WBNB 2Q1XA 5CB4B 5LXTB 4F6RA 2BTQB 4X20B 4ZHQA 4IHJB 4B46A 4X1YB 3RYHB 3RYFA 5LOVB 5ITZA 3JASB 1RQ2A 5BMVB 3E22A 3VOAA 2R751 4U3JB 4YJ2B 5GONB 4X1IA 3HKBB 3N2KA 1JFFB 5EYPB 5LA6B 5JH7A 1FFXB 3HKDB 4I50A 5IJ9A 3JAKA 3ZBQA 5EZYB 4TUYA 4I55A 4TV9A 4ZOLB 3RYIA 4HNAA 2VXYA 4I4TA 4O4IA 1W5BA 4DRXA 5CA0B 3WGJA 5MN4A 4YJ3A 3JARA 1Z5VA 5C8YA 2GVIA 4DXDA 4E6EA 3V3TA 3HKEA 4IIJB 3WGLA 5EIBC 1FSZA 5J2UA
chains in the Genus database with same CATH superfamily
3TGLA 1M93A 4FFBA 1QDUA 3MWEA 5C1OA 3VAYA 1T0JB 1ISSA 3V1NA 2OHIA 1MAHA 3PA6A 3DHVA 2VQ3A 4XQGA 3WBFA 1QGUB 3QMMA 5AG2A 5IUKC 2L17A 1R74A 3CINA 1ZK3A 1YQDA 3DE5X 1U98A 4FKMA 1K06A 3ZS9A 5E79Z 1QOQB 1CPYA 1IJBA 5A9SA 3OD5A 3NWJA 1W2HA 4TT3D 5C8XA 2G1KA 3W2IA 1C8BA 1QGYA 5BOVA 5IE9A 4Z54A 1HM5A 2F23A 2RMKA 5KJEA 1DV1A 4OHUA 2XCOA 1A5TA 4MW7A 2X0NA 5DO9A 3ZYCA 4D8TA 4Q12A 1KVUA 5DIZA 2JI9A 5ILQA 3UAYA 1BGYH 3NYQA 4FNMA 4B0OA 3L71H 3RNOA 1EX6A 3K9WA 2R68A 4EAAA 4Y0NA 4AY5A 4MW9A 3HB4X 3DTNA 4K26A 1SDSA 2K2WA 4LFBO 1DLIA 2R8PA 3M81A 5CT4A 4R2WA 1O96A 2WJHA 1QMPA 4Y67A 4ZAYA 2YZ7A 4WRRA 4G84A 4AY6A 2I91A 3C3BA 1B7GO 5BPHA 3OZGA 1Z35A 5DB4A 3QO8A 3WA7A 3K2EA 3KKYA 1YQGA 1FNKA 1M2NA 3FB1A 5CR9A 5CNIA 3AGKA 1U2DA 2YHUA 2QQFA 1UZLA 4I1OA 2B4TO 5BSUA 2HQSA 3NBYC 3H5OA 1FA9A 2E4YA 3N53A 1JZQA 4X0EA 1P9RA 3JCUZ 1GKIA 2R3SA 1URPA 3K6JA 3OR7C 3AFNA 3DYVA 2UYGA 2YVQA 2CNOA 3HB1A 3LSYA 2QRKA 1IDSA 4MRMA 4QFCA 1VIBA 5A6SB 4MIKA 2CVFA 4BP9A 1TU0A 3NGXA 2Y1WA 1OX4A 3VIUA 1K4KA 4D92A 3KSBC 3LK7A 4CM7A 1U6JA 2JK0A 2B35A 3I8OA 4RY2A 3GFBA 3JWHA 2IT1A 3HXQA 2HJDA 2GEVA 2CCGA 2OTCA 3FOCA 4YP5A 1YZUA 5DGDA 4C5BA 1AQJA 4KO8A 4UNNA 4ZJUA 1T0KB 4PSKA 2FFQA 3CPWF 2JJ1G 3CXCF 5BUCA 3G0DA 3IGAC 3NDRA 3BCSA 1L8OA 2VQSA 4AJPA 1AQLA 2Y4NA 5LYYA 2PWPA 2XNDD 1NONA 4EHLA 5K0FA 4PZLA 1ADGA 2CMKA 2FPKA 4TQAA 1L5ZA 5E6UA 4U7HA 1O6CA 2ZINA 2KBFA 5FWXB 2XGOA 1GVNB 1XRRA 3TW8A 2VJKA 1M10A 1EI9A 4M0UA 2HHHO 5EC1C 4DZZA 1T9AA 2OXTA 3DAGA 2AFHE 1Z0JA 4C43A 5JFGA 1TA0A 1EP3B 4BIIA 1VC2A 3BJZA 3QE9Y 1PLLA 4N54A 1SWWA 5FL3A 3AX6A 1VYVA 1QZZA 2F7SA 4L3WA 1JYSA 3JQGA 1X7OA 1YJNV 4HAIA 4FK5C 4E32A 2IODA 4KXUA 2VYVD 1JA0A 2JKVA 4X1KA 1Q86W 1UPFA 4AZWA 2ZXFA 2YL2A 4RFSA 4AURA 1VXOA 1B6RA 4L07A 2UXNA 3PC2A 1PN3A 4LF4B 2OTMA 1XPOA 4Q3AA 3WB2A 2EVWX 4A03A 1C7EA 3NV9A 1FQWA 4AG6A 1L7MA 3RWBA 4XWYA 3BL8A 2A5FA 5IVKA 1E1DA 3P20A 4OP1A 3MGKA 1UP7A 3TJMA 4DV0O 2ZNJA 1P1HA 3CCMF 4UMVA 4DL9A 1TI7A 4EYGA 4M2LA 2ISQA 2RHRA 3DEKA 3PEEA 5E95A 4GP9A 2VZ9A 4N5NA 4BVKA 3I6YA 2QU7A 3AHJA 4OUDA 2NP7A 1UJBA 5I9TA 5TXGA 1QG6A 1XZGA 3LLCA 4PRLA 3S2IA 2I8CA 4AZSA 3TRDA 4HB3A 1XQ8A 1ZIXA 5KNDA 3R77A 1D6MA 1KEPA 3HBAA 3LP5A 4U2GA 3FA2A 1MENA 1NQXA 3RRYA 2HLDG 4WY2A 3SQXA 3EVTA 4MR8B 1TYZA 3LC1O 3RC2A 4HJXA 4ER7A 4RPIA 3BL5A 1KJZA 3U3KA 1WXEA 6CHYA 3R0ZA 4TKUB 2QI2A 3EA0A 2PAFA 3FNBA 1G3IA 4Z4CA 3KOUA 3GMDA 1CY6A 3DGFC 5BQ3A 3NR7A 1V2HE 2P6PA 3U26A 1SUBA 1BSVA 4B47A 3BREA 2BLLA 2CL6X 3LCJA 2PGDA 3O1LA 1DJQA 3N7AA 1DQZA 4LDJA 1J6UA 3LM8A 4C0HA 2VWPA 5JJEB 3FOWA 1LUWA 2Z8YM 3FVVA 2XEXA 1CQZA 1KF0A 1ACJA 1QD9A 4K3AA 3TTUA 2IZOA 1ACMA 1U9JA 3BAAA 3OTGA 1HF3A 1TXGA 4Y9UA 4M7RA 3DBOB 3FOBA 4UARA 2EFHB 1VL5A 3TZEA 3JZIA 3HU5A 1SAYA 3I2HA 4F3KA 3WWYA 1T3ZA 3UKJA 1WSBA 3L1IA 1T6BY 3KFLA 4ZO9A 1TFRA 3EFEA 3AYZB 3SSAA 4QVKA 3OA0A 2FC3A 3P8ZA 5EG5A 3RS4A 4JC5A 5KKAA 3ZVNA 2LCIA 1SETA 2ECPA 1IZYA 3O75A 2DFPA 2WOJA 4A73A 1E2DA 1WCWA 1MFPA 1W57A 1RHQA 4TSFA 1Z5UA 2F1OA 4HN9A 5EIEA 3AG5A 2WR8A 4TKLA 1WOMA 2YHIA 5FUBA 2A9RA 1PVVA 3FVRA 1U3PA 2ZE5A 1QGOA 4ML3A 1N0IA 3MGGA 4QQKA 5CFQA 3HWRA 2BMEA 3HCBA 2LW1A 1VSTA 4I0WB 2EXXA 5U9CA 4UBNA 4B08A 4MITA 5EJMA 2F55A 2B34A 2P9QA 4QT0A 4YAWA 2ORWA 2P6YA 1DCFA 5DHQA 3AZPA 2I1VB 4F2DA 4QU8A 2FPWA 4K9NA 1FDWA 3O1HB 3A6FA 4TKZA 4NYMR 3FDJA 2RIPA 2X41A 3OHSX 2KPOA 2JZOA 4PHHA 3FWPA 4JR0A 3GGPA 5J5CA 3M9XA 5FXMA 3ANXA 1XYVA 5B7GA 2R84A 1NQUA 5FUMA 3AJRA 2XA9A 3KJZA 1JHVA 2D1QA 3L7KA 1QOPB 5DLQC 2HBYA 1I5RA 1U96A 3TWOA 2QIOA 3CJHA 4RHTA 4JF3A 5DK6A 1XREA 3MS2A 4EVSA 2IH1C 3C70A 3OICA 4B81A 3G9UA 3RTAA 3NJ4A 3ANMA 1GNRA 1VE9A 5ULLA 3AV3A 3CVUA 1S3JA 4DV2O 4OXXA 2NTNA 2FYTA 3VR3D 1KO5A 2AZTA 3DOFA 2AZ2A 1Z15A 2ZJ6A 2A86A 5EUMA 2IXDA 4FSHA 2GHRA 2GZ1A 4WN9B 1PT5A 1XXHE 5HZKA 5J40A 1Q1AA 2YCLA 4WZBE 1RI4A 3A3KA 4EOGA 1THMA 4YUVA 1GKFA 3QKSB 2W2KB 2A35A 3A70A 3WICA 3KEOA 1SXQA 3C8UA 1S8NA 2R4UA 5K3FA 1XUQA 1A4RA 3GZ4A 4I50A 2PJDA 2ZD9A 3VKFA 3AHEA 1I3LA 5A2QM 2YXBA 4ZGGA 4TQ9A 3L6UA 2OTJV 2HF8A 3WPXA 1JFRA 1LA2A 4LXUA 1QG2A 3K35A 5KYUB 3DE4X 1MRZA 4QFMA 3WG9A 1PNRA 4ZHQB 2HREA 2GUZA 4XDKA 2PH3A 3TQTA 2XDQA 3ELBA 1ZEMA 4FLZA 1JLKA 2ITDC 1I6WA 3VPFA 4XWGA 4G5SA 4RQOA 4U2BA 2F3SA 1J97A 1KMHB 2FF5A 2NO1A 4ZOLA 3A28A 1Z0UA 1GGNA 2WSYB 2N47A 4DLXA 1U4OA 1L6IA 2YN4A 4NI5A 3IPCA 4ZI5A 3RFFA 1U04A 2V5AA 2G76A 4RF2A 1JDNA 2IXTA 5ICFA 1NPYA 2EJBA 3IEUA 5YASA 5B7NA 2PT9A 4J0HA 2Q69A 4J0QA 3BQMB 1ULAA 1PR4A 1UC8A 4F45A 3B3JA 2IY9A 1TZJA 4KYTA 2PVSA 4L7QA 1Q81W 2PO7A 4JLNA 3BWCA 1V41E 5E2BA 4FYXA 2WZCA 5C4GB 3RCBA 5IT0A 4V1CB 1TW3A 2BFDB 2XSZA 4D6PA 1CFJA 3I0NA 1FFCA 1E59A 4QUDA 4CMBA 1XTJA 4QBKA 2R1TB 3FVQA 3WRXA 1XN4A 3NHWA 3QUTA 3GX1A 3VISA 1DNPA 3W3AD 4QGSA 2BHNA 4A6DA 3SGLA 3G71F 2A3NA 3N0XA 5IANA 2QX9A 1TAHA 4BFTA 4D81A 1L4YA 2RBKA 4GOND 3LX4A 4WWHA 3SDSA 2Z9BA 1DT3A 4J7JA 2EJWA 1ZL8A 3K3WA 2ZT7A 3WK9A 1W36B 1JQAA 2P9BA 5HJ2A 4CKEB 3SN6A 3EIFA 3R5KA 3IVXA 1Q6IA 4ARBA 1W96A 3I6IA 4NU5A 3LRPA 1AGRA 1M4UA 3QYPA 4ALNA 4CIBA 3V4FA 1PR2A 1EEXB 3LUFA 1C0PA 5J4VA 4CWAA 1JECA 4YONB 4MLCA 1X9GA 2V0GA 1SA0B 2QE7D 3TRJA 1Q0LA 3D8NA 4YAGA 1DF4A 3FB7C 1R0KA 3LY7A 3WIBA 4MGIR 5AXAA 1NLZA 1JDSA 1LB1B 3THWA 1VE3A 2VRBA 2HGZA 3K9FC 2AX3A 1XEXB 4HFNA 2Z1NA 2NQTA 3V4SA 4MV6A 1HW7A 4B2LA 1D03A 3HJHA 3S1SA 3H9GA 2P40A 3BD6A 2QN7A 4J6EA 1P1RA 2VI5A 3Q3GE 5JDIA 1VKNA 1V16B 4CEJA 4JB8A 4RMGA 3OBWA 1NBMD 5L3RA 3KQTA 3LF2A 3QP9A 4GYWA 2AKYA 4IIJF 4NENA 3NU1A 1ADYA 3AT1A 2BEWB 3EBOA 5HXAA 2QGFA 3TFWA 4JT2A 3ER6A 4FN4A 4KB5A 1GL3A 3CM0A 1EGVB 3ACBA 5IY5B 1KY3A 4DXWA 2R6GA 4CF7A 5KJCA 4OM8A 3WR5A 1T2FA 3ZUPA 4RAOA 5L3FA 2C5FA 4YCNA 3WGUA 1GADO 4PGGA 5CT9A 2M6RA 2OPHA 3HN2A 2IYQA 3TL6A 2NG1A 3HG7A 2GPJA 3UA4A 1L4NA 2A9PA 4TL7A 4E7OA 4C7OB 1HBJA 2VJAA 3PLRA 2FN7A 4C0BA 1YZYA 1T8SA 3ZMSA 1Q12A 2VWQA 5CDGA 1LLFA 3ND7A 1TLFA 3AVXA 4PC6A 3RQSA 1P7PA 3G0OA 5TQVA 1MAUA 3R6GA 3OEYA 1RWBA 4DK0A 4UM8B 3ZU3A 4PFSA 3H9JA 1H05A 4NE9A 2G6TA 4CMIB 1B8PA 5IYCO 4DR5O 3PQ2A 1WHSB 2VF8A 1KO4A 5B6IA 4OUKX 2ZP1A 5B7QA 1SUDA 3FYTA 1RD4A 4NKGB 1Y89A 1SRRA 4D2IA 3H1IH 2N48A 2KE5A 2OD7A 1BJTA 2PWYA 4D97A 2XZPA 2AC2A 4BHTA 3HE3A 2BE9A 3BHPA 3R09A 1IHUA 2Z4SA 721PA 4DR7O 4G9BA 4R01A 3U4GA 1OMOA 5BXQC 1PV4A 4TV8F 4ZRDA 1J0AA 2AJ8A 4FLMA 4MS3A 3GLTA 1TZKA 3AL2A 4UE6A 1H0HA 2PX8A 5I9SA 2FZKA 1L4BA 3A7DA 1FD9A 4X89A 4QBHA 3OX2A 4NH4A 4JFRA 4M1YA 3KT6A 3LZ6A 1MQAA 4QAJA 3CMMA 1V8OA 4C20A 1NURA 5HQJA 5I9NA 2IK8A 3SFVA 3PRHA 2YV1A 4TXJA 4FHGA 3E1GA 3AWDA 3D36A 2R9RB 1E1YA 2CDYA 3PXXA 1QVFF 1R4ZA 4LS3A 2JGKA 3IE0A 1TAUA 3DKKA 5CAEA 4HF7A 4RD2A 5EE9A 2GAAA 5FOTA 1NQTA 4JVOA 3CC4F 1XCJA 3G6EV 2R62A 5EINA 1ISGA 4NYJQ 2PZMA 1HYGA 2C95A 3ONVA 5KHOC 4E5DA 1LJUA 3HR0A 4H7DA 1CVRA 1O58A 3UVEA 5I7AA 1G1XB 4DMRA 5FTLA 1C3LA 5AHOA 1EZZA 3KE8A 2ZULA 3HJAA 5EIXA 3CX7A 3FYHA 4L2IB 1H3EA 3UGQA 2GZRA 2KLHA 3D54D 1G2QA 3C3YA 4L15A 2NSLA 2JJ2G 4R4JA 2Q7OE 1OCCB 2YUAA 1X1DA 2XAQA 2KS6A 2CUZA 3CT4A 2CMFA 4DM4A 1PK7A 2CFTA 3H4TA 1YO6A 3B9BA 3BMCA 4H6XA 5DKFA 2CWDA 5THKA 4FZ3A 1YBHA 2ZI6A 1PZHA 4TUYA 3OZVA 3KLNA 1MH9A 1CT9A 1RXIA 1NKVA 2DXIA 3RH0A 1TF2A 5C53B 4DV5O 1DWQA 3LAWA 1PNLA 1IYZA 4BE9A 5TX7A 1JVMA 2G7ZA 2NXCA 3FF4A 5LWHA 4TVOA 2CLEB 2EIMB 1W2WB 3QLTA 3CZQA 1DQRA 1RXEA 1GA6A 2HHJA 2RH8A 3VMFB 4YROA 3GD5A 1M0TA 2RGXA 1IURA 3MRXA 1QQTA 4DRXB 1GITA 2J7PA 2BFMA 2JAHA 3T5TA 1SXJD 1QB7A 1JXQA 2OESA 4LRWA 1P7WA 4GC9A 2C7BA 1H6AA 1LUAA 3C7AA 5AT1A 2DE0X 4BRSA 2DUMA 1LLUA 1QONA 1ORQC 1EDBA 3RUAA 1FXKB 3ZV4A 3SJ7A 2QRHA 2W9XA 1XLTC 5EXEA 4EYOA 1UP6A 4DUGD 2ZREA 2ZJ5A 4HADA 2V3VA 3VR0A 4PWTA 3P4UA 3R6TA 4CBCA 1E7KA 3ABKC 1AR1B 1EVEA 1X1RA 1BXGB 4JBLA 5K3EA 2P2DA 4KQGA 2ZXUA 4Z49A 5KYYB 2VDQB 2XNJA 1KJYA 4X45A 4WNAB 1YWGO 4OPAA 1KYZA 3DXRA 3DSQA 2GAIA 3VR5H 4Y0VA 3THXB 3MWGA 1HTTA 3SE0A 5JAHA 3Q0IA 4CIWA 1C7IA 4E4YA 4DXAA 2GRUA 3DJYA 1T3SA 3GT0A 4LJ7A 1J7HA 2WQ7A 2BOVA 4HRYA 1LXCA 3EGXA 5ALFA 4KXQA 4Z8YA 5CA1B 3W04A 3CUEF 1GV0A 4KDCA 4N23A 1YBVA 3CZAA 3ZQKA 1XJQA 5FHQA 2OHHA 1SBTA 2R1VA 2D4AA 1EM1A 3LO5A 4G2NA 2ZUFA 5LQAA 4KREA 3ZHCA 4RKRA 4HB0A 2C84A 5LCXA 3JYLA 4IIHA 2ZIZA 5HKAA 2EWWA 3DLCA 3T7SA 2P41A 1MEJA 1MG1A 4OHYA 4DDTA 1TFUA 2H2IA 4US0R 3ZV7A 1Q7RA 4ZO6A 2B4QA 3K72B 4PQRA 1LVHA 2QD4A 3LY9A 3DYBA 1XNHA 3LLUA 3QQ5A 3WFZA 5E1DA 2IEAA 4NCHA 2QXYA 3AB7A 1E3LA 1U6KA 4L0QA 2ARHA 3SEZA 1GRRA 4Q1CA 1JWBB 5LQJA 3II6X 4EJ6A 2MSCB 2R66A 3KYIB 3ZWDA 4MZDA 4IOKA 3QWAA 3ESQA 2BMFA 4RVHA 1AKYA 1W5EA 2BSQA 1E79A 1VSBA 4ZP1A 4F9FA 2FQXA 4HD8A 3WWPA 1Y76B 5FOXA 5EIAA 6GPBA 3NFRA 5IKMA 4LF6B 4DB4A 1UDCA 4B4VA 5DNAA 2D2XA 1N1GA 3OPVA 5A5DA 1OAOA 1W49A 1GT91 1H0KA 3UXHA 1X13A 5ICMA 1NDUA 2PY5A 5IFKA 1T5DX 3DXZA 5ETJA 1V5IA 3P2JA 4ZEWA 2OWEA 1GM5A 1XTVA 4P3PA 1KR5A 2IPAB 1FXWA 3R65A 4YMGA 3N2GA 4KQXA 5KNBA 3IKEA 1D0VA 2H29A 5M5BA 1TNDA 4G5XA 4UVDA 2EX1A 5G4UC 3W9BA 5JOQA 3C6BA 2Y1XA 4II3A 4QGHA 1QX4A 1XHXA 3QELB 1TCUA 3ETNA 3DV0A 4IIYA 1N6NA 1L9KA 4ZDJA 1UEIA 4HDCA 1H2WA 5ABPA 3N8KA 5DYYA 1T9KA 3DWFA 1A69A 3OQIA 4LYFA 2W2MA 3B6IA 2XLBA 3AJ9A 2J3DA 3FDZA 3HO1A 2MWMA 4HVAA 4PONA 3AEUA 3ROTA 1TU3A 1W0JG 5IM4F 3D1VA 2OKCA 4BX8A 5KAFZ 2NPOA 5FWNA 4UVHA 3FUXA 3ZCXA 2X42A 3WP1B 4DR4B 4UHCA 1LGYA 2ODNA 4ZVOA 2B6HA 3ABMC 4M60A 2IUYA 3WXMA 1I1OA 4NQRA 4IOMA 1O97D 1W34A 3Q9LA 2X8WA 4ZT6A 4LF4O 5I6DA 4LSMA 4H0NA 2ZI3A 2AN4A 4CEIA 5JCJD 1URFA 4G2TA 1SVWA 2P6UA 1YZNA 4EEQA 3K1AA 4MR9B 4OB6A 1G18A 1ZGJA 1KRXA 1PJZA 2GN4A 5F1YA 3QEMA 1A1SA 1NVVR 5EE0A 4FWTA 2XTAA 4KR2A 1YVWA 2HP8A 4J49A 2NTEA 3FSRA 1AJQA 4OXKA 1YGPA 5JAIA 5AM5A 4PC1A 3BULA 3LYUA 2FPUA 1KJJA 3ZHRA 4YV0A 2VRZA 1ZLZA 2FUNB 1BGVA 5CFPA 2X5OA 4W9MC 2WFLB 1VQKF 4JOSA 1QIMA 5H3CA 4LQ4A 4JDUA 4RVCA 5BSKA 2LCQA 2D1FA 1DJNA 1K73W 1MOPA 5C1PA 2HJVA 5EQFA 2D59A 4TXHA 2FRDC 4G0YA 5DHTA 4B75A 2VWKA 4LCEA 1IPAA 3L73H 1UC4B 2AHRA 3CW9A 4DCSA 1N2ZA 5I4IA 1HNWB 1W4CA 4K8ZA 1C1DB 3PPIA 4HDNB 1N7GA 3K8ZA 4FFBB 1XZAA 3MWEB 2IEGA 4PBTA 2CMHA 1IM5A 3BDAA 5J4HA 2ZQZA 5BURA 3F5QA 1DBIA 5KVQA 1JJAA 3E20B 4ZZ3A 4QFBA 3KSMA 4WI1A 4YMWA 1HUQA 3ERCA 3EVBA 4HYTA 2P77A 1Y7IA 3G2PA 2AE2A 4ZCPA 1L5GB 5A9SB 4JSTA 5K6AC 4KEAA 4L28A 3N0VA 2YRXA 1EDDA 2RMKB 1V55C 4LJ8A 3KB8A 3AG1C 1PNTA 1PKXA 1IVYA 2B2XA 3FZNA 5CK4A 4RD1A 1NQOA 1W42A 3MMPA 4HAYA 4JXJA 2PLRA 1A5ZA 3W4KA 4BEVA 1RABA 3OMWA 2FSFA 3DKRA 5H2FZ 3M3HA 4O25A 4B45A 2YJNA 3AF3A 3B85A 4U7JA 3VR1A 4GNRA 4E2ZA 4QRIA 3FRJA 2XYQA 1U0JA 1CRPA 2AW9A 2DETA 1L3CA 4X20A 2A0YA 4A82A 1XEWX 5GADl 3I4CA 2E37A 1O96B 1VMIA 4FONA 1L7VC 3R9KA 3IPAA 1DEXA 1T3LA 8AT1A 5BY1A 3E2PA 1TJYA 3VH1A 4DGQA 4Y6OA 5H3HA 1M0SA 4GQAA 4KC0A 2WUGA 3MINA 2I1QA 3A10A 1VCNA 4BNTA 3C5WP 4CLRA 2BZGA 5AJHA 4WCFC 4BNDA 5L4LA 3IOCA 4OATA 1P4GA 3BQNB 4WFGA 1H2GA 3GAMA 3TUJC 1E1KA 1WKVA 1KMNA 2FFHA 1UFYA 3GYBA 1GA1A 3VR4A 1R0YA 4KPGA 1YRBA 2M6YA 2FW6A 1BAPA 1K2VN 2Y1LA 3VPXA 4B4UA 1NVTA 3G49A 3A0BZ 1M6VA 3OQNA 2Y1FA 4C7JA 4ENPA 2OB1A 1C3JA 4NG4A 4MRMB 3PT9A 1YDEA 2C2MA 3A1SA 2NADA 1R3UA 4KUHA 1DADA 4ZXFA 1OX4B 3TCKA 4HXYA 3H8VA 4LH7A 2Q0QA 2G06A 4JLMA 5ERXA 2VLIA 1ZH6A 3UK1A 1Q0PA 3MWDA 1IDOA 1S8AA 3TZHA 3ENQA 1IHOA 4DLWA 2YN0A 1O08A 1SESA 1UJCA 2FPMA 3HXOA 2IJHA 4L02A 3O93A 2WE8A 4LJYA 2I7DA 5G0UA 1OWNA 2YMQA 1AY0A 2HR1A 1YZGA 3E9QA 3H04A 3W3ZB 2DT8A 3PNPA 4HAVA 4GPTA 5JNUA 3PE6A 4BLRA 1AI5A 3A8TA 4JUDX 1FX1A 2ZPTX 2QYTA 4JBXA 1VHQA 1NJ1A 1J21A 2RI1A 1IBLB 2YS7A 2QA4F 2R0QC 1L7QA 5LUAA 5E6UB 3RG2A 4OXNA 1MQ8B 1EVIA 2AFIE 3L77A 3B8NA 4WKBA 3T0FA 5I5GA 3U3OA 4CL3A 5F21A 3PKIA 1IXKA 4BDSA 3TW8B 2IAFA 2C57A 4N48A 2VCHA 2CK3D 4D45A 3OCXA 4OJTA 1UKEA 4P3YA 2UVDA 1A27A 1GNSA 3IHWA 4RANA 3JQGB 4NV3A 1IV1A 1MW8X 2AOTA 1G8KA 2CTPA 4A5OA 5F5NA 3GNSA 1NVBA 3L1JA 1GZHB 4F2HA 4JUFA 2B8TA 3N4YA 4RFSB 5ERGB 2O5EA 1SCBA 3UPDA 1PL8A 1YT5A 3UXEA 4BL5A 3WNBA 1EDOA 1VQMV 3CZ5A 4GE0A 2FPLA 1NW9B 3NTUA 3EFFK 4MKXA 3BMOA 3CYFA 3TSAA 3EJ6A 2XZDA 4ZAXA 2EF0A 3TXSA 4J07A 3G2OA 4LX8A 1NMXA 4N82A 2D7DA 1KJNA 3KUDA 1N33B 3D31A 3W3AH 3GLUA 5M7EA 2ZRKA 1DAOA 4W6QA 2GHQA 3N3BC 3X1JA 1KZYC 2YFKA 1DFIA 4UQLA 3D6VA 3R7BA 4EPWA 3CV3A 3VXKA 1ECBA 1TT7A 4FGSA 2P2SA 4OUDB 2QZJA 3CJTA 1M2VB 3HJWC 2F90A 4OP3A 2QWNB 4P54A 5F23A 3RK4A 1M9NA 1X2EA 4HGNA 3WNDA 5JATA 1Z5VA 1JU3A 1XK7A 5BYKA 1R9MA 4UVIA 4R16A 1USVA 4WZAA 2VSYA 5HX7A 2XZOA 4BASA 2XKJE 2QNBA 4BWVA 1YB7A 4AXXA 4O2BA 5DHSA 1SOWA 1IPHA 5GMOA 2RFLA 1IL0A 4BKUA 4L51A 4YJ2A 4JUIA 3HSYA 1U6IA 5B30A 5ALDA 4QGFA 1NQVA 1XPUA 1GN9A 4LUCA 4PZCA 3LFTA 1S1MA 3BHJA 2VPQA 3TR6A 4R8LA 5UKDA 4WOCA 4ALLA 3NM6B 4JA2A 1SCQA 2ONJA 2Q45A 2XZLA 4KI7A 2F3RA 1N2EA 2WTAA 4YQZA 1JEJA 4POAA 1E63A 3GLQA 1LZKA 1S5LZ 3B2QA 4KQCA 3FPBA 1PYDA 1VG9B 4MV1A 2CWWA 4UHKA 2XA1A 4YPOA 4O63O 5FI3A 4IDQA 4EKNB 2PZFA 3TD3A 4B33A 1QO0A 2ZAUA 4F9GA 4S1NA 2VOEA 5DECA 1Z9BA 4FD3A 4X91A 2C59A 2CLHB 1T9CA 2L42A 2YI8A 5KCMA 1G8YA 4L4YA 4AKGA 2H63A 4XUEA 3LL4A 1T8YA 3F5MA 3DE7X 4S2EA 2BTQA 3A6LA 1MDFA 2WTXA 4CKWA 4HFRA 3QBEA 4FGKA 3O4GA 1H5QA 4C4XA 2JNWA 2VKTA 1MB2A 1BW9A 2YC2C 4HLUA 1CDDA 4QYXA 3CBQA 1E8DA 1C8LA 1WNFA 4YWHA 2HNBA 4RPHA 4G4WA 1RJGA 3KZNA 3TQOA 4DQKA 4C3OB 1K27A 2JVDA 3L7IA 1K8AW 4DS3A 2HHLA 2WAXA 2YHIB 4HWSA 5J9FA 4HDSA 4P2GA 3AY6A 3P96A 2RB4A 5JTTA 3VR6D 3GT4A 2F64A 4RABA 3MUNA 4BBPA 2H4FA 4XR9A 1CNEA 3KT0A 4K0RA 2AEJA 3JD0A 3RS9A 2I71A 1W55A 3SX0A 5FF9A 3RIYA 2O0LA 3K70D 5AK4A 1ZC4A 4D46A 2XMZA 1LTQA 4V0RA 3UHOA 4B4DA 1RM0A 3VDQA 4LDNA 5BXZA 5KLVH 4I3GA 2NYAA 1U0NA 3UMSA 2YWGA 2C20A 3OF3A 3RHFA 2ID7A 3OJ0A 1MB4A 1AZSC 2B9VA 2H2FA 1X3SA 1UOPA 2BUCA 4JI1B 3V7NA 3EASA 2WP0A 3H2SA 4KL8S 2XBMA 2C7QA 5FPTA 2A4MA 1NXPA 1FP7A 5L7YA 2XE7A 3G2NA 1R8YA 3CJHB 5HILA 1JFFA 4EG6A 1SZDA 3GWGA 4ND8A 5BQFA 2W42A 1BS2A 1MVLA 1RVDA 5KMGB 1KC1A 5B3LA 2JFVA 1VA4A 1FFHA 1RXYA 5IW8A 1EMDA 5DZSA 4FQ8A 1Q44A 4WKGA 1RPAA 4M1KA 4RZIA 3VTZA 1OAKA 2GYWA 4MVJF 2P65A 1EVQA 2QRLA 3BTVA 3GN1A 1EPUA 3SC4A 1G5RA 5LDGA 4PYKA 3QVWA 4FVTA 1X9HA 4DMFA 5K3FB 4E13A 2H9AA 3OM1A 4I50B 4P30A 4FJ2A 1ACLA 2JJYA 2CGOA 3H1EA 2J6BA 2QW1A 1V8DA 2NNWB 1W59A 4RCYA 1KH3A 1VSVA 4FJCC 3KQNA 5TPWA 3P27A 3TSOA 3TIFA 2DPGA 4OK3A 3JQPA 1CLUA 2VDPB 3VQVA 2X5KO 4WFJA 3D7RA 1CW2B 2XDQB 3AR2A 2IHNA 2VRNA 4NBUA 2V9YA 4DK1A 2WJAA 2HRBA 2QLNA 4EHNA 3U2QA 2ARKA 5FLXM 2MINB 4ZOLB 4CIYA 3U48A 2W0SA 3TLMA 4B6PA 1H2FA 3MXTA 3JRXA 5FPPA 2WJPA 1HE4A 3B5IA 1QG0A 1Y1SA 5GTIZ 4B3JA 3ABOB 2QD3A 2E82A 1RXUA 1Y1QA 2AG1A 1IHPA 5DNVA 4M1TA 2R7LA 2YWHA 4DJFC 5AM2A 4X71A 2NTVA 3UEOA 3LUAA 5IMSA 1NLYA 4J7KA 2H06A 1NE2A 3O74A 4B6FA 3VTAA 2PD4A 1YTLA 4UTVA 4C0QC 2UAGA 2BBWA 3FB8C 3MM4A 2ZSKA 3OC6A 3DSRA 2HSJA 5M29A 2WRZA 3PUXA 1W0KA 4WV3A 4UMEA 2Q4RA 3E8GA 3K0TA 5CBFA 3W2EA 3JAKA 1NJFA 3ZZMA 1SO8A 4Y9DA 3VX4A 2BC9A 3R5JA 2N74A 3PNOA 4OHVA 1YHZA 4QOSA 2ZTUA 2CVHA 1TJ4A 1LBQA 4DWOA 1NR5A 1YHQV 4O4LA 3I5DA 5BV8A 1UM8A 4RO0A 3UHJA 2IGTA 3FPHA 2EZUA 1JG7A 4LWPA 2V6BA 4GVLA 1IJFA 4Q00A 3QUBA 1NYTA 2G88A 4KLNA 3LW8A 4NYKA 4O4JF 1I2DA 1QO7A 4P8RA 5K0CA 3RREA 5HZMA 2WDPA 3ZLJA 1E7SA 4JEMA 3DT8A 3O7WA 1Q0SA 1JXAA 4B76A 2VTKA 2EJTA 2A9JA 3QBJA 2YV4A 1ZSYA 1JN1A 4R41A 3SMQA 3ER8A 1GTZA 5ALOA 4C4RA 5AVTA 1QHYA 1BL8A 2YOHA 4NBRA 3RVLA 3PI6A 3FRHA 3QBTA 4RPCA 2JJMA 3BXOA 3FLBA 2I4NA 2M98A 4XTCS 2ECFA 5HOQA 2BFNA 2O4UX 4AJKA 1E6WA 1W88A 2NQ8A 2Y1KA 4XGRA 3PGJA 4IV5A 4NFHA 5K05A 4ODIA 3R5XA 1R4MB 3K1JA 3E81A 1IZ9A 1RRGA 3TGUH 2H2HA 3IJ4A 3IUYA 3VKGA 3MMNA 5DNEA 4EPVA 2E7ZA 3LWVC 3MCUA 2CLFB 4FFVA 1E5TA 4Q01A 3OQVA 3PEYA 1QRRA 4IH9A 3B5JA 3N59A 1JDJA 3AF0A 2BEUA 3EXAA 1RMYA 3U39A 4D4IA 2AJBA 1PJSA 4NENB 2XB2A 4GX0A 3MJFA 2BTOA 3K59A 2XVMA 4P7JA 4N0DA 5GVRA 1I08A 2QG4A 3RS7A 4G8BA 3CKMA 3OHMA 1HQCA 4FYWA 5ELMA 5FOVA 4UFNA 2XWPA 4FGJA 2OUKA 4CM5A 2QX8A 2C4HA 1GO3F 3AHFA 1VI2A 4MAFA 2QUAA 1HEYA 2XQFA 4S3MA 1ZG3A 5IVHA 1QFSA 3O8DA 3DS8A 4CNQA 2EBOA 4IG9A 2G40A 5B3SB 3QVOA 4QGBA 3HDYA 2Q5CA 1K33A 1GGFA 2Q5JA 3H5NA 4RVFA 1QIHA 3JYPA 2W6JD 4LF6O 3CG0A 4JB3A 5D6NA 5FDFA 4NZNA 4YASA 1UOOA 4I1PA 2JEZA 3W5HA 3BCHA 4DMLA 5AVJA 2WYHA 1LDGA 1IY9A 3KQWA 4JENA 4B43A 4OHZA 3W7SA 4RGVA 3U3DA 3BRQA 3QKTA 1QYIA 3WJ1A 4DCPA 4Y2RA 4DR6B 3AL0C 2P9GA 3LGAA 4G0ZA 1PF5A 5DW0A 4YIHA 1FSPA 3Q3CA 5C1DA 4HGRA 1MJHA 4RD4A 1XCGB 4L4SA 3EZGA 4TVKA 1UMCA 2ZSDA 3OT7A 3M33A 1RPRA 3AHCA 2QBYB 2ZYGA 3D81A 3T35A 1NVXQ 3RC9A 1FRNA 1YBFA 1CIVA 4UCXA 3NHMA 4I5SA 4W9NA 3R0PA 5DMHA 1WPRA 2OUIA 2JIRA 2A4KA 3QA3E 2W2OA 2P9EA 4HDMA 1SXJC 5CAEB 2HCJB 1SQQH 2GEJA 4YRCA 3F2IA 2FUKA 5ELLA 4PANA 3DAYA 1S3GA 1EWRA 1SVUA 1II9A 4MTGA 1PE0A 2XUIA 3L43A 1DPGA 4F4FA 4G2KA 3PXAA 4TTIA 2VHWA 5FJ4C 1W47A 3CX4A 3C7TA 4D9IA 4Z3KA 1WM1A 2CLMB 3MMSA 3L9DA 3RUEA 3PDCA 4DR4O 1GTJ1 1PCXA 4JJ8A 3AUSA 3NWBA 1MRNA 3HJCA 1U0RA 1JG1A 2IZ7A 3VPGA 3OKCA 3EZYA 1U3FA 4KP4A 4H7HA 4WN3A 4NOKA 4IQ0A 1KEWA 1BXKA 4IJQA 4H44B 2EIJC 1QLEB 2H4XA 4CTNA 2P8JA 1EBOA 1VE6A 3ZY5A 1GX1A 1PJTA 2QEQA 1RACA 1Z4JA 3UYKA 1ZOPA 1F2TB 3BMCB 2H1OA 4BQPA 2HEIA 2IH5A 1OGIA 1IN4A 2UUBB 5JPCA 4TUYB 1ZWIC 2JL1A 2GNPA 3Q4GA 4GKAA 3LC7O 4KWIA 2FRVA 2CNWD 4FT4A 2OAP1 3X1ZA 2PF4E 2DAPA 5HRUA 3ZCCA 3KU4A 4I7ZB 1JAHA 2JS7A 5A4IS 4KACA 1MNQA 4OH7A 3JCZA 4AZ3A 2ZRGA 1RPNA 3F1LA 3BZUA 1B16A 2JFFA 5ALHA 4P80A 4KQFA 3UWOA 2OYSA 3LV8A 2NV0A 4HVCA 1QLHA 4LX0A 4IXDA 5LP1A 4OQMA 4LZLA 5EWRA 2XGMA 3JQ9C 3FB6C 1GO0A 1CUXA 1N2HA 1K89A 3ZRWA 3UIEA 1DKPA 1U8UA 3TCUA 2GAJA 1U3UA 5HMMA 1DELA 1JU4A 3UHAA 4CCAA 1J8QA 3NWPA 5HF6A 4RY0A 1HNWO 3WMFA 4YI3A 3WNVA 3X2FA 1KNKA 2C0QA 4KWCA 3KQUA 2A1UB 2FLWA 1G3RA 4XW2A 5C7LO 1PHPA 3ZDZB 4AYTA 4IO1A 4Z86A 1ESEA 5B7PA 2P1RA 4LYYA 4MVMA 4P22A 1Z3IX 2F9LA 4XASA 3A1FA 2FX5A 4PPNA 1Y7LA 4Q4CA 2QMZA 2RJNA 5HMLA 2PLFA 3R3SA 2QMEA 2IYOA 2BDUA 4LC9A 2J3QA 2YJ4A 2AZ0A 4GXRA 2VF7A 2J31A 1Z63A 1RWVA 5IZ4A 3OPQA 1TQDA 2IWRA 2CUNA 4OGKA 3HRHA 1Z07A 2M1XA 3BXXA 1AG9A 3K0SA 5B12A 1K7SN 2WTNA 3N27A 3C15C 4CI9A 3DXRB 1FLAA 2POQX 3GRZA 1CR0A 2YZ2A 3KEFA 3TRFA 1WXGA 3I58A 4U7TB 4GLBA 3NC4A 4QBTA 3FDIA 3F6SA 3ELYA 1TL7C 4P84A 3G0HA 1P5HA 2E75B 4OO3A 1X7DA 3EGXB 4FZ5A 2QR4A 2FPGA 4G86A 3DDUA 1D4AA 3LC0A 3NATA 2IBZH 2G8NA 5AKLA 4N47A 2PR7A 1I94B 2G82A 1MQSA 3CCUV 2OTLV 5GIPC 2B1QA 4DMMA 3IQHX 3PXBA 3F5WC 1P5RA 2R1VB 5HGJA 4ZD6A 3ZS8A 4YFYA 2J3EA 1XRJA 3KKMA 1CYDA 2DCMA 4E22A 5JW6A 3HPRA 1SHTX 2AKEA 2ICAA 4J1TC 1KGSA 4QECA 4GS5A 3QUAA 2HNKA 4D4MA 1XPRA 3CUYA 3EAGA 3Q72A 1BU8A 5IAJA 4MHTA 2FPPA 2GN9A 1Z68A 1JQ3A 3ADDA 3KXKA 2FU5C 4YJGA 2AW5A 2GSWA 4LYDA 1AQ6A 3VC2A 2WFZA 3ZGXA 2CH7A 2R6AA 2O3UA 2OYRA 1EJ2A 1MA1A 3KKNA 1KDPA 1ORHA 3LBIA 1O97C 5DYGA 5FWYA 4EYSA 4K35A 1JQEA 4MYRA 1OCZC 4NBTA 4CS2A 3EC7A 5A3SA 2BONA 1RFYA 4TLLB 4F6CA 4FW9A 4L8FA 2YI9A 1T4BA 1JR4A 2GPSA 4WFBV 4YUZA 3KE1A 1NNI1 4UCFA 4QJFB 2O48X 4LC0A 3UM9A 5LKRA 3GJSA 1UADA 3J81N 1Z6ZA 3R5TA 1AJNA 4XIIA 4HNQA 3ZHZA 1NNUA 2QRNA 2VEDA 3O0TA 3KOWA 4YI5A 2IS1A 3W0LB 2OV6A 1OU0A 2PS9A 2I99A 1IBLO 4KFSA 4G4XA 3FWZA 1GLGA 1K6JA 3DV0B 5EFOA 3JWPA 1T3TA 5KOJA 4XI9A 3ZBHA 5CPFA 4LV5B 2ZTHA 4E6EA 3KETA 1RMQA 1GZ5A 2OXIA 4ND3A 5A0FA 4DG9A 3F47A 1LQUA 2IFTA 3PRKE 3OQIB 1DARA 3DO6A 4LGVA 2GT1A 4G1MB 4R5HA 4ASUD 1AKTA 2C92A 5BNTA 3I6BA 2ZXWB 5IT9N 3AEUB 1JIXA 1GNPA 2P9ZA 3PEUA 1JR3D 3RHZA 3HGQA 3A06A 4LISA 2JCGA 4IRUB 1QVZA 2D3OW 1J2JA 1YJQA 3UPUA 2R1ZA 4GOOD 5AYVA 3MT9A 3NV7A 1NBME 3DDHA 4QARA 3NLLA 4IDPA 1PWHA 4KQ2A 2BGWA 3L7LA 1I5OA 4BGDA 4MRPA 1CJUC 1SCIA 3E03A 3WXMB 1P2TA 4NLLA 2XOXA 2HQRA 1X87A 4D56A 2NSYA 3FMPB 2JCXA 1C29B 5BYBA 1CUSA 1KIMA 4CEIB 5JJCA 4D5EA 3CGGA 2FZ5A 2J3IA 2VL7A 3K1AB 1Z56C 3P9IA 1AQYA 3S02A 4M86A 3QEMB 5FBRB 2X5JO 3GGCA 3HLTA 3SNHA 3NYRA 2E5FA 1N33O 1UZNA 3W6OA 1ZRNA 5A06A 3DOHA 2FTKA 4KBYA 2FN4A 3A6EA 1NW7A 5MGBA 1MZPA 4CDNA 1WMEA 2Z09A 1MNAA 2AK2A 3BBPA 4DLUA 1LTHR 3INTA 1QFYA 2R8YA 2LCFA 2PH7A 4F2WA 4WW0A 1W1UA 3WYAA 3KWMA 2Z4TA 2DBQA 5JMPA 5AJTA 2J45A 4RGQA 1N5MA 2FOLA 3EDRA 4LHWA 1WRBA 3A0RA 3ONEA 1QCEA 2CXNA 1K6MA 2O6HA 3PGLA 1XTTA 3D0KA 2UZ4A 3CPJB 3RVJA 4KGZA 3UY4A 1NTOA 2EILB 3TDMA 1SIWA 1W94A 1WB4A 5ER6A 4CMKA 2RBGA 4QHSA 3TTVA 3WMEA 3B6JA 2O3TA 4BO2A 1CUZA 1XD9A 4X63A 4DW0A 3L0BA 2UZ3A 2C5BA 2ZUCA 1SOAA 1B1AA 5HY1A 1I36A 2Q1SA 3COSA 3MCWA 3WLMA 1Q8IA 2OK7A 2GPAA 3HCCA 3S8YA 5GONA 3N58A 1TYEB 2QWRB 4O4HB 3PHHA 2Y2VA 2D4HA 4FGZA 3MTDA 1A2BA 2EGHA 5ICEA 2E4ZA 1DKUA 1D2CA 3AJ8A 3KR1A 4EA9A 1Z7GA 2RCNA 2WTUA 3HA2A 1Y7TA 4A23A 5KVSA 1D04A 1KZ1A 5DOZA 1AXGA 1SIBE 3Q6MA 3G23A 1MXFA 5AI8A 3LA8A 3ASOC 3CNLA 4LXTA 1KH1A 4RCVA 3CBGA 5GW7A 3L7CA 3RUDA 4CUKA 1CYEA 3LCUA 5ADVA 4RWUA 1FJ2A 4BNHA 1B6TA 5FA5A 4ARAA 2Q3HA 3OQJA 2UYNA 4XYLA 5KYWB 3U7GA 4NOJA 1MP0A 2VR1A 1I4WA 3CWZA 3GY0A 5JQGA 4PBSA 4JUCA 1TTQB 4YUYA 1TCVA 5AKIA 5KJFA 1U4SA 2CB0A 2P0AA 1X94A 4P5DA 5KS2A 1FC0A 3MINB 1VE5A 4EB6B 3ZK8A 2YSUB 4D9KA 4CLRB 1PGJA 4H7JA 5HGXA 4BNDB 4WVLA 1P2SA 4MDYA 4EGJA 3FGNA 1YL6A 2MTBA 1E94E 3OFNA 3IKLA 1I9CA 3WG7C 3E8HA 3ZKWA 4G4JA 2QENA 1ORTA 5DULA 5K3CA 1CWUA 2CXRA 1IZ0A 1YIOA 4MB6A 1CF2O 2P6RA 1M6VB 2VUTA 4ZPXA 3WK7A 2WQZA 1I4LD 2Q0OC 1Z0KA 2QRPA 5T6MA 5DXFA 5CNJA 4LRYA 1R66A 1OH7A 3CCEV 3WGJA 5JE8A 3QBDA 2H0AA 4RW0A 4LKRA 4JI1O 1SXJE 4PS1A 1ZNXA 2OFFA 3BK7A 4GKBA 3GRPA 1U2QA 2VDUE 4Y2TA 3MWDB 3X1MA 2G4VA 4REQA 3W1VA 3SHWA 2DHQA 2IL1A 3CNQS 5FP0A 3A26A 4M0FA 4ZYXA 2NMUA 4IDNA 2HYIC 1KRWA 3VV2A 3WZMA 4BC0A 3TM4A 5DGHA 3N8DA 3NB0A 2O2IA 5KVCA 4MGHA 3T7JA 2HIAA 2YBEA 3IDSA 5AHWA 1VQPV 5J9PC 4KR0A 3KLOA 3UUGA 3TNFA 4UCSA 1HFEL 1Q1ZA 1NVKA 1O94C 1JKMA 1MO3A 4U8GA 4A2CA 1AMNA 4O2RA 2H9YA 3J7AU 4DC0A 1ZN7A 4PAMA 5JWRA 3DW3X 4WXEA 3JVIA 1ECGA 4M89A 5CLQA 3PDHA 3AG6A 2OOSA 1F23A 1O95D 3K0GA 2B82A 4WXHA 3RDPA 3RTBA 2FSVA 1W5AA 1JQ5A 1XTIA 3MTBA 3PPWA 1J95A 2GVDC 4I6EA 3CF2A 3JSXA 5HF9A 3U31A 4DLVA 3BGWA 2AOTB 5KSOA 5DHFA 2UV8A 5EMKA 3P52A 3C1AA 3NUQA 3HR7A 2Z43A 3EW7A 1VK3A 1MT3A 4DMKA 4BQFA 5D3KA 5IYZA 3H0EA 4UEJA 5EWLA 1TRKA 3GT3A 2B7BA 1R9GA 4OGLA 2ILTA 1LPNA 3BMOB 1QVWA 3RA6A 3D2CA 4PZPA 4B3SB 3DLTA 5DLEA 2NYUA 2I7VA 4DPLA 1TK3A 3SNKA 4LMRA 3AYXB 1EA5A 2Q0XA 2F8SA 2FJPA 5A5EA 3OESA 4FD2A 4YRRA 3RSGA 3FBGA 2BZ1A 1NJ5A 5LP6F 3E3MA 3KZOA 2B9EA 3ODGA 3GJQA 1DRKA 5A2GA 4RS3A 4R3UC 4NS4A 2WG0A 4R8MA 3F0EA 4PZUA 1GFWA 4HWPA 5TPZD 3QUQA 3UJHA 4BRUA 2J3KA 4BJ5A 4NMHA 1N2IA 2QAGC 2H31A 2HMAA 3OWOA 4LIPD 3RVOA 3AI2A 3OOEA 2SKDA 5B8FA 3ED1A 2WINI 2PJZA 4KHZA 4MRNA 1V0JA 4V3CA 3QVMA 3C41J 5CNMA 5DEDA 3TQFA 3B8HA 1A7UA 4S2UA 4HMOA 1MPTA 1TVMA 1M2OA 3LMKA 4LRQA 2ZBDA 4MB0A 3TSYA 4L4UA 2JBHA 4Y1EA 4EDHA 4YJ2B 2GETA 1RZ3A 1TLLA 3BA1A 5AVXA 4HBGA 1U0BB 4BLPA 3K70C 5GIPE 1N6OA 1W73A 5ECYA 4R98A 4LPSA 4F72A 4GEKA 4OQDA 1FRVA 1F2DA 5KDDA 5FQOA 3DWIA 3K0FA 521PA 2ORIA 4Y0AA 4I81A 5DGCA 5FT9A 1I80A 1VRWA 4RJLA 4BJ1A 4X8MA 3SLGA 2JH9A 1ZN8A 3WL5A 1ZW1A 2HJ9A 1SKVA 3DMPA 3PG5A 4QOHA 3P9CA 3ZH2A 2PBLA 2HZ7A 5CB0A 4YMLA 3BRWA 1M1KW 2GK4A 2IPXA 2E0IA 4OFZA 4K1XA 3VQYA 4QODA 2PU7A 3A6HA 4LJ6A 1JB1A 2HXGA 2D0DA 2Q2VA 1XLVA 1ZJ4A 5CDFE 3E4DA 5J47A 2QDKA 2OOKA 3KC2A 4NNJA 2ZVZA 1SU7A 1WL8A 1J33A 2BTQB 3CRRA 5K0LA 5C93A 4PSDA 4N21A 2PX3A 3SEAA 4CKWB 3Q9UA 4A2PA 2ZOVA 3IAHA 4D3ZA 3ACCA 1JA1A 3IH5A 5DU2A 3RTCA 4XBFA 1JEAA 4QPCA 3M1AA 1DKQA 1CZUA 3TNLA 2KB0A 2VJQA 3EPPA 4FOPA 5G1PA 2NUAB 1RHMA 1AKWA 5BRNA 2C4VA 4KG7A 1VIVA 1TGVA 2LGQA 1WW8A 3A9SA 2V6IA 4HDSB 1GRQA 4I4CA 4JLJA 5L3CA 5BQ5A 4L0DA 4RSRA 1UXIA 1W44A 1HL3A 4XWTA 4HGPA 3ROGA 4E94A 1H9AA 4M8IA 4CDMA 1IOVA 2A30A 3KV3O 4LMPA 2DW4A 3ZJUA 4JA0A 3H1AA 2WK1A 5J1TB 4OX9Y 3TKYA 2ODPA 3M9WA 1KMMA 1CIJA 1ETUA 1P1FA 4XSGA 5IFLA 2OHWA 2EQAA 4XTRA 3GFTA 1P7CA 1X1AA 5LBUA 4CKYA 5AVUA 3QVXA 1UKVY 3AK3A 1K4YA 3KUXA 3I1IA 4ND8B 4NESA 1H22A 1E2QA 2ZJ3A 3TZKA 2IOHA 3W2GA 2VK4A 1XX6A 4DR6O 2W00A 4JCCA 5JO9A 2FK8A 3M3DA 4PE5B 5FTWA 3ZDDA 2QKSA 4INJA 4GR5A 3TLKA 4D25A 1L5NA 3HJTA 2UU9B 3GELA 4NYIQ 4QEDA 4F84A 2ODQA 3BFPA 2RHDA 2AZMA 5DJ5A 2QE6A 3KJJA 2BP7A 3FPEA 1QS0A 2V7BA 3KYCA 4FDTA 1EFCA 2JFHA 4OI0A 3F8WA 3KQKA 2O54A 1ISFA 4ENTA 4FSDA 3Q87B 3EARA 2F1IA 3WU2Z 3MVEA 4FHZA 1QOZA 4X3LA 2VDVE 3FB4A 1SN7A 1NU6A 2BKLA 4Q15A 1OFIA 2FG7C 4UOZA 3WAGA 1U63A 4C1NA 5IC4A 2ZYVX 1N0VC 2W6ZA 4CL0A 4BNFA 4TZZA 1L4LA 4HQFA 1I0LA 4F8JA 3UJ6A 4KOAA 4TQUS 3SDZA 2XDAA 3MS4A 1FDUA 1JT9A 1N3LA 1IXMA 4GPEA 3AM1A 2DQSA 1U1IA 1R16A 4RD6A 5B1AB 3HJBA 3R3HA 4AD8A 1VYTA 1ZDMA 4PN7A 1YDHA 1LJ8A 3GCWA 3FBAA 4C7VA 3INYA 1B2RA 1TM4E 3TLXA 3QH4A 1R18A 2X5XA 3COJA 1PT6A 1XQYA 4O02B 2EULA 1AK2A 3M3PA 2GZHA 4OD0A 1Y8AA 4XJTA 3ZDAA 4D7TA 5CEFA 4NZMA 2FWJA 1HSOA 3EBLA 1NH2B 4KVAA 3ZN0A 2COEA 1D8TA 3UJDA 3W5IA 2LFSA 3DFKA 9ATCA 2GLTA 2BFWA 5EO3A 3L40A 1PX0A 2OWDA 1DC8A 5B3AA 4XWWA 2UUBO 4UHDA 1QLJA 1LPMA 2H94A 2QS9A 1VFNA 2J3MA 2OBBA 4K7JA 4MINA 2Z1EA 5B2ZA 3R5HA 4F5EA 4BKRA 4L74A 3WDMA 2NO9A 2W8BA 2O3JA 5ISMA 2HS4A 2PVPA 3GYQA 4JJAA 1QP4A 4TTRA 4DLKA 3IA7A 3JAKB 3A1UA 3E3AA 4IDHA 1KMIZ 1CN7A 3KQSA 3FCAA 3KLPX 3NOXA 1WETA 1LRKA 3HUDA 1NZ6A 2LKCA 1ORWA 3ZGNA 4ZGWA 1D2EA 5MN5A 3DEAA 4O4LB 1YFKA 4EY3A 1R6XA 3QENA 3HYNA 2REBA 3D4OA 1OLSA 3CQ9A 1L8LA 4Q9NA 1H2AS 1MVNA 1KXZA 4IFIA 4OX9B 1OBCA 3NBZC 2I55A 3H4VA 3RU2A 2A59A 2C3UA 1XTUA 2QTMA 1EWQA 2J5RA 1HMYA 2X86A 1KVTA 4B31A 5K03A 2YNMD 3FCYA 1BWPA 3EPRA 1DC6A 1U3WA 3IELA 4MYCA 2CGEA 1D6JA 1UK7A 1G5IA 2IRWA 5AXCA 2AHYA 4CLDA 2CLCX 3OBIA 4DAEA 3ZDCA 5JXWA 4IS3A 1VQ5V 5ECWA 1IEXA 3UICA 3CONA 4K40A 1XDZA 3LC2O 3APOA 5FH9A 1X7WA 1L5WA 3ELWA 3T94A 1VLLA 4K1LA 3JASA 1SXGA 4B44A 1W88B 5JWHA 3WK6A 3ZQ4A 1WDTA 4B3HA 3E4CA 5DNWA 2O8DA 3T1QA 2NR5A 1ZFNA 4EMSA 1Q6ZA 2O7NA 1SBHA 4A92A 4X1KB 1B76A 1I94O 2EBUA 3R5FA 1OE0A 3ZY4A 3LBNA 2EATA 4GM1A 2BEUB 1N5DA 2NAFA 2DWPA 5HS4A 2QN2A 3K9LA 1AGYA 1R1MA 4KQJA 1E1RA 2LKDA 4TT3G 4D8UA 5DT2A 1V26A 3GJ0A 1LWNA 2E18A 4UREA 1Z5OA 1RSOA 2GHTA 3W9YA 5DX0A 1O87A 2QSAA 4C0KA 2BI7A 4FS8A 3AKZA 4KQIA 2Q5IA 1UDXA 2H1VA 3QW4B 5HKKD 3O3CA 4PIMA 4O4IF 4BVHA 1Z12A 3RV4A 3LZCA 3CC2F 2WJWA 1E3IA 1LPOA 2Y99A 4K6CA 2P5UA 1Y1LA 2IF2A 5D00A 3ERNA 1QLWA 2R9AA 3TINA 2JH3A 3A2KA 5EXTA 1ZMRA 4ZHSA 1KYVA 2DQ4A 4BIZA 1E1QD 2Y9PB 3DLPX 4MUYA 1PQWA 1AVMA 4FJ1A 4JC0A 2EBHX 4YRPA 4UZEA 2DYRB 4IBOA 2EQ5A 4OBBA 3AR5A 4WJKB 3RAGA 5HOEA 2FQYA 3DZ8A 3STHA 1B3RA 4FGUA 4BFLA 2I6GA 3UB4A 1VHWA 4CLHA 3O47A 1C14A 3D8TA 4EJSC 2J5QA 3EMDA 1SHJA 1OFVA 1KMCA 4UQPA 2QQ5A 4F04A 4GPAA 4H4DA 1S7CA 4MTCA 3RE3A 3SQDA 1U02A 2C98A 3CSDA 1Y66A 1Z18A 4M8KA 3VZQA 2Q4EA 3OFJA 1YB5A 4O0MA 1MAAA 2IW5A 1ND6A 4HTAA 3UM7A 4D42A 4MW6A 2IZ5A 2GUWA 4JT4A 1PL4A 2G72A 2WLLA 2ZATA 1DQPA 5L45A 3PUWA 2CBXA 1MORA 3TQHA 4BB6A 1T0AA 3VYTB 3MSCA 1WXFA 4HDMB 3T7TA 1Y81A 2JLUA 1W41A 2HSZA 2Y05A 5A0VA 4GU5A 2VP4A 4JJ4A 5K8JB 3TTYA 2TMGA 2RK6A 2C7RA 3E48A 4EG3A 3I9V6 4F2PA 1UJMA 3Q6IA 3CH6A 4DA6A 4UUOA 2OO5A 3A4MA 4QTTB 1ZA1A 5ED4A 3L6BA 3G3EA 1ONSA 3PKZA 1UJ5A 1U28A 3N87A 3B36A 3N2NA 4I7EA 1N3BA 1CY2A 1RE0A 2JAOA 4XDHA 3WLEA 2Q9BA 2ZGVA 2Z3WA 2Q6IA 2VT7A 3IKJA 3T5BA 4LYHA 4R6WA 4YRFA 2IP1A 1ETHA 1E92A 4DR3B 3H5LA 3DQPA 3TTXA 1U0SY 5ICCA 3LQKA 3MJVA 1IBMB 4B4KA 2BAGA 3BD8A 5K9ZA 4DIBA 2OZPA 1YQQA 4O3FA 4CIAA 3IP5A 2A58A 3GLGA 3PFKA 2FVXA 1H7MA 3WJQA 4MYHA 1F8FA 2C3PA 4GM4A 2GF9A 4XDGA 1J56A 2P1ZA 1YCFA 1LFDB 4V2UA 2ATXA 1I4EB 4N40A 2PXHA 4LJLA 3GLFE 3T5AA 1TUEA 3WMGA 621PA 4X7PA 3I30X 4QYSA 4DLAA 4H77A 1NXXA 3UJ8A 2CE7A 1O1YA 2BFPA 3HDJA 4L0CA 4PXYA 3ZVKA 4M9SA 1NM5C 1BOFA 3NUGA 3ZRWB 4DHWA 3AG2C 5EXDA 5IN5A 3AEKA 1DGSA 1H8HA 3PEWA 3PA8A 3Q1KA 3LBAA 1QP8A 3GDWA 4NF2A 3KJHA 2PWAA 4CKBA 2QTOA 1VQ9V 4XOIA 5H81A 5GOZA 1L3IA 3TXQA 3CPEA 3C6XA 2VAPA 4FXPA 3T41A 1AS0A 3ZXIA 4B48A 4AU1A 3V9PA 1G60A 1KNJA 4KMOA 3DBRA 1GQOA 2IYYA 1MO5A 1R0LA 2JHAA 1W5BA 4MLZA 2Q67A 4RM3A 2LDXA 3T6KA 4AMVA 3G7NA 4N0EA 1RLTA 2XUZA 5ES3A 4RTSA 3ZN1A 2ENUA 2Q3MA 4TOIA 2G5TA 1YEWA 5AUQA 1OV4A 2ADMA 2EFYA 1KETA 1GQFA 2I2XB 5C7OO 5K4GA 1EINA 3K57A 4LZAA 4LMBA 2RJZA 1VBKA 1Z0FA 2LPMA 1EVJA 4B8ZA 1I24A 1AA6A 4NIMA 5KUMA 2Q5QA 2IYWA 2FPGB 4IJUA 1HETA 4XJVA 2GUZB 1GIAA 3EEFA 4XSHA 4RTMA 5LU9A 1MLDA 4RHXA 5E7QA 4B7XA 3T4XA 1SMKA 1X9IA 5AWFC 3ADKA 5FUQA 2PZLA 3RFVA 2HXYA 1ZM2A 3R23A 1REQA 2B83A 2VJBA 3UMVA 1VF7A 3RE1A 3Q7PA 1RQNA 3WL8A 1COZA 4UEWA 2JPDA 4PA4A 4RPLA 3OLWA 3WGHA 1J8MF 2VA8A 4NBKA 3GP3A 1KSHA 5HK8A 1N7HA 3I52A 2NN4A 4JB0A 4N9QA 3RANA 3PNYA 2ZRJA 1E18A 1PF7E 2EFJA 3EDMA 1V37A 5LB4A 3OBBA 1M2WA 5HIIA 1Y48E 2HUPA 3U3ZA 2ZFUA 2FPPB 5E6RA 2B21A 3O5AA 1BMFG 2O2CA 4F21A 1I9GA 4YJGB 2KG7A 2ZJ7A 2BR4A 4URWR 2CH7B 1J42A 3R8CA 1WPGA 4BVEA 4RIGA 4F7DA 2K4MA 3O95A 3V4VB 4YAUA 1VQ7F 5A03A 5AO9A 1KZGB 1WOYA 1EK5A 3QOFA 1YI1A 1YCGA 4TRMA 1PD0A 1QAMA 3N2IA 4XVRA 3D7KA 3LGSA 3H2GA 5A3VA 3ZJYA 2FPRA 3MFYA 4LNUA 3HA3A 2GLZA 2ISSD 4D0LB 1W36D 2ATVA 4K46A 3EULA 1ZL8B 3RUFA 2VHCA 4ZQIA 1BJKA 1G3UA 1HKUA 1GQRA 1JH8A 4Z0HO 4PJ0Z 2VRCD 4R3WA 5IH3A 1YS2X 5DEIA 1FFYA 3MJDA 2WP8J 1J5EB 1PR0A 1JKXA 3ACDA 4ARIA 4XCVA 3PEFA 1M8KA 2H2WA 4D1YA 4H7FA 4I1UA 1R0WA 1TQ4A 5KOJB 4TV9F 1NKTA 1ZSPA 1LX7A 1Y8RA 1P4HA 2WUEA 3PRYA 5LHIA 1WQ3A 5B1IA 3V6LA 3RYTC 3A1VA 2AN9A 2DZDA 1M2JA 3THWB 1GGHA 4GCZA 3K5PA 1NV9A 2XQJA 2VK2A 3CC7V 3VHXA 4OQNA 2JK1A 5EJIA 3NK6A 4KDEA 4W1QA 2BCJQ 3CRW1 3ZWMA 1H47A 3ABTA 2YWXA 4FFNA 1NUQA 3A25A 1RLJA 1D09A 2CHSA 5FOWA 3TX6A 3PHGA 4YQEA 2RARA 3BHIA 4CEJB 4JBNA 2OHGA 2IUTA 2V97A 3F67A 3CUVA 3F6PA 4ZT7A 1WVIA 2GRAA 7GPBA 1E0KA 1JALA 1WUKS 3IIIA 4G4ZA 3LD9A 2WEKA 1V71A 4J4TA 5KUTA 4KGDA 2ZZNA 5IVDA 4B3SO 1ELOA 1KBOA 2PCLA 4CFZA 5C8YF 4HHEA 4LF9B 1K4MA 2DT4A 2Y27A 1SB8A 3DH0A 4YLGA 4EL5A 4DUZB 1U9IC 3OTQA 2YN2A 2ZRIA 3FGPA 4W6ZA 5JADA 2XD4A 1QF7A 2Y0CA 1U97A 4YMSA 5ALXA 1UBTS 5SZIA 4C0AC 3LLVA 2R4QA 3LBYA 1I3MA 3U6KA 1VL8A 3QV1A 4ZV9A 1IXSB 3DDWA 2P79A 1QG4A 2XA2A 1IHYA 2NQ2C 4CG1A 3UJAA 1KAHA 3QPAA 2C7GA 2XB9A 2YS8A 1YZKA 3CEHA 3MG9A 3V3TA 3LMEA 4EKDA 1V54C 4ZCQA 1HEUA 1Y9JA 1GAXA 3CUTA 3MTAA 4DLZA 1T5OA 1BEEA 2CF5A 3A0RB 5EJAA 3AVTA 5CLJA 4DMGA 3AK1A 4LFAB 4BVRA 4M1QA 2BOBC 1OZFA 3OCZA 1BN6A 5L4NA 3TLYA 4TWAA 3WDSA 4Z7OB 4WT7A 3UMRA 4YXWD 1D2HA 4BKMA 1KI6A 3C7CB 2YZGA 1H2EA 2DR3A 4MS3B 4B84A 1L5FA 2XNHA 3VAAA 5LFAA 4WLFA 1AT1A 1MC4A 1Z2AA 2FCAA 3U3JA 2PO5A 2AS0A 2PLWA 3BH6A 2JDIA 2WFMA 2B5OA 3C87A 5HYVA 2XVZA 1VMKA 3GNLA 2GI4A 3A4IA 2IXFA 5JS7A 3ND6A 1THGA 3ZEAA 5GONB 1JMKC 2WF9A 4B8WA 4WXPA 1G7RA 4DA9A 2J9XB 4HQOA 3QPBA 4R5MA 2IYTA 3W2TA 1IPFA 1LVUA 3ESAA 4CG3A 2BRUC 4OHOA 5JVDF 3LUPA 3KV1A 3DXXA 1C7JA 3HH8A 4BMOB 3RC7A 2AFRA 3JD1A 4IILA 1M76A 3W5AA 1U9CA 5IWAB 2UYHA 2W4IA 4NOMA 1A5AB 3Q9SA 2IZZA 1T1JA 1ZVKA 3SC2A 4QO8A 3MMXA 3R8FA 3C97A 4RKQA 1QVGU 4A0RA 4DQVA 5JSUA 5EIOA 4YPVA 1P9OA 1KZHA 1SOMA 4ZOQI 2HA3A 4EA7A 3E7PA 2NZ8A 2NYRA 1QBZA 3S2ZA 2P35A 2GVNA 4QDTA 4JBYA 5FL7A 3UOAB 4IIJA 3ABZA 4E51A 2R44A 3GFVA 2UYNB 4HEA6 2XXJA 1WZCA 2YVUA 5DFAA 2RGDA 2ZI4A 2ZT5A 2C2GA 3S1AA 1P7YA 3CCSV 2I9PA 2PKEA 4AC9A 1L7DA 4LRSB 4MKRA 4WH0A 2BOCC 3U7QA 1YVPA 1MMMA 2WJJA 1O95C 4YT4A 2CNDA 5DM4A 4NARA 4B74A 1QC5A 1UBLS 3T54A 1PJAA 2LBTA 4YH1A 1CUDA 2LWIA 3JQBA 3JYCA 2QQ0A 3SC3A 3CKKA 4AMGA 2O52A 3ZKWB 3SHQA 2CHVA 4HDRA 4HUJA 4EPYA 1N2CE 1XIVA 4PHFA 5IZCA 1SD5A 3BSWA 1ST3A 1MX9A 3RS2A 2I5PO 3PDUA 1NBWB 5FORA 3PC3A 2NUTA 5G0VA 4HL6A 4NMWA 4BNWA 5BUZA 3BHNA 1NBMG 3G4SV 3CVJA 1OLXA 1LK5A 3OZRA 1NRIA 3L0PA 1NTZH 4S12A 3HVRA 1KVQA 1CUFA 2X40A 4QLBA 1W1WA 2YHAA 3NXKA 4S1TA 4PW0A 2FQ1A 3UYLA 4LQCA 1OTXA 1I1HA 1YR9A 3VMMA 1GN8A 3BBLA 4MMZB 4WESA 2FV8A 1VGRA 5HF8A 2XF2A 4ANFA 1DIHA 4C6HA 3PQCA 4QXMA 4UXHA 1OFTA 1KP9A 4ZARA 3CCVF 2UU9O 4WSOA 1DUIA 1FY2A 4LZOA 2PTGA 2EL7A 2R97A 5LWQA 3KKZA 5AVQA 1T2EA 4IUCS 1YS9A 4BZXA 3OM8A 2X0IA 4F5WA 5DGIA 5CVCA 1QO9A 2IBTA 1W29A 1S5JA 2HH9A 3MOGA 3C74A 5TE9A 2I7CA 5FJJA 4DO2A 4FN5A 4DJ5X 3MDSA 1EP2B 3W4JA 4WLVA 2AOVA 2ERCA 3CX6A 4OFBA 3SYOA 1VLZA 5BVHA 1NHGA 4J7CA 5EUCA 4MI3A 3DL0A 3WOVA 5DI3A 3NMUF 1TRHA 1P9LA 1HLGA 1KBZA 1Q82H 1YL7A 2OR3A 4EG5A 1G8GA 5GIOC 5IT9A 1WSWA 5A9RA 3JQFA 2QW8A 1OGJA 2QD1A 4DQ0A 5JD5A 5IYZB 2G9UA 2M6SA 3T3MB 4NAUA 3W5UA 4BECA 3F5SA 1UOEA 5BO5A 5DX8A 3KYJB 2DC1A 4BB5A 1KD1H 5CTAA 3S2EA 2EV9A 2I4TA 5BR4A 1MRSA 2RAVA 3DMDA 2QJ1A 1O6BA 2WJVA 3AW9A 3J81k 1QQ5A 1R6UA 2CW5A 3OZXA 1C7FA 3S55A 4JELA 3FPAA 4EI7A 3HJGA 1ZY2A 3NONA 1JS1X 4E5YA 3C3CA 4BW5A 4X8AA 3L6DA 4PZYA 2IS6A 3O26A 4U0JA 5DV9A 3R1IA 2Q46A 3E58A 3R20A 1WAMA 3AFMA 2ZZMA 3NTRA 4FKZA 4NTYA 4KXLA 4TROA 4AUKA 2PSJA 1XOIA 3Q6NA 1J7JA 1EBBA 4Y2VA 2EW2A 3NDJA 1IZ7A 1KAOA 1WXIA 1BH2A 2FLVA 4AK9A 4K87A 1I7FA 3T3GA 1V5FA 3EXFA 2PFSA 4R54A 4B17A 1F51E 1SHZA 2VTDA 3LCMA 1GL7A 1GUDA 1W5TA 3SK0A 4WDQA 1AGPA 2DG2A 4II7A 1KHHA 1M2OB 1ES9A 2FVYA 4YX9A 1R00A 1TB4A 2WF5A 2ZIMA 3N2GB 1US6A 1KKCA 1F8XA 4EZEA 3GA5A 4OX9O 2Z2JA 5EAZA 3SS9X 2QTWB 3AILA 1OCEA 3QO7A 3F78A 3T9FA 1YZQA 4GZRB 4XJSA 2AIFA 2DSTA 3STLC 1C80A 1X8XA 3Q8MA 1D2NA 2G0NA 4V0OA 4E46A 4Y9RA 1LX6A 1W5FA 2GK7A 3NVMB 3K0FB 3EVFA 1PEYA 2KW5A 1N8NA 2FWAA 3UW1A 2WU0A 2GPBA 1W6UA 1J23A 3TTTA 5LZ7A 4MPTA 1OA0A 3GCGA 1SQXH 3QHQA 2DLCX 1OX6A 4AS3A 4Z0NA 1S9HA 1JR3E 1ZBQA 5K8CA 5T4EA 3NKVA 3LSSA 3B2NA 1UBMS 4CTJA 3QJ5A 3T7DA 3FDZB 4IJMA 1PS9A 4N5MA 3GFSA 2I4LA 4JPRA 2BEKA 1X8LA 1P1JA 1EXVA 3K6RA 1UJ6A 3A9UA 1BDBA 3ILXA 4I9GA 2XCQA 1WQ4A 1NIJA 1KOGA 3WLOA 1PQYA 3ZWAA 5TDHA 2ZWIA 1CJTC 2OBLA 1EWTA 3RKUA 5ALUA 4MTLA 3B6NA 2WU8A 3EISA 4EHAA 4N65A 2EL9A 4L50A 1FS0G 2BZSA 5F5XA 4FMDF 3CKLA 4CV1A 4TTAA 1JD1A 2FDXA 4EI9A 3ZGZA 4FMPA 4B82A 3PHLA 4FI3C 3ZLVA 4L6IA 5KWSA 1T0HB 3LQ4A 3ODPA 3G88A 3L7YA 1CG6A 4TWZA 5F2NA 3LHIA 3QTYA 3AHDA 2J9FA 3RLIA 1TM1E 4G0PA 3EDYA 3VPHA 3HVHA 3RC8A 2RJOA 3CF6R 4CMHA 1KARA 5E38A 1J0XO 5JBIA 4GMKA 3T0IA 1G4AE 5E3JA 5EQDA 3O9ZA 4M7WA 5F7OA 2IU0A 3TN7A 4NBVA 1Q7GA 1U2EA 3GRCA 3CCRF 4BFUA 1VMGA 2P0EA 1CR2A 2PMPA 1DAFA 3BFJA 1QH1A 2XKBA 1R5NA 4AO6A 5SYAA 3U5ZB 1RYEA 4PQFA 1BE8A 2BW0A 3HUUA 4QM6A 3B53X 2OBYA 1Y6XA 5EZSA 4L0MA 3L0SA 4BJ6A 2ZSFA 3UO8B 4P0TA 1CEQA 2D62A 5JU6A 3M4JA 5CFOA 4G5GA 2Q9CA 3PU6A 5C8VA 3GRKA 4IKOA 1HP8A 4ZMSA 5LC1A 4B34A 3GLIA 1Q43A 2WWGA 4CHGA 2C4TA 1DOZA 2JLSA 1BEUB 4M9UA 1UK6A 3JTEA 5K1XA 5EERA 3RIXA 1U7DA 4Y2JA 3MOSA 3S2GA 1QS0B 2A3RA 3KYCB 2OD9A 4MVJI 3OFVA 4R8SA 1V1JA 2GFHA 3F4BA 1GTG1 1VKHA 2XCTB 1FSSA 1VZ3A 2ZBVA 5F3DA 1PL0A 1Q16A 1QYDA 4I55F 2ISCA 3ZTTA 3WX0A 4PR3A 1GEGA 4E1VA 2B5WA 5IM4A 5GJCA 2C1XA 3NK7A 4XE5A 3H9QA 4NNPA 2IHYA 3BXGA 5LYJF 1U9ZA 2C03A 2PTMA 2OLEA 3MCZA 2NZWA 3HCAA 5IAAA 5JO0A 2JKZA 3E3OA 3VR6H 4E5KA 3A04A 2DSNA 5DWVA 2PUDA 2DM6A 2LUOA 1DC3A 4FK8A 4X20B 4BNNA 4D9BA 3KDPA 1O9HA 1HURA 3OZFA 3I2IA 5F35A 2AMLA 3FZGA 1OOEA 2YW9A 4G0WA 4FZ0A 3FAZA 2IVFA 2XTMA 1NH2D 4MA4A 4B5LA 1FFAA 3I01M 4DR3O 4EUFA 5LBIA 3U19A 3WGKA 1YL5A 3QPVA 4INOA 1IBMO 3DGEA 1ZIPA 1G291 1ZN2A 1P8JA 3KOOA 3Q40A 4BMNA 4EHKA 4H3VA 2BMVA 3I53A 2ZK7A 5AOVA 1PNQA 4N6OA 3GLHA 1UJNA 4EVIA 4JI5B 4RKYA 3K9QO 1EZ4A 3GW8A 4PC7A 1IY2A 3SAJA 3U62A 4KMRA 3UJPA 5SYMA 4G4SP 2DBRA 2P4QA 4RPJA 5BWLA 4DIUA 2W6NA 3RR2A 3IBTA 3L0CA 1HNNA 4H16A 4NQ3A 3K1TA 4MQEA 4JBHA 5K20A 1ENZA 5IKOA 4GZ5A 4QJ3A 3EIXA 3E22A 4YALA 2HO5A 4JMPA 1U1CA 1GRJA 3CRVA 3CH7A 4RF3A 2ZVYA 1Z5PA 1TYBE 4XRRA 1RWOA 4BO0A 2H1SA 1NXOA 4RM2A 5ADHA 3GTZA 10MHA 2ZR8A 4L1KA 4BN5A 3K8YA 2OO3A 4OKSA 1OLSB 5HG0A 1TM7E 3UGKA 3H8WA 4BQRA 4HVTA 2PM8A 1XQXA 3A2FA 2V3CC 3WDKA 2NYVA 5HHTA 5KWEA 2VNKA 3PC4A 4D82A 4FR0A 1NRWA 1ST2A 6AT1A 4MIEA 2IJIA 4H4CA 2XQKA 1E99A 4GLFA 3P9NA 4J41A 2ZDHA 3GU3A 4Z5XA 3AG4B 4DEYA 1OU4A 2CCKA 2ZDIC 5H70A 2J48A 4EITA 3L84A 4EPTA 1NNSA 4R83A 1X7WB 2P27A 5JAZA 1WVGA 4L9WA 3JASB 2ZI5A 2FR0A 1D4FA 3PEVA 2Z2IA 1NQAO 4G5RA 2HVYD 5M2QA 3I8XA 4G1CA 1MJ5A 4KAFA 2FI1A 2O8DB 2ZTSA 3WYBA 1NYQA 2O07A 5CMUA 3CR3C 3KM0A 4IYHA 5IG2A 3EODA 3G9QA 4ESOA 2IVZA 4GLJA 3CMCO 2P11A 1VRCA 2NV2B 5DRTA 3H2ZA 3L6RA 1WDWB 2EKPA 1S96A 3KIZA 1HO3A 3BIOA 3I2FA 3VOSA 1ZJYA 2IDKA 3SGIA 2ETVA 4ZVRA 1DIBA 2UZ1A 1HPLA 1E60A 1HSZA 4TPKA 1J24A 4ZBMA 3LUJA 4JVMA 4H6PA 3JD4A 5JDCC 4X54A 2I4MA 1RSOB 4RY8A 4MW1A 1H6CA 4FEGA 3K7EA 4C21A 4U4AA 4X3OA 5HY4A 3K2BA 4ETMA 2FZVA 3CCJF 1XMOB 3B9PA 2BHSA 1P33A 4IHJF 3SKYA 2D1RA 3L6OO 1XMPA 1H93A 1XRMA 1ZPDA 3F6BX 1GZ0A 1PFVA 3DTVA 2QWXA 2M6LA 3CJRA 2XODA 1A97A 4RVDA 1CP2A 1TMYA 3IEPA 3GEGA 2GPYA 3JAWA 3CLSD 4O5AA 5L53A 3ZP7A 4BUJA 4X3PA 2VJCA 1Y0BA 3D5EA 4TS9A 4RZ2A 3FKSA 5B1SA 4WZAB 5HDBB 2WBLC 2AJDA 3MTEA 1HNZB 5KDLA 4O2BB 3HP1A 4C0WA 4FOLA 4OGWA 3UGJA 3ETQA 2BKXA 1SGWA 2F59A 4KTVE 2JEXA 4NE7A 5GIOE 1J9EA 4Y1GA 4UHBA 4HEA1 1L7XA 2RH5A 2QX7A 2G09A 1J5EO 1GMGA 3DQQA 5K99A 4R8RA 2ZKIA 3M1IA 5C31A 1U7ZA 5DIFA 1P4RA 1W40A 3WLFA 1R15A 4QO7A 3DDNA 3LQRA 4DDVA 2WLIA 2WLLB 5K5EA 1KQFA 3I1FA 3L8HA 1J90A 2CD7A 2QRVA 4E5VA 5C3UA 1IULA 2AOWA 2PK3A 3UQZA 1T8RA 2DMRA 3ROPA 1VHTA 4KH1A 2FX2A 4R1MA 4GQIA 5F7JA 2QKCA 1Z82A 1I7DA 3E8SA 3FGZA 1N5KA 1NT4A 5JJNB 1BE6A 4AX8A 1EFRA 1DAMA 2ZIXA 1XT6A 2D2CB 1PM9A 4MCJA 4PBRA 5AH0A 5EC8A 4XD2A 3D2LA 1TLTA 1BW9B 3PFFA 3PL5A 1GCIA 4PR0A 1E2UA 3NJ8A 2P69A 3HO6A 4TSFD 5EP3A 4GZ3A 3SYPA 3LWPC 2YJ6A 1NBAA 3SSMA 1G5FA 2HV9A 3K53A 1HZJA 1FXHA 3RODA 3WRYA 3AI3A 4EG4A 5IJWA 3TEFA 5AIAA 1D6SA 1RC1A 1ZUNA 4LF9O 5FTJA 4LI0A 3VI4B 1F1BA 2GX6A 4DUZO 3GLGB 4KO2S 1OX5A 1GZ7A 3NHBA 2W6MA 3FLMA 3LY8A 4RL6A 1WR8A 2H7YA 1VB3A 2AC4A 1IN8A 1GUBA 1NV8A 3AR4A 2VTVA 3PDIA 5GANK 1DUSA 1B0ZA 3WL7A 2XKKA 1ZRSA 2XT6A 5KQRA 3ZX4A 1TUEB 3B9QA 4WCEV 3R7NA 3L1VA 4C22A 1DX9A 4L8GA 4D0RA 4NAHA 2UDPA 1LK7A 4LCBA 2PBRA 2AIRA 2X0DA 4AKIA 3I55F 3ZJVA 3EOBI 1WU7A 3U1TA 4X97A 2VSNA 5DH9A 1JLHA 3CG6A 3HEBA 3P45A 4MCIA 3CFYA 4KFTA 1TJ3A 1TOAA 3AEKB 4J43A 5LB2A 4LFAO 4HZUA 1JFFB 2I2BA 4PHTA 2J67A 1BQ0A 2F3TA 3C3MA 3DMTC 2IIBA 3P2EA 4P83A 2OCBA 3RIGA 4CKBB 1S3SA 3OLCX 5H5JA 2RGNA 4LVUA 1EK0A 1ZD2P 2HPHA 3GUVA 4B0PA 1PFKA 3FSEA 1D8AA 2RGBA 2ZYDA 2XE4A 4JLOA 1UDBA 2ILMA 4RDHA 1YAJA 5AD1A 2NW6A 3FVWA 3DBRB 4QDUA 3EMKA 1ZI9A 4YNBA 2VT2A 5AVVA 2QKAA 4W5RA 4K0KB 5BORA 4FC6A 2Z6UA 3MAAC 3SBOA 2CXHA 1W36C 2ZRLA 5DMXA 3C9TA 1N5OX 5JC8A 3NG1A 5TPWB 5IWAO 4AJ2A 4ZDWA 1G7SA 1DWPA 4TTPA 4P2BA 3VU1A 2Z95A 3L06A 1T0PA 2XPCA 2W48A 1ECCA 4IHAA 2QTBA 2QJWA 4H7IA 4JGGA 4QU9A 2XWBF 1K5SA 1LV7A 3LUBA 3R8XA 1HE2A 2RKWA 2HA7A 2XIJA 5H5NA 4QQ8A 4KQ1A 1REQB 4KN9S 1G8PA 2BGMA 4YJDA 3UKMA 2CDBA 2ABWA 2BM0A 4DGSA 2ID9A 3STZC 4D9MA 5HSGA 3DFMA 5L3BA 1OQAA 3OZIA 4MIYA 2Q5ZA 4MHOA 1I5XA 2HJGA 3CX8A 4IR7A 1KEVA 4TMKA 5E6RB 1L4MA 1E77A 2XSZD 1T91A 3LDUA 2KG7B 1YFJA 1L5MA 2C61A 4ZO7A 4MVOA 1NS1A 3IQDB 5DN6A 3TRKA 4LY6A 3NM4A 5KQGA 3F7MA 3RBZA 2ZR9A 1QR6A 3WVNA 1NP6A 4ZO8A 3K0KA 1XEFA 1LDEA 1C3OA 3MD9A 4FLYA 3AUYA 5F78A 4ZYLA 5IY5C 1N5IA 1UKYA 1RCUA 2NPFA 4PVCA 1L7AA 1M8PA 1FW8A 3K9AA 5LLDA 3CMEV 3R7LA 2X2PA 4LNUB 3IAUA 3VFDA 2REOA 2MHCA 4DKJA 1QQAA 1CNMA 2W2QA 1YXBA 5AMXA 1T2DA 3NJRA 1GCOA 2R00C 3L92A 3BAZA 3GGSA 1DTEA 3JWEA 4JP1A 1JFLA 3I9OA 4IUDS 4QSMA 5HXZA 4FM9A 4I6JA 3FAVA 3B3AA 5JALA 2CFOA 2FMUA 2FEXA 3ND9A 3AJAA 3O90A 3N5CA 4MVJA 4JZKA 1UR5A 2GZAA 2HU2A 5CB4F 3DMRA 3PC8A 4FR5A 2CFIA 3B70A 1CJVC 4LYJA 2XUDA 1Y8RB 1TQ2A