3F0FA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0fA00
1H47A 4C81A 1YQNA 1JY8A 3B6NA 1T0AA 3MBMA 1KNKA 2UZHA 1KNJA 3IEWA 4C82A 1VHAA 2PMPA 5B8FA 1IV1A 1U43A 3F0FA 1JN1A 4C8GA 4C8EA 3JVHA 1U40A 3K14A 3Q8HA 1W57A 3KE1A 1H48A 1U3LA 3F0GA 3F6MA 3IEQA 3ESJA 3ERNA 3IKFA 3QHDA 1IV2A 1U3PA 3FPIA 1IV4A 3ELCA 1GX1A 2AMTA 3F0DA 3FBAA 3IKEA 3F0EA 3P0ZA 1VH8A 4C8IA 3GHZA 3P10A 2GZLA 3EORA 3RE3A 1W55A 3K2XA 1IV3A 3T80A
chains in the Genus database with same CATH superfamily
2HRYA 1XV2A 3C9SA 5GIOC 3G4SF 2HVYD 1QU9A 1J7HA 1XHOA 1DBFA 5LA6A 2LBTA 4I4TA 4ZK7A 5GONB 3RYIA 3WGNA 4RHAA 1ONIA 3OW2F 3FPIA 2Z1UA 5HWEA 4TZZA 1VQPF 1GX1A 5EZYA 1NJIH 1KD1H 3IR9A 5EYPB 1VQ5F 1TUBB 2BTQB 2BTUA 3JAWA 4X3MA 4F6RB 3VTIC 1W40A 3M84A 1NMUB 4X20B 2B33A 1M90H 1S72F 3I55F 4HNAA 3WGLA 4YJ2B 4ZHQB 4TUYA 4BVTA 1OFUA 1VQKF 3RYFA 5HXZA 1FNKA 3J7AR 3CPQA 1FFXA 2QTPA 3VCZA 3C8LA 5FNVA 1W5EA 4C8IA 2HS4A 3TD3A 5JCOC 3G71F 1X7OA 3FFMA 1XBIA 4O4IA 1N8RH 1KNKA 4B46A 4O4HA 3ZOPA 3HKDB 4LCKA 2ALEA 2CSLA 1VQMF 2ZOVA 4X1IA 4EI8A 2VXYA 5CA1A 3NMUC 4X3LA 3CMEF 5LYJB 3JASB 1QAHA 3IEQA 1M1KH 5KMGA 4NUTA 2HS0A 1QVFF 4O2BB 3E22B 2CVLA 3CCEF 1FNJA 4YJ3B 3HKCA 3HKEA 1H47A 4ZI7A 4C4WC 2UZHA 5GINC 3IEWA 5KX5A 4O4JB 3M1XA 4BY9D 4G4YA 3RYCB 4ZOLB 3M4SA 3VYSC 1NQ3A 5HY0A 3LMEA 1FSZA 3ESJA 3CCLF 3J80M 3PAFA 3CC4F 3V7QA 1RLUA 4U3JA 1W55A 5ITZA 2HS3A 5J2TA 3MCQA 4X1YB 4TV8A 5BMVB 5CB4B 1T0AA 4LNUA 2UYKA 3R0PA 3KIZA 4I50A 2R751 3F0FA 3MQWA 1TVKB 1XRGA 5CA0B 3JVHA 5HXUA 5LXTB 3JALA 3AGKA 4FFBA 1U3LA 3IKFA 4G4ZA 2FC3A 1KQSF 3S03A 2AMTA 2EWCA 1SA0A 4TV9A 3IKEA 1PF5A 3KJJA 5EZYB 2KTVA 4BT5A 2GVIA 1CN7A 3ON1A 4B45A 3JATA 4C81A 4IIJA 1VK3A 3N4ZA 2BTOA 3K0TA 5HP8A 2UYNB 4E6EA 4O4LA 5LP6A 1VQLF 1VHAA 4IHJB 5IJ9B 1U43A 1QD9A 2JNBA 4C8EA 1KC8H 1PXWA 5JVDA 3JAKB 4RQOA 5FJ4C 3CC2F 4TUYB 3NVKE 3WGKA 4ERHA 1ZWZA 3PLAC 3F0DA 3CD6F 4ZHYB 3U0OA 2AIFA 5MN5A 2WALA 2ZVZA 3HTNA 4X1KB 4DRXA 3RYHA 2KGWA 5JH7A 3WGJA 2G9IA 5J2UB 4WBNB 3GYQA 3HKBA 3CYPB 1W59A 3JARA 4I55B 1E7KA 3RA5A 5EO3A 2LBWA 3N2KA 2RB9A 2HQSC 1X7PA 1W41A 3HJWC 1JFFB 3JAMM 5KMGB 2PHNA 3C9TA 2QEXF 4G4WA 2YYEA 5IJ0B 3WJRA 2KG4A 3P0ZA 5JQGB 2Q1YA 2OTLF 1UI9A 3MBMA 4EB6B 3HWUA 5GAPK 4G4VA 2RHOA 1JN1A 2R6R1 2HRUA 4EI7A 4ZHVA 2CW4A 3NK6A 3MDOA 5EYPA 2LBXA 1QVGF 1TUBA 5EB1B 3QUWA 5EIBD 2DYYA 4F6RA 5IYZB 3VIUA 3D54A 4BT4A 3JCMM 1K9MH 3RE3A 4X20A 2Q1XA 3OBYA 1VQVA 3V7EA 3OONA 2PMPA 2Z01A 4ZHQA 4YJ2A 1IPAA 3UT5B 3N4YA 3VOBA 3C9RA 2H6LA 3O85A 3WGMA 5C8YB 3F6MA 2HP0B 2CWJA 3V3TA 1IV2A 3FD6A 1CK2A 1X25A 4ZHWA 3N2GB 3FBAA 3GTZA 1CLIA 2OTMA 2CZWA 3CCVF 1YJ9F 4XCQA 5EIBC 5MN4A 3HKDA 5LOVA 3S0YA 4BW0B 3CC7F 4R40B 5MN6A 3WPWA 2QI2A 5LYJA 2ZF8A 1RQ2A 3S0HA 1W57A 3ZP4A 1VQ9F 5LA6B 3CXCF 4I4TB 2F9ZC 4BT2A 4O2BA 2ZAUA 3RYIB 3LWVC 1VQ7F 3E22A 2L26A 1GO0A 2H8CA 4BVRA 4YJ3A 3OBWA 3LFOA 3DC2A 5HY2A 3CPWF 3LWRC 1VH8A 2W8BC 2HP3A 1Q86H 3KJKA 1GO1A 2VAMA 2FGYA 3JAWB 2RHLA 3TD4A 4C82A 4O4JA 3VMFB 3RYCA 2Z1EA 3VYUC 1YHQF 4ZOLA 2MQEA 2RHHA 3IMPA 5JCOA 3CB2A 3CCJF 1Q82H 1W3EX 5EAZA 3E20B 1JD1A 2VGNA 3S0WA 2VAWA 4BT7A 3KE1A 4HNAB 5DCVA 3LDTA 3RYFB 1UFYA 4B5CA 1YITF 3TD5A 3WPXA 1JJ2F 3BYQA 3F0EA 1K8AH 1FFXB 2GZLA 3EORA 4X1YA 5BMVA 5CB4A 3CCSF 5FNVB 1R1MA 2V9YA 2OTJF 4KWEA 1YQNA 2HX0A 5IT9M 2ZODA 1TVKA 4O4IB 5CA0A 1RLGA 5LXTA 2IG8A 4O4HB 4C8GA 1VQOF 5HY1A 5AVMA 1Q8RA 3FD5A 3ZP7A 4BVQA 4X1IB 2VAPA 5CA1B 3MCAB 3I56F 2CHTA 4PWTA 1IV4A 5HY4A 3D01A 4O2AA 2RHJA 1H7MA 4B62A 3SIUA 2ZVYA 1K73H 1RA4A 3CCUF 5EWRA 5GANK 2IAFA 2UYNA 1T0KB 3HKCB 4IHJA 5IJ9A 1JY8A 3HKEB 2UYPA 1YIJF 2P6YA 4ZI7B 4NQ3A 2Z1TA 3WJQA 1W581 3D00A 3JAKA 3KHNA 3RA6A 5GONA 5FLXM 2GLZA 5KX5B 3LWPC 1ODEA 1U40A 2CHSA 3Q8HA 2H8EA 4G4XA 2YXZA 1W5FA 4X1KA 1VQ8F 1YI2F 2OZBA 1X52A 2I6RA 2BO1A 5LP6C 3P10A 3S06A 5G4VC 4WBNA 5J2UA 5G4UC 3K2XA 3T80A 3V4DA 4U3JB 3B6NA 4I55A 3SIVA 3VYTC 3C9UA 4NWOB 5ITZB 5LOVB 5J2TB 3CCRF 5B8FA 4TV8B 1IV1A 4LNUB 2VGMA 3E1YA 2DT4A 4EI9A 1DT9A 4I50B 2AIZP 1JFFA 2N48A 4G88A 3QHDA 1COMA 1VQ4F 5IJ0A 3JALB 4FFBB 1W5BA 4BT6A 2UYJA 3ELCA 1Q81H 5JQGA 1YJNF 2KTUA 4TV9B 1SA0B 4EB6A 1OAPA 3CG6A 3I3FA 3QTYA 3WJPA 3LWQC 1RQ7A 2OHWA 3JATB 3I7TA 1YGYA 2NMUA 4IIJB 3ZO8A 1Q7YH 5A2QM 3NVIB 4O4LB 4BT3A 5LP6B 3CCQF 3JASA 1YJWF 1VQ6F 1VQNF 3K12A 1SZQA 3F0GA 2K1SA 5JVDB 1Z5VA 1U3PA 3L7QA 5IYZA 4M8IA 3LWOC 2LCAA 3CCMF 3GHZA 3S02A 4U39A 1IV3A 4BVSA 1SDSA 3G6EF 3CMAF 3WXMB 4DRXB 3RYHB 3UT5A 1KNJA 5JH7B 3LYBA 1Z5WA 3HKBB 5EB0A 5C8YA 3CYQA 2HP0A 3K14A 3JARB 3P4EA 2I6DA 3VO8A 1H48A 2IQQA 1W42A 1GZ0A 3ERNA 3N2KB 5GIPC 1W5AA 2QA4F 1W2BF 3VOAA 4DXDA 3N2GA 5HP7A 3DDNA 4O2AB 3J81M 3NK7A 2Z1FA 3HAXD 3VI6A
chains in the Genus database with same CATH topology
1H47A 4C81A 1YQNA 1JY8A 3B6NA 1T0AA 3MBMA 1KNKA 2UZHA 1KNJA 3IEWA 4C82A 1VHAA 2PMPA 5B8FA 1IV1A 1U43A 3F0FA 1JN1A 4C8GA 4C8EA 3JVHA 1U40A 3K14A 3Q8HA 1W57A 3KE1A 1H48A 1U3LA 3F0GA 3F6MA 3IEQA 3ESJA 3ERNA 3IKFA 3QHDA 1IV2A 1U3PA 3FPIA 1IV4A 3ELCA 1GX1A 2AMTA 3F0DA 3FBAA 3IKEA 3F0EA 3P0ZA 1VH8A 4C8IA 3GHZA 3P10A 2GZLA 3EORA 3RE3A 1W55A 3K2XA 1IV3A 3T80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H47 A;  4C81 A;  1YQN A;  1JY8 A;  3B6N A;  1T0A A;  3MBM A;  1KNK A;  2UZH A;  1KNJ A;  3IEW A;  4C82 A;  1VHA A;  2PMP A;  5B8F A;  1IV1 A;  1U43 A;  3F0F A;  1JN1 A;  4C8G A;  4C8E A;  3JVH A;  1U40 A;  3K14 A;  3Q8H A;  1W57 A;  3KE1 A;  1H48 A;  1U3L A;  3F0G A;  3F6M A;  3IEQ A;  3ESJ A;  3ERN A;  3IKF A;  3QHD A;  1IV2 A;  1U3P A;  3FPI A;  1IV4 A;  3ELC A;  1GX1 A;  2AMT A;  3F0D A;  3FBA A;  3IKE A;  3F0E A;  3P0Z A;  1VH8 A;  4C8I A;  3GHZ A;  3P10 A;  2GZL A;  3EOR A;  3RE3 A;  1W55 A;  3K2X A;  1IV3 A;  3T80 A; 
#chains in the Genus database with same CATH topology
 2HRY A;  1XV2 A;  3C9S A;  5GIO C;  3G4S F;  2HVY D;  1QU9 A;  1J7H A;  1XHO A;  1DBF A;  5LA6 A;  2LBT A;  4I4T A;  4ZK7 A;  5GON B;  3RYI A;  3WGN A;  4RHA A;  1ONI A;  3OW2 F;  3FPI A;  2Z1U A;  5HWE A;  4TZZ A;  1VQP F;  1GX1 A;  5EZY A;  1NJI H;  1KD1 H;  3IR9 A;  5EYP B;  1VQ5 F;  1TUB B;  2BTQ B;  2BTU A;  3JAW A;  4X3M A;  4F6R B;  3VTI C;  1W40 A;  3M84 A;  1NMU B;  4X20 B;  2B33 A;  1M90 H;  1S72 F;  3I55 F;  4HNA A;  3WGL A;  4YJ2 B;  4ZHQ B;  4TUY A;  4BVT A;  1OFU A;  1VQK F;  3RYF A;  5HXZ A;  1FNK A;  3J7A R;  3CPQ A;  1FFX A;  2QTP A;  3VCZ A;  3C8L A;  5FNV A;  1W5E A;  4C8I A;  2HS4 A;  3TD3 A;  5JCO C;  3G71 F;  1X7O A;  3FFM A;  1XBI A;  4O4I A;  1N8R H;  1KNK A;  4B46 A;  4O4H A;  3ZOP A;  3HKD B;  4LCK A;  2ALE A;  2CSL A;  1VQM F;  2ZOV A;  4X1I A;  4EI8 A;  2VXY A;  5CA1 A;  3NMU C;  4X3L A;  3CME F;  5LYJ B;  3JAS B;  1QAH A;  3IEQ A;  1M1K H;  5KMG A;  4NUT A;  2HS0 A;  1QVF F;  4O2B B;  3E22 B;  2CVL A;  3CCE F;  1FNJ A;  4YJ3 B;  3HKC A;  3HKE A;  1H47 A;  4ZI7 A;  4C4W C;  2UZH A;  5GIN C;  3IEW A;  5KX5 A;  4O4J B;  3M1X A;  4BY9 D;  4G4Y A;  3RYC B;  4ZOL B;  3M4S A;  3VYS C;  1NQ3 A;  5HY0 A;  3LME A;  1FSZ A;  3ESJ A;  3CCL F;  3J80 M;  3PAF A;  3CC4 F;  3V7Q A;  1RLU A;  4U3J A;  1W55 A;  5ITZ A;  2HS3 A;  5J2T A;  3MCQ A;  4X1Y B;  4TV8 A;  5BMV B;  5CB4 B;  1T0A A;  4LNU A;  2UYK A;  3R0P A;  3KIZ A;  4I50 A;  2R75 1;  3F0F A;  3MQW A;  1TVK B;  1XRG A;  5CA0 B;  3JVH A;  5HXU A;  5LXT B;  3JAL A;  3AGK A;  4FFB A;  1U3L A;  3IKF A;  4G4Z A;  2FC3 A;  1KQS F;  3S03 A;  2AMT A;  2EWC A;  1SA0 A;  4TV9 A;  3IKE A;  1PF5 A;  3KJJ A;  5EZY B;  2KTV A;  4BT5 A;  2GVI A;  1CN7 A;  3ON1 A;  4B45 A;  3JAT A;  4C81 A;  4IIJ A;  1VK3 A;  3N4Z A;  2BTO A;  3K0T A;  5HP8 A;  2UYN B;  4E6E A;  4O4L A;  5LP6 A;  1VQL F;  1VHA A;  4IHJ B;  5IJ9 B;  1U43 A;  1QD9 A;  2JNB A;  4C8E A;  1KC8 H;  1PXW A;  5JVD A;  3JAK B;  4RQO A;  5FJ4 C;  3CC2 F;  4TUY B;  3NVK E;  3WGK A;  4ERH A;  1ZWZ A;  3PLA C;  3F0D A;  3CD6 F;  4ZHY B;  3U0O A;  2AIF A;  5MN5 A;  2WAL A;  2ZVZ A;  3HTN A;  4X1K B;  4DRX A;  3RYH A;  2KGW A;  5JH7 A;  3WGJ A;  2G9I A;  5J2U B;  4WBN B;  3GYQ A;  3HKB A;  3CYP B;  1W59 A;  3JAR A;  4I55 B;  1E7K A;  3RA5 A;  5EO3 A;  2LBW A;  3N2K A;  2RB9 A;  2HQS C;  1X7P A;  1W41 A;  3HJW C;  1JFF B;  3JAM M;  5KMG B;  2PHN A;  3C9T A;  2QEX F;  4G4W A;  2YYE A;  5IJ0 B;  3WJR A;  2KG4 A;  3P0Z A;  5JQG B;  2Q1Y A;  2OTL F;  1UI9 A;  3MBM A;  4EB6 B;  3HWU A;  5GAP K;  4G4V A;  2RHO A;  1JN1 A;  2R6R 1;  2HRU A;  4EI7 A;  4ZHV A;  2CW4 A;  3NK6 A;  3MDO A;  5EYP A;  2LBX A;  1QVG F;  1TUB A;  5EB1 B;  3QUW A;  5EIB D;  2DYY A;  4F6R A;  5IYZ B;  3VIU A;  3D54 A;  4BT4 A;  3JCM M;  1K9M H;  3RE3 A;  4X20 A;  2Q1X A;  3OBY A;  1VQV A;  3V7E A;  3OON A;  2PMP A;  2Z01 A;  4ZHQ A;  4YJ2 A;  1IPA A;  3UT5 B;  3N4Y A;  3VOB A;  3C9R A;  2H6L A;  3O85 A;  3WGM A;  5C8Y B;  3F6M A;  2HP0 B;  2CWJ A;  3V3T A;  1IV2 A;  3FD6 A;  1CK2 A;  1X25 A;  4ZHW A;  3N2G B;  3FBA A;  3GTZ A;  1CLI A;  2OTM A;  2CZW A;  3CCV F;  1YJ9 F;  4XCQ A;  5EIB C;  5MN4 A;  3HKD A;  5LOV A;  3S0Y A;  4BW0 B;  3CC7 F;  4R40 B;  5MN6 A;  3WPW A;  2QI2 A;  5LYJ A;  2ZF8 A;  1RQ2 A;  3S0H A;  1W57 A;  3ZP4 A;  1VQ9 F;  5LA6 B;  3CXC F;  4I4T B;  2F9Z C;  4BT2 A;  4O2B A;  2ZAU A;  3RYI B;  3LWV C;  1VQ7 F;  3E22 A;  2L26 A;  1GO0 A;  2H8C A;  4BVR A;  4YJ3 A;  3OBW A;  3LFO A;  3DC2 A;  5HY2 A;  3CPW F;  3LWR C;  1VH8 A;  2W8B C;  2HP3 A;  1Q86 H;  3KJK A;  1GO1 A;  2VAM A;  2FGY A;  3JAW B;  2RHL A;  3TD4 A;  4C82 A;  4O4J A;  3VMF B;  3RYC A;  2Z1E A;  3VYU C;  1YHQ F;  4ZOL A;  2MQE A;  2RHH A;  3IMP A;  5JCO A;  3CB2 A;  3CCJ F;  1Q82 H;  1W3E X;  5EAZ A;  3E20 B;  1JD1 A;  2VGN A;  3S0W A;  2VAW A;  4BT7 A;  3KE1 A;  4HNA B;  5DCV A;  3LDT A;  3RYF B;  1UFY A;  4B5C A;  1YIT F;  3TD5 A;  3WPX A;  1JJ2 F;  3BYQ A;  3F0E A;  1K8A H;  1FFX B;  2GZL A;  3EOR A;  4X1Y A;  5BMV A;  5CB4 A;  3CCS F;  5FNV B;  1R1M A;  2V9Y A;  2OTJ F;  4KWE A;  1YQN A;  2HX0 A;  5IT9 M;  2ZOD A;  1TVK A;  4O4I B;  5CA0 A;  1RLG A;  5LXT A;  2IG8 A;  4O4H B;  4C8G A;  1VQO F;  5HY1 A;  5AVM A;  1Q8R A;  3FD5 A;  3ZP7 A;  4BVQ A;  4X1I B;  2VAP A;  5CA1 B;  3MCA B;  3I56 F;  2CHT A;  4PWT A;  1IV4 A;  5HY4 A;  3D01 A;  4O2A A;  2RHJ A;  1H7M A;  4B62 A;  3SIU A;  2ZVY A;  1K73 H;  1RA4 A;  3CCU F;  5EWR A;  5GAN K;  2IAF A;  2UYN A;  1T0K B;  3HKC B;  4IHJ A;  5IJ9 A;  1JY8 A;  3HKE B;  2UYP A;  1YIJ F;  2P6Y A;  4ZI7 B;  4NQ3 A;  2Z1T A;  3WJQ A;  1W58 1;  3D00 A;  3JAK A;  3KHN A;  3RA6 A;  5GON A;  5FLX M;  2GLZ A;  5KX5 B;  3LWP C;  1ODE A;  1U40 A;  2CHS A;  3Q8H A;  2H8E A;  4G4X A;  2YXZ A;  1W5F A;  4X1K A;  1VQ8 F;  1YI2 F;  2OZB A;  1X52 A;  2I6R A;  2BO1 A;  5LP6 C;  3P10 A;  3S06 A;  5G4V C;  4WBN A;  5J2U A;  5G4U C;  3K2X A;  3T80 A;  3V4D A;  4U3J B;  3B6N A;  4I55 A;  3SIV A;  3VYT C;  3C9U A;  4NWO B;  5ITZ B;  5LOV B;  5J2T B;  3CCR F;  5B8F A;  4TV8 B;  1IV1 A;  4LNU B;  2VGM A;  3E1Y A;  2DT4 A;  4EI9 A;  1DT9 A;  4I50 B;  2AIZ P;  1JFF A;  2N48 A;  4G88 A;  3QHD A;  1COM A;  1VQ4 F;  5IJ0 A;  3JAL B;  4FFB B;  1W5B A;  4BT6 A;  2UYJ A;  3ELC A;  1Q81 H;  5JQG A;  1YJN F;  2KTU A;  4TV9 B;  1SA0 B;  4EB6 A;  1OAP A;  3CG6 A;  3I3F A;  3QTY A;  3WJP A;  3LWQ C;  1RQ7 A;  2OHW A;  3JAT B;  3I7T A;  1YGY A;  2NMU A;  4IIJ B;  3ZO8 A;  1Q7Y H;  5A2Q M;  3NVI B;  4O4L B;  4BT3 A;  5LP6 B;  3CCQ F;  3JAS A;  1YJW F;  1VQ6 F;  1VQN F;  3K12 A;  1SZQ A;  3F0G A;  2K1S A;  5JVD B;  1Z5V A;  1U3P A;  3L7Q A;  5IYZ A;  4M8I A;  3LWO C;  2LCA A;  3CCM F;  3GHZ A;  3S02 A;  4U39 A;  1IV3 A;  4BVS A;  1SDS A;  3G6E F;  3CMA F;  3WXM B;  4DRX B;  3RYH B;  3UT5 A;  1KNJ A;  5JH7 B;  3LYB A;  1Z5W A;  3HKB B;  5EB0 A;  5C8Y A;  3CYQ A;  2HP0 A;  3K14 A;  3JAR B;  3P4E A;  2I6D A;  3VO8 A;  1H48 A;  2IQQ A;  1W42 A;  1GZ0 A;  3ERN A;  3N2K B;  5GIP C;  1W5A A;  2QA4 F;  1W2B F;  3VOA A;  4DXD A;  3N2G A;  5HP7 A;  3DDN A;  4O2A B;  3J81 M;  3NK7 A;  2Z1F A;  3HAX D;  3VI6 A; 
#chains in the Genus database with same CATH homology
 1H47 A;  4C81 A;  1YQN A;  1JY8 A;  3B6N A;  1T0A A;  3MBM A;  1KNK A;  2UZH A;  1KNJ A;  3IEW A;  4C82 A;  1VHA A;  2PMP A;  5B8F A;  1IV1 A;  1U43 A;  3F0F A;  1JN1 A;  4C8G A;  4C8E A;  3JVH A;  1U40 A;  3K14 A;  3Q8H A;  1W57 A;  3KE1 A;  1H48 A;  1U3L A;  3F0G A;  3F6M A;  3IEQ A;  3ESJ A;  3ERN A;  3IKF A;  3QHD A;  1IV2 A;  1U3P A;  3FPI A;  1IV4 A;  3ELC A;  1GX1 A;  2AMT A;  3F0D A;  3FBA A;  3IKE A;  3F0E A;  3P0Z A;  1VH8 A;  4C8I A;  3GHZ A;  3P10 A;  2GZL A;  3EOR A;  3RE3 A;  1W55 A;  3K2X A;  1IV3 A;  3T80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...