3F0FA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0fA00
3QHDA 2GZLA 3Q8HA 1IV1A 1H47A 1GX1A 3ELCA 3P0ZA 3F0DA 1KNKA 4C8IA 2UZHA 1IV4A 3IKFA 3F6MA 3FPIA 3F0GA 3IKEA 3K14A 3K2XA 5B8FA 4C8EA 3FBAA 2PMPA 4C81A 4C8GA 1H48A 3B6NA 3EORA 3IEQA 1JN1A 3P10A 3MBMA 1VHAA 1JY8A 1T0AA 1U43A 3JVHA 3F0FA 1VH8A 3ESJA 3T80A 2AMTA 1U3LA 1U40A 1IV3A 3RE3A 4C82A 1YQNA 3ERNA 1IV2A 1W55A 1KNJA 1U3PA 3KE1A 1W57A 3GHZA 3IEWA 3F0EA
chains in the Genus database with same CATH superfamily
5IT9M 2UYPA 3S03A 3D01A 1Q8RA 1VQ8F 1X52A 3CCUF 2IG8A 1CN7A 2HRUA 2Z01A 1RQ2A 3IKEA 4LCKA 1FNJA 4C8EA 1W5BA 3CYPB 3JASB 5JQGA 4X3LA 1XHOA 5LOVA 3B6NA 3VYSC 4EB6B 4G88A 4O2AA 5J2TA 3E20B 4O2BA 3HKBB 2GVIA 2BTUA 2LBWA 5JH7A 1X25A 5G4UC 4IHJA 2KTVA 3JALA 5HY1A 3HAXD 5EIBC 3FD6A 2CW4A 3S0YA 3CCVF 5EIBD 2CVLA 5GANK 3RYFB 2QTPA 2BO1A 5EWRA 5AVMA 2CHSA 3CYQA 3ZP4A 5IJ0B 5LOVB 3G71F 3FBAA 1CK2A 3TD4A 1W3EX 2HVYD 2V9YA 2OHWA 1VQ7F 1TVKA 3JAWB 5GONB 4LNUB 1JJ2F 4X1IA 2FGYA 3LWPC 3WJPA 1YQNA 1TUBA 2FC3A 4TV9A 2Z1FA 3NK7A 4BVTA 4G4VA 3D54A 1FFXA 4C8IA 5HP7A 1W40A 1YJNF 2ZODA 5LYJA 2ZF8A 4YJ3A 3RYIB 3S0HA 4IIJB 1Z5WA 3JAKB 4ZHVA 3CG6A 5J2UA 3V3TA 3MBMA 1Q86H 3QUWA 1FNKA 1M1KH 3WJQA 3HKCB 3JVHA 3GTZA 3KJJA 4X1YB 4BY9D 5KX5B 3C9TA 2IQQA 3FD5A 3N4YA 2OTLF 3CC2F 5EB0A 5CA1A 3S0WA 1JD1A 1FFXB 3LWRC 3VI6A 1VQ9F 3SIUA 3OW2F 1KNKA 2CSLA 3M1XA 3N2GB 1KQSF 3K2XA 2Z1TA 3G4SF 1Q7YH 3K12A 4BW0B 3S06A 3V4DA 3HKEA 2PHNA 4BT5A 3GYQA 3WGLA 4F6RA 1T0AA 2I6RA 4BT6A 2HS3A 2H8EA 2ZOVA 3FFMA 3JATB 1SDSA 4B62A 1K8AH 4KWEA 1W57A 5HP8A 2K1SA 1YIJF 1R1MA 5CB4A 3F0EA 3QTYA 5MN6A 2GZLA 1H47A 4XCQA 3JARB 4ZHWA 3E22A 1W41A 2VXYA 3WPWA 3TD3A 3JCMM 1COMA 3RYCA 3IEQA 5EZYA 3LMEA 1Q82H 3VTIC 1CLIA 4BVSA 1ODEA 3OBYA 2Q1XA 3VMFB 1VH8A 2VAMA 5HY2A 4B5CA 1QD9A 3ERNA 3I55F 3UT5A 1KC8H 2CWJA 3LYBA 3CCSF 4U3JA 1QVFF 1YGYA 3OONA 1YJ9F 4RHAA 4TUYA 5C8YB 3N2KB 2VGNA 5KMGA 3MCAB 3IKFA 2QI2A 3F6MA 3LWQC 3J80M 4FFBA 2HP0B 2UYKA 3RYHA 3WPXA 4HNAB 5LP6A 4G4ZA 5LP6C 4I4TA 4BT4A 1VQKF 2LBTA 4O4HB 1YHQF 2ZAUA 4R40B 2HQSC 5BMVB 5LA6B 2YXZA 5GINC 2BTOA 3P4EA 3Q8HA 4X3MA 5KMGB 3CPWF 1GX1A 1KD1H 3F0DA 3WGNA 1K73H 4FFBB 5ITZA 2UYNA 1QU9A 3MCQA 5JQGB 3CMAF 3ZOPA 1JFFA 3RYHB 3LDTA 5HY4A 5J2TB 4O2AB 3P10A 1X7OA 4O2BB 1RA4A 4BT7A 1W5AA 5JH7B 4ZHYB 3ESJA 2AMTA 1U3LA 3IR9A 4IHJB 3JALB 3I56F 3NMUC 1QAHA 1M90H 2MQEA 3E1YA 2H6LA 3HTNA 3LFOA 3HWUA 4I50A 5HXZA 2GLZA 4G4XA 4O4IA 5EYPA 1VQOF 4ZHQA 1NMUB 3N4ZA 4TV8A 3PAFA 2CZWA 4ZOLA 1TVKB 2H8CA 3CB2A 5JVDA 1DT9A 4X1IB 2RHOA 4E6EA 1TUBB 1UI9A 1RLGA 2KTUA 4B45A 4TV9B 4ERHA 3WGKA 2L26A 3ELCA 1YITF 2DT4A 3DDNA 3HKDA 3CD6F 4PWTA 4ZHQB 5LYJB 1W581 3VOBA 4YJ3B 3VYTC 4TV8B 5MN4A 5J2UB 2NMUA 5G4VC 3NVIB 2AIZP 5GIOC 1ZWZA 5FNVA 4NWOB 2HX0A 3U0OA 3T80A 3LWOC 5CA0A 5LXTA 5GAPK 1DBFA 1W59A 4X20A 4DRXA 3KHNA 1GO1A 4M8IA 5CA1B 3J7AR 1RLUA 4X1KA 3PLAC 3CCQF 3VCZA 1YJWF 3F0GA 3C8LA 2G9IA 4EI8A 3CCEF 3HKEB 2PMPA 1SA0A 1H48A 2YYEA 4F6RB 5FNVB 4BT2A 2WALA 3KJKA 4WBNA 1JY8A 5CA0B 5MN5A 2ZVYA 4RQOA 1XBIA 4O4JA 4YJ2A 4DXDA 2RHLA 5CB4B 2QEXF 5IJ9A 5GIPC 4ZI7A 1W42A 3E22B 2KG4A 3D00A 5JCOA 5EO3A 3CCLF 5JCOC 1X7PA 3RA6A 2UZHA 1XRGA 1W2BF 3RYCB 3JASA 5EZYB 4O4LA 3EORA 4C4WC 4BT3A 2DYYA 2QA4F 4EB6A 3CCRF 3NVKE 2VAPA 1Z5VA 3VO8A 3M84A 4EI9A 3HKBA 4I55A 5IYZA 3CCMF 3RE3A 4C82A 2KGWA 1VQ5F 4NQ3A 1T0KB 3UT5B 5IJ9B 4ZI7B 1VQMF 4BVRA 4U3JB 2Z1UA 4TUYB 1N8RH 2VGMA 2R6R1 3RYFA 1RQ7A 3VIUA 1QVGF 3CC4F 4O4LB 5IJ0A 4G4WA 1W5EA 2F9ZC 3O85A 1FSZA 2CHTA 1VQ6F 3JAMM 5LP6B 4I4TB 3RA5A 1GZ0A 4I55B 5IYZB 2N48A 1U43A 3JAWA 5GONA 5HXUA 1IV3A 4LNUA 3ON1A 1IV2A 5FJ4C 1U3PA 1Q81H 2AIFA 2OZBA 3QHDA 1IV1A 3C9RA 1W5FA 5ITZB 2UYNB 1OFUA 5DCVA 5EB1B 2LCAA 1UFYA 1JFFB 4C8GA 2I6DA 3I3FA 3RYIA 4IIJA 3JAKA 1JN1A 1VQNF 3V7EA 2ZVZA 3HKCA 1VK3A 3F0FA 1NQ3A 3S02A 3M4SA 5A2QM 2VAWA 1YI2F 2HS4A 3CC7F 4X1YA 3KIZA 5KX5A 3MDOA 2RHHA 3AGKA 4NUTA 3OBWA 1VQLF 3SIVA 3C9UA 3C9SA 4I50B 4O4IB 1ONIA 2UYJA 5EYPB 1K9MH 3K14A 2HRYA 1PXWA 3N2GA 4B46A 2ALEA 1SZQA 2RB9A 3V7QA 4ZOLB 2HP3A 5JVDB 3TD5A 2LBXA 3LWVC 3CXCF 3CMEF 3BYQA 2Z1EA 3JATA 1OAPA 1J7HA 5HWEA 1PF5A 3CCJF 3HJWC 2RHJA 3HKDB 3JARA 3ZO8A 4G4YA 3VOAA 1VQVA 2R751 5FLXM 3DC2A 4EI7A 1VHAA 1S72F 2W8BC 2OTJF 5LXTB 3K0TA 3L7QA 3WGJA 1VQPF 5EAZA 1U40A 1NJIH 4X20B 4DRXB 3VYUC 3WJRA 1KNJA 2B33A 3WXMB 3WGMA 3GHZA 2Q1YA 4X1KB 3P0ZA 3R0PA 3CPQA 2IAFA 1IV4A 5C8YA 3N2KA 3J81M 3FPIA 5B8FA 1E7KA 1VQ4F 1SA0B 4C81A 2HP0A 3G6EF 1GO0A 3NK6A 4WBNB 4HNAA 2OTMA 2EWCA 4U39A 1XV2A 1H7MA 2JNBA 4O4JB 4YJ2B 4O4HA 5HY0A 2BTQB 5BMVA 1W55A 2HS0A 2P6YA 3IMPA 5LA6A 3KE1A 3ZP7A 4ZK7A 3IEWA 3I7TA 1IPAA 4TZZA 3MQWA 4BVQA
chains in the Genus database with same CATH topology
3QHDA 2GZLA 3Q8HA 1IV1A 1H47A 1GX1A 3ELCA 3P0ZA 3F0DA 1KNKA 4C8IA 2UZHA 1IV4A 3IKFA 3F6MA 3FPIA 3F0GA 3IKEA 3K14A 3K2XA 5B8FA 4C8EA 3FBAA 2PMPA 4C81A 4C8GA 1H48A 3B6NA 3EORA 3IEQA 1JN1A 3P10A 3MBMA 1VHAA 1JY8A 1T0AA 1U43A 3JVHA 3F0FA 1VH8A 3ESJA 3T80A 2AMTA 1U3LA 1U40A 1IV3A 3RE3A 4C82A 1YQNA 3ERNA 1IV2A 1W55A 1KNJA 1U3PA 3KE1A 1W57A 3GHZA 3IEWA 3F0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHD A;  2GZL A;  3Q8H A;  1IV1 A;  1H47 A;  1GX1 A;  3ELC A;  3P0Z A;  3F0D A;  1KNK A;  4C8I A;  2UZH A;  1IV4 A;  3IKF A;  3F6M A;  3FPI A;  3F0G A;  3IKE A;  3K14 A;  3K2X A;  5B8F A;  4C8E A;  3FBA A;  2PMP A;  4C81 A;  4C8G A;  1H48 A;  3B6N A;  3EOR A;  3IEQ A;  1JN1 A;  3P10 A;  3MBM A;  1VHA A;  1JY8 A;  1T0A A;  1U43 A;  3JVH A;  3F0F A;  1VH8 A;  3ESJ A;  3T80 A;  2AMT A;  1U3L A;  1U40 A;  1IV3 A;  3RE3 A;  4C82 A;  1YQN A;  3ERN A;  1IV2 A;  1W55 A;  1KNJ A;  1U3P A;  3KE1 A;  1W57 A;  3GHZ A;  3IEW A;  3F0E A; 
#chains in the Genus database with same CATH topology
 5IT9 M;  2UYP A;  3S03 A;  3D01 A;  1Q8R A;  1VQ8 F;  1X52 A;  3CCU F;  2IG8 A;  1CN7 A;  2HRU A;  2Z01 A;  1RQ2 A;  3IKE A;  4LCK A;  1FNJ A;  4C8E A;  1W5B A;  3CYP B;  3JAS B;  5JQG A;  4X3L A;  1XHO A;  5LOV A;  3B6N A;  3VYS C;  4EB6 B;  4G88 A;  4O2A A;  5J2T A;  3E20 B;  4O2B A;  3HKB B;  2GVI A;  2BTU A;  2LBW A;  5JH7 A;  1X25 A;  5G4U C;  4IHJ A;  2KTV A;  3JAL A;  5HY1 A;  3HAX D;  5EIB C;  3FD6 A;  2CW4 A;  3S0Y A;  3CCV F;  5EIB D;  2CVL A;  5GAN K;  3RYF B;  2QTP A;  2BO1 A;  5EWR A;  5AVM A;  2CHS A;  3CYQ A;  3ZP4 A;  5IJ0 B;  5LOV B;  3G71 F;  3FBA A;  1CK2 A;  3TD4 A;  1W3E X;  2HVY D;  2V9Y A;  2OHW A;  1VQ7 F;  1TVK A;  3JAW B;  5GON B;  4LNU B;  1JJ2 F;  4X1I A;  2FGY A;  3LWP C;  3WJP A;  1YQN A;  1TUB A;  2FC3 A;  4TV9 A;  2Z1F A;  3NK7 A;  4BVT A;  4G4V A;  3D54 A;  1FFX A;  4C8I A;  5HP7 A;  1W40 A;  1YJN F;  2ZOD A;  5LYJ A;  2ZF8 A;  4YJ3 A;  3RYI B;  3S0H A;  4IIJ B;  1Z5W A;  3JAK B;  4ZHV A;  3CG6 A;  5J2U A;  3V3T A;  3MBM A;  1Q86 H;  3QUW A;  1FNK A;  1M1K H;  3WJQ A;  3HKC B;  3JVH A;  3GTZ A;  3KJJ A;  4X1Y B;  4BY9 D;  5KX5 B;  3C9T A;  2IQQ A;  3FD5 A;  3N4Y A;  2OTL F;  3CC2 F;  5EB0 A;  5CA1 A;  3S0W A;  1JD1 A;  1FFX B;  3LWR C;  3VI6 A;  1VQ9 F;  3SIU A;  3OW2 F;  1KNK A;  2CSL A;  3M1X A;  3N2G B;  1KQS F;  3K2X A;  2Z1T A;  3G4S F;  1Q7Y H;  3K12 A;  4BW0 B;  3S06 A;  3V4D A;  3HKE A;  2PHN A;  4BT5 A;  3GYQ A;  3WGL A;  4F6R A;  1T0A A;  2I6R A;  4BT6 A;  2HS3 A;  2H8E A;  2ZOV A;  3FFM A;  3JAT B;  1SDS A;  4B62 A;  1K8A H;  4KWE A;  1W57 A;  5HP8 A;  2K1S A;  1YIJ F;  1R1M A;  5CB4 A;  3F0E A;  3QTY A;  5MN6 A;  2GZL A;  1H47 A;  4XCQ A;  3JAR B;  4ZHW A;  3E22 A;  1W41 A;  2VXY A;  3WPW A;  3TD3 A;  3JCM M;  1COM A;  3RYC A;  3IEQ A;  5EZY A;  3LME A;  1Q82 H;  3VTI C;  1CLI A;  4BVS A;  1ODE A;  3OBY A;  2Q1X A;  3VMF B;  1VH8 A;  2VAM A;  5HY2 A;  4B5C A;  1QD9 A;  3ERN A;  3I55 F;  3UT5 A;  1KC8 H;  2CWJ A;  3LYB A;  3CCS F;  4U3J A;  1QVF F;  1YGY A;  3OON A;  1YJ9 F;  4RHA A;  4TUY A;  5C8Y B;  3N2K B;  2VGN A;  5KMG A;  3MCA B;  3IKF A;  2QI2 A;  3F6M A;  3LWQ C;  3J80 M;  4FFB A;  2HP0 B;  2UYK A;  3RYH A;  3WPX A;  4HNA B;  5LP6 A;  4G4Z A;  5LP6 C;  4I4T A;  4BT4 A;  1VQK F;  2LBT A;  4O4H B;  1YHQ F;  2ZAU A;  4R40 B;  2HQS C;  5BMV B;  5LA6 B;  2YXZ A;  5GIN C;  2BTO A;  3P4E A;  3Q8H A;  4X3M A;  5KMG B;  3CPW F;  1GX1 A;  1KD1 H;  3F0D A;  3WGN A;  1K73 H;  4FFB B;  5ITZ A;  2UYN A;  1QU9 A;  3MCQ A;  5JQG B;  3CMA F;  3ZOP A;  1JFF A;  3RYH B;  3LDT A;  5HY4 A;  5J2T B;  4O2A B;  3P10 A;  1X7O A;  4O2B B;  1RA4 A;  4BT7 A;  1W5A A;  5JH7 B;  4ZHY B;  3ESJ A;  2AMT A;  1U3L A;  3IR9 A;  4IHJ B;  3JAL B;  3I56 F;  3NMU C;  1QAH A;  1M90 H;  2MQE A;  3E1Y A;  2H6L A;  3HTN A;  3LFO A;  3HWU A;  4I50 A;  5HXZ A;  2GLZ A;  4G4X A;  4O4I A;  5EYP A;  1VQO F;  4ZHQ A;  1NMU B;  3N4Z A;  4TV8 A;  3PAF A;  2CZW A;  4ZOL A;  1TVK B;  2H8C A;  3CB2 A;  5JVD A;  1DT9 A;  4X1I B;  2RHO A;  4E6E A;  1TUB B;  1UI9 A;  1RLG A;  2KTU A;  4B45 A;  4TV9 B;  4ERH A;  3WGK A;  2L26 A;  3ELC A;  1YIT F;  2DT4 A;  3DDN A;  3HKD A;  3CD6 F;  4PWT A;  4ZHQ B;  5LYJ B;  1W58 1;  3VOB A;  4YJ3 B;  3VYT C;  4TV8 B;  5MN4 A;  5J2U B;  2NMU A;  5G4V C;  3NVI B;  2AIZ P;  5GIO C;  1ZWZ A;  5FNV A;  4NWO B;  2HX0 A;  3U0O A;  3T80 A;  3LWO C;  5CA0 A;  5LXT A;  5GAP K;  1DBF A;  1W59 A;  4X20 A;  4DRX A;  3KHN A;  1GO1 A;  4M8I A;  5CA1 B;  3J7A R;  1RLU A;  4X1K A;  3PLA C;  3CCQ F;  3VCZ A;  1YJW F;  3F0G A;  3C8L A;  2G9I A;  4EI8 A;  3CCE F;  3HKE B;  2PMP A;  1SA0 A;  1H48 A;  2YYE A;  4F6R B;  5FNV B;  4BT2 A;  2WAL A;  3KJK A;  4WBN A;  1JY8 A;  5CA0 B;  5MN5 A;  2ZVY A;  4RQO A;  1XBI A;  4O4J A;  4YJ2 A;  4DXD A;  2RHL A;  5CB4 B;  2QEX F;  5IJ9 A;  5GIP C;  4ZI7 A;  1W42 A;  3E22 B;  2KG4 A;  3D00 A;  5JCO A;  5EO3 A;  3CCL F;  5JCO C;  1X7P A;  3RA6 A;  2UZH A;  1XRG A;  1W2B F;  3RYC B;  3JAS A;  5EZY B;  4O4L A;  3EOR A;  4C4W C;  4BT3 A;  2DYY A;  2QA4 F;  4EB6 A;  3CCR F;  3NVK E;  2VAP A;  1Z5V A;  3VO8 A;  3M84 A;  4EI9 A;  3HKB A;  4I55 A;  5IYZ A;  3CCM F;  3RE3 A;  4C82 A;  2KGW A;  1VQ5 F;  4NQ3 A;  1T0K B;  3UT5 B;  5IJ9 B;  4ZI7 B;  1VQM F;  4BVR A;  4U3J B;  2Z1U A;  4TUY B;  1N8R H;  2VGM A;  2R6R 1;  3RYF A;  1RQ7 A;  3VIU A;  1QVG F;  3CC4 F;  4O4L B;  5IJ0 A;  4G4W A;  1W5E A;  2F9Z C;  3O85 A;  1FSZ A;  2CHT A;  1VQ6 F;  3JAM M;  5LP6 B;  4I4T B;  3RA5 A;  1GZ0 A;  4I55 B;  5IYZ B;  2N48 A;  1U43 A;  3JAW A;  5GON A;  5HXU A;  1IV3 A;  4LNU A;  3ON1 A;  1IV2 A;  5FJ4 C;  1U3P A;  1Q81 H;  2AIF A;  2OZB A;  3QHD A;  1IV1 A;  3C9R A;  1W5F A;  5ITZ B;  2UYN B;  1OFU A;  5DCV A;  5EB1 B;  2LCA A;  1UFY A;  1JFF B;  4C8G A;  2I6D A;  3I3F A;  3RYI A;  4IIJ A;  3JAK A;  1JN1 A;  1VQN F;  3V7E A;  2ZVZ A;  3HKC A;  1VK3 A;  3F0F A;  1NQ3 A;  3S02 A;  3M4S A;  5A2Q M;  2VAW A;  1YI2 F;  2HS4 A;  3CC7 F;  4X1Y A;  3KIZ A;  5KX5 A;  3MDO A;  2RHH A;  3AGK A;  4NUT A;  3OBW A;  1VQL F;  3SIV A;  3C9U A;  3C9S A;  4I50 B;  4O4I B;  1ONI A;  2UYJ A;  5EYP B;  1K9M H;  3K14 A;  2HRY A;  1PXW A;  3N2G A;  4B46 A;  2ALE A;  1SZQ A;  2RB9 A;  3V7Q A;  4ZOL B;  2HP3 A;  5JVD B;  3TD5 A;  2LBX A;  3LWV C;  3CXC F;  3CME F;  3BYQ A;  2Z1E A;  3JAT A;  1OAP A;  1J7H A;  5HWE A;  1PF5 A;  3CCJ F;  3HJW C;  2RHJ A;  3HKD B;  3JAR A;  3ZO8 A;  4G4Y A;  3VOA A;  1VQV A;  2R75 1;  5FLX M;  3DC2 A;  4EI7 A;  1VHA A;  1S72 F;  2W8B C;  2OTJ F;  5LXT B;  3K0T A;  3L7Q A;  3WGJ A;  1VQP F;  5EAZ A;  1U40 A;  1NJI H;  4X20 B;  4DRX B;  3VYU C;  3WJR A;  1KNJ A;  2B33 A;  3WXM B;  3WGM A;  3GHZ A;  2Q1Y A;  4X1K B;  3P0Z A;  3R0P A;  3CPQ A;  2IAF A;  1IV4 A;  5C8Y A;  3N2K A;  3J81 M;  3FPI A;  5B8F A;  1E7K A;  1VQ4 F;  1SA0 B;  4C81 A;  2HP0 A;  3G6E F;  1GO0 A;  3NK6 A;  4WBN B;  4HNA A;  2OTM A;  2EWC A;  4U39 A;  1XV2 A;  1H7M A;  2JNB A;  4O4J B;  4YJ2 B;  4O4H A;  5HY0 A;  2BTQ B;  5BMV A;  1W55 A;  2HS0 A;  2P6Y A;  3IMP A;  5LA6 A;  3KE1 A;  3ZP7 A;  4ZK7 A;  3IEW A;  3I7T A;  1IPA A;  4TZZ A;  3MQW A;  4BVQ A; 
#chains in the Genus database with same CATH homology
 3QHD A;  2GZL A;  3Q8H A;  1IV1 A;  1H47 A;  1GX1 A;  3ELC A;  3P0Z A;  3F0D A;  1KNK A;  4C8I A;  2UZH A;  1IV4 A;  3IKF A;  3F6M A;  3FPI A;  3F0G A;  3IKE A;  3K14 A;  3K2X A;  5B8F A;  4C8E A;  3FBA A;  2PMP A;  4C81 A;  4C8G A;  1H48 A;  3B6N A;  3EOR A;  3IEQ A;  1JN1 A;  3P10 A;  3MBM A;  1VHA A;  1JY8 A;  1T0A A;  1U43 A;  3JVH A;  3F0F A;  1VH8 A;  3ESJ A;  3T80 A;  2AMT A;  1U3L A;  1U40 A;  1IV3 A;  3RE3 A;  4C82 A;  1YQN A;  3ERN A;  1IV2 A;  1W55 A;  1KNJ A;  1U3P A;  3KE1 A;  1W57 A;  3GHZ A;  3IEW A;  3F0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...