3F0FA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0fA00
3K14A 3ERNA 1JY8A 3F0FA 1U40A 2UZHA 3B6NA 1W57A 1YQNA 1IV4A 1GX1A 4C8IA 1IV2A 3IKFA 1JN1A 2GZLA 3JVHA 4C8EA 3QHDA 3MBMA 3F0GA 3IEQA 3T80A 1U3LA 3K2XA 4C82A 1H47A 3FPIA 3P10A 1T0AA 1W55A 1IV1A 1KNJA 3FBAA 1KNKA 3Q8HA 1IV3A 3P0ZA 5B8FA 3KE1A 1VH8A 3F6MA 2PMPA 3F0DA 3GHZA 1U3PA 3IEWA 3ELCA 3ESJA 3IKEA 1H48A 1VHAA 3RE3A 4C81A 1U43A 3F0EA 4C8GA 2AMTA 3EORA
chains in the Genus database with same CATH superfamily
3N2GB 5IJ0B 1OFUA 3N4YA 3VI6A 1YQNA 2UYPA 4C8EA 1UI9A 4O2AA 3RA5A 5LOVB 2ZVYA 3LWRC 4LCKA 2ZOVA 2F9ZC 3DDNA 2HX0A 3QTYA 4R40B 5FLXM 3S0WA 5J2UA 3ON1A 4G4YA 4EI8A 1NJIH 4LNUA 1CK2A 4O2AB 4O2BB 4U3JA 4X1YA 2AIFA 3C9TA 4NWOB 2R6R1 3RYHA 2FGYA 3WJPA 3D54A 3F0DA 1JFFA 5J2UB 1PXWA 3S03A 3S0YA 5EWRA 4BT7A 1QU9A 3LDTA 4LNUB 4NQ3A 5G4VC 4U3JB 1W59A 4X3LA 4X1YB 1IV2A 4B5CA 3RYHB 1YITF 3JATA 1ONIA 1TVKA 3CB2A 3WPXA 1JFFB 4O4HA 1Z5VA 1YJNF 5HY2A 1Q81H 5C8YA 2ZVZA 5GANK 5GIOC 3M84A 5B8FA 4TZZA 3KE1A 5A2QM 2HS3A 4DXDA 3CCVF 3CXCF 1FSZA 2CZWA 3JATB 2H6LA 1OAPA 1TVKB 2Q1YA 4O4HB 5JH7A 3VYTC 3RA6A 4FFBB 3S0HA 4O4LA 3CMAF 3N2KA 3KIZA 1VQ9F 1ZWZA 4X1IA 1QVFF 4I55A 2H8CA 5HWEA 3J7AR 4G4VA 5EB1B 1ODEA 3VIUA 2CSLA 3CCRF 3IEQA 1K9MH 1W41A 5JH7B 3FD5A 3KJJA 1YGYA 3CCMF 1FFXA 1X7PA 4O4LB 3N2KB 3LMEA 4IHJA 1S72F 4X1IB 3KHNA 3JARA 1FNJA 2QEXF 2VGNA 1U3PA 3CD6F 3CCQF 1DT9A 1FFXB 4I50A 2Z1UA 5LP6C 2Z1EA 3JARB 1VQ5F 1VK3A 3QHDA 1Q82H 5JQGA 5FNVB 3WGMA 1W5EA 1H47A 5HP7A 2CW4A 1VQ7F 4ZHWA 3WGNA 4BVSA 3P0ZA 4G88A 5JQGB 5LYJA 3MDOA 2R751 4BT5A 3E22A 4YJ3A 3K0TA 2AMTA 4NUTA 3I7TA 3I3FA 4RHAA 5IJ9B 2Z1FA 2V9YA 3OBYA 3JVHA 3NK7A 4YJ2A 1VQMF 5IT9M 5HXZA 5LYJB 2OTLF 3E22B 4YJ3B 4BT2A 4C82A 2N48A 4B45A 4ZI7A 5BMVA 5EAZA 1VQPF 3C9SA 2DT4A 5KX5A 2YXZA 3V4DA 4YJ2B 1VQ6F 3WPWA 5MN5A 2HRUA 5HY1A 3RE3A 4ZI7B 3RYIA 4C8GA 3ZP7A 5BMVB 5LP6A 3CCUF 1JY8A 5KX5B 1NMUB 1W57A 2EWCA 1RLGA 4O2BA 5CB4A 5IYZA 3WJRA 1VQOF 3RYIB 2I6DA 2RHLA 3MQWA 5LP6B 3U0OA 3S06A 3HAXD 4ZHQA 2RHJA 3HKCA 2BTUA 1YIJF 3GTZA 3O85A 2ZF8A 5CB4B 5IYZB 2PHNA 3UT5A 1W2BF 2RB9A 5KMGA 1K8AH 3KJKA 3MCAB 1VHAA 4G4XA 3HKBB 2OZBA 4ZHQB 3HJWC 1XRGA 2QTPA 3HKCB 3QUWA 1Z5WA 1VQLF 4O4IA 1GO0A 2HQSC 3AGKA 3UT5B 4U39A 3V7EA 5KMGB 1RLUA 4BT4A 1SA0A 3WGJA 2P6YA 1SDSA 5JCOC 3VOAA 1T0KB 1YI2F 4FFBA 2I6RA 3JAWA 4O4IB 2CVLA 3ZP4A 4PWTA 1Q8RA 1SA0B 2HVYD 1QD9A 3M4SA 5EYPA 3CMEF 3K14A 1SZQA 5EZYA 3LWQC 1VQVA 3JAWB 3RYCA 4EB6A 1GX1A 4EI7A 5EB0A 3J80M 1CN7A 1IPAA 1KC8H 2LBWA 3E20B 3V3TA 5EYPB 5EZYB 3CYPB 1KQSF 4C4WC 3WXMB 1CLIA 4EB6B 5MN4A 3RYCB 2IQQA 5DCVA 3P4EA 3JCMM 3LWOC 1YHQF 4M8IA 1JD1A 1W5FA 1W5BA 3VYSC 4C81A 5ITZA 3CC4F 5FNVA 1W42A 2LCAA 1JJ2F 2GVIA 1X52A 3FFMA 5GINC 1IV4A 3TD4A 1XV2A 3VTIC 2HS0A 3T80A 5ITZB 3WJQA 2OTJF 4DRXB 5FJ4C 5JCOA 4BVQA 3LWVC 2W8BC 3IR9A 2PMPA 2RHHA 3M1XA 4ZHVA 5IJ9A 1TUBA 4BW0B 4B62A 3SIUA 3C9RA 3WGLA 3NK6A 1RQ7A 3VMFB 2BO1A 1H7MA 2CHSA 3LFOA 2VAMA 4TV8A 1U40A 2ZODA 3HTNA 4IIJA 1M1KH 1X7OA 2ZAUA 3B6NA 1VQ8F 3S02A 4C8IA 3IKFA 1KD1H 3SIVA 4KWEA 1TUBB 2NMUA 4O4JA 1U3LA 2K1SA 4ZOLA 2OTMA 2FC3A 2LBTA 2L26A 2MQEA 5GAPK 4TV8B 4IIJB 4ZK7A 2UYNA 5LXTA 2LBXA 5CA0A 4G4ZA 4O4JB 3ESJA 4ZOLB 2YYEA 1DBFA 1XBIA 1XHOA 1YJWF 5GONB 2H8EA 2UYNB 5EO3A 3WGKA 5LXTB 3CPQA 5CA0B 2BTOA 3DC2A 3I56F 3G6EF 1GZ0A 2GZLA 3CYQA 4XCQA 5AVMA 3NVKE 3E1YA 3RYFA 3NMUC 3G71F 1T0AA 3HKBA 3FBAA 1KNKA 2B33A 3OBWA 3Q8HA 1IV3A 2AIZP 1VQNF 1FNKA 3GHZA 3OW2F 4F6RA 3ZO8A 1W5AA 3RYFB 5LA6A 3BYQA 4X3MA 1Q7YH 2UYJA 4F6RB 1W3EX 1UFYA 3F0GA 5LA6B 1J7HA 5EIBC 5GIPC 3CCSF 3P10A 4EI9A 2KTVA 5HY0A 3N4ZA 3D00A 4BVTA 1Q86H 2RHOA 2UYKA 1X25A 2GLZA 1H48A 2KG4A 2VAWA 3C9UA 5MN6A 3MCQA 3EORA 3FD6A 2Z1TA 2OHWA 2UZHA 3JAKA 3PLAC 3LYBA 2VGMA 3I55F 4BT6A 3L7QA 1QVGF 2BTQB 3CCJF 2IAFA 4B46A 2QA4F 3TD5A 4ERHA 1RA4A 3JAKB 3F6MA 1M90H 1COMA 3R0PA 5HY4A 2VAPA 3ELCA 1K73H 4WBNA 3CC2F 5C8YB 3CG6A 4DRXA 2KTUA 2Q1XA 1W581 4E6EA 3NVIB 3K12A 3OONA 1PF5A 1YJ9F 5G4UC 3VYUC 4WBNB 3K2XA 3LWPC 3C8LA 1E7KA 3CC7F 1KNJA 4I55B 3VO8A 3GYQA 3V7QA 1NQ3A 4RQOA 2G9IA 5JVDA 4TUYA 1R1MA 2CHTA 2CWJA 2HS4A 3J81M 4HNAA 4IHJB 2HRYA 5EIBD 1U43A 3VOBA 1GO1A 4X1KA 3CPWF 3ZOPA 2JNBA 5J2TA 3ERNA 4I4TA 4TUYB 5JVDB 4ZHYB 4HNAB 4I50B 3MBMA 2KGWA 5CA1A 3G4SF 4X1KB 1VQKF 4TV9A 5J2TB 1IV1A 2DYYA 3HKEA 4I4TB 3JAMM 2Z01A 3TD3A 5GONA 1VH8A 3IEWA 5CA1B 4TV9B 3F0EA 3JASA 1W40A 3HKEB 2VXYA 2HP0A 1RQ2A 2QI2A 2ALEA 3F0FA 3PAFA 2HP3A 3HWUA 3IMPA 3JALA 5HXUA 3D01A 1JN1A 2WALA 4BVRA 5HP8A 3CCEF 3JASB 3HKDA 3FPIA 4X20A 1W55A 2IG8A 4BY9D 2HP0B 1QAHA 3JALB 3N2GA 4G4WA 1VQ4F 4BT3A 5IJ0A 1N8RH 3VCZA 5LOVA 3HKDB 3IKEA 4X20B 3CCLF
chains in the Genus database with same CATH topology
3K14A 3ERNA 1JY8A 3F0FA 1U40A 2UZHA 3B6NA 1W57A 1YQNA 1IV4A 1GX1A 4C8IA 1IV2A 3IKFA 1JN1A 2GZLA 3JVHA 4C8EA 3QHDA 3MBMA 3F0GA 3IEQA 3T80A 1U3LA 3K2XA 4C82A 1H47A 3FPIA 3P10A 1T0AA 1W55A 1IV1A 1KNJA 3FBAA 1KNKA 3Q8HA 1IV3A 3P0ZA 5B8FA 3KE1A 1VH8A 3F6MA 2PMPA 3F0DA 3GHZA 1U3PA 3IEWA 3ELCA 3ESJA 3IKEA 1H48A 1VHAA 3RE3A 4C81A 1U43A 3F0EA 4C8GA 2AMTA 3EORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  3ERN A;  1JY8 A;  3F0F A;  1U40 A;  2UZH A;  3B6N A;  1W57 A;  1YQN A;  1IV4 A;  1GX1 A;  4C8I A;  1IV2 A;  3IKF A;  1JN1 A;  2GZL A;  3JVH A;  4C8E A;  3QHD A;  3MBM A;  3F0G A;  3IEQ A;  3T80 A;  1U3L A;  3K2X A;  4C82 A;  1H47 A;  3FPI A;  3P10 A;  1T0A A;  1W55 A;  1IV1 A;  1KNJ A;  3FBA A;  1KNK A;  3Q8H A;  1IV3 A;  3P0Z A;  5B8F A;  3KE1 A;  1VH8 A;  3F6M A;  2PMP A;  3F0D A;  3GHZ A;  1U3P A;  3IEW A;  3ELC A;  3ESJ A;  3IKE A;  1H48 A;  1VHA A;  3RE3 A;  4C81 A;  1U43 A;  3F0E A;  4C8G A;  2AMT A;  3EOR A; 
#chains in the Genus database with same CATH topology
 3N2G B;  5IJ0 B;  1OFU A;  3N4Y A;  3VI6 A;  1YQN A;  2UYP A;  4C8E A;  1UI9 A;  4O2A A;  3RA5 A;  5LOV B;  2ZVY A;  3LWR C;  4LCK A;  2ZOV A;  2F9Z C;  3DDN A;  2HX0 A;  3QTY A;  4R40 B;  5FLX M;  3S0W A;  5J2U A;  3ON1 A;  4G4Y A;  4EI8 A;  1NJI H;  4LNU A;  1CK2 A;  4O2A B;  4O2B B;  4U3J A;  4X1Y A;  2AIF A;  3C9T A;  4NWO B;  2R6R 1;  3RYH A;  2FGY A;  3WJP A;  3D54 A;  3F0D A;  1JFF A;  5J2U B;  1PXW A;  3S03 A;  3S0Y A;  5EWR A;  4BT7 A;  1QU9 A;  3LDT A;  4LNU B;  4NQ3 A;  5G4V C;  4U3J B;  1W59 A;  4X3L A;  4X1Y B;  1IV2 A;  4B5C A;  3RYH B;  1YIT F;  3JAT A;  1ONI A;  1TVK A;  3CB2 A;  3WPX A;  1JFF B;  4O4H A;  1Z5V A;  1YJN F;  5HY2 A;  1Q81 H;  5C8Y A;  2ZVZ A;  5GAN K;  5GIO C;  3M84 A;  5B8F A;  4TZZ A;  3KE1 A;  5A2Q M;  2HS3 A;  4DXD A;  3CCV F;  3CXC F;  1FSZ A;  2CZW A;  3JAT B;  2H6L A;  1OAP A;  1TVK B;  2Q1Y A;  4O4H B;  5JH7 A;  3VYT C;  3RA6 A;  4FFB B;  3S0H A;  4O4L A;  3CMA F;  3N2K A;  3KIZ A;  1VQ9 F;  1ZWZ A;  4X1I A;  1QVF F;  4I55 A;  2H8C A;  5HWE A;  3J7A R;  4G4V A;  5EB1 B;  1ODE A;  3VIU A;  2CSL A;  3CCR F;  3IEQ A;  1K9M H;  1W41 A;  5JH7 B;  3FD5 A;  3KJJ A;  1YGY A;  3CCM F;  1FFX A;  1X7P A;  4O4L B;  3N2K B;  3LME A;  4IHJ A;  1S72 F;  4X1I B;  3KHN A;  3JAR A;  1FNJ A;  2QEX F;  2VGN A;  1U3P A;  3CD6 F;  3CCQ F;  1DT9 A;  1FFX B;  4I50 A;  2Z1U A;  5LP6 C;  2Z1E A;  3JAR B;  1VQ5 F;  1VK3 A;  3QHD A;  1Q82 H;  5JQG A;  5FNV B;  3WGM A;  1W5E A;  1H47 A;  5HP7 A;  2CW4 A;  1VQ7 F;  4ZHW A;  3WGN A;  4BVS A;  3P0Z A;  4G88 A;  5JQG B;  5LYJ A;  3MDO A;  2R75 1;  4BT5 A;  3E22 A;  4YJ3 A;  3K0T A;  2AMT A;  4NUT A;  3I7T A;  3I3F A;  4RHA A;  5IJ9 B;  2Z1F A;  2V9Y A;  3OBY A;  3JVH A;  3NK7 A;  4YJ2 A;  1VQM F;  5IT9 M;  5HXZ A;  5LYJ B;  2OTL F;  3E22 B;  4YJ3 B;  4BT2 A;  4C82 A;  2N48 A;  4B45 A;  4ZI7 A;  5BMV A;  5EAZ A;  1VQP F;  3C9S A;  2DT4 A;  5KX5 A;  2YXZ A;  3V4D A;  4YJ2 B;  1VQ6 F;  3WPW A;  5MN5 A;  2HRU A;  5HY1 A;  3RE3 A;  4ZI7 B;  3RYI A;  4C8G A;  3ZP7 A;  5BMV B;  5LP6 A;  3CCU F;  1JY8 A;  5KX5 B;  1NMU B;  1W57 A;  2EWC A;  1RLG A;  4O2B A;  5CB4 A;  5IYZ A;  3WJR A;  1VQO F;  3RYI B;  2I6D A;  2RHL A;  3MQW A;  5LP6 B;  3U0O A;  3S06 A;  3HAX D;  4ZHQ A;  2RHJ A;  3HKC A;  2BTU A;  1YIJ F;  3GTZ A;  3O85 A;  2ZF8 A;  5CB4 B;  5IYZ B;  2PHN A;  3UT5 A;  1W2B F;  2RB9 A;  5KMG A;  1K8A H;  3KJK A;  3MCA B;  1VHA A;  4G4X A;  3HKB B;  2OZB A;  4ZHQ B;  3HJW C;  1XRG A;  2QTP A;  3HKC B;  3QUW A;  1Z5W A;  1VQL F;  4O4I A;  1GO0 A;  2HQS C;  3AGK A;  3UT5 B;  4U39 A;  3V7E A;  5KMG B;  1RLU A;  4BT4 A;  1SA0 A;  3WGJ A;  2P6Y A;  1SDS A;  5JCO C;  3VOA A;  1T0K B;  1YI2 F;  4FFB A;  2I6R A;  3JAW A;  4O4I B;  2CVL A;  3ZP4 A;  4PWT A;  1Q8R A;  1SA0 B;  2HVY D;  1QD9 A;  3M4S A;  5EYP A;  3CME F;  3K14 A;  1SZQ A;  5EZY A;  3LWQ C;  1VQV A;  3JAW B;  3RYC A;  4EB6 A;  1GX1 A;  4EI7 A;  5EB0 A;  3J80 M;  1CN7 A;  1IPA A;  1KC8 H;  2LBW A;  3E20 B;  3V3T A;  5EYP B;  5EZY B;  3CYP B;  1KQS F;  4C4W C;  3WXM B;  1CLI A;  4EB6 B;  5MN4 A;  3RYC B;  2IQQ A;  5DCV A;  3P4E A;  3JCM M;  3LWO C;  1YHQ F;  4M8I A;  1JD1 A;  1W5F A;  1W5B A;  3VYS C;  4C81 A;  5ITZ A;  3CC4 F;  5FNV A;  1W42 A;  2LCA A;  1JJ2 F;  2GVI A;  1X52 A;  3FFM A;  5GIN C;  1IV4 A;  3TD4 A;  1XV2 A;  3VTI C;  2HS0 A;  3T80 A;  5ITZ B;  3WJQ A;  2OTJ F;  4DRX B;  5FJ4 C;  5JCO A;  4BVQ A;  3LWV C;  2W8B C;  3IR9 A;  2PMP A;  2RHH A;  3M1X A;  4ZHV A;  5IJ9 A;  1TUB A;  4BW0 B;  4B62 A;  3SIU A;  3C9R A;  3WGL A;  3NK6 A;  1RQ7 A;  3VMF B;  2BO1 A;  1H7M A;  2CHS A;  3LFO A;  2VAM A;  4TV8 A;  1U40 A;  2ZOD A;  3HTN A;  4IIJ A;  1M1K H;  1X7O A;  2ZAU A;  3B6N A;  1VQ8 F;  3S02 A;  4C8I A;  3IKF A;  1KD1 H;  3SIV A;  4KWE A;  1TUB B;  2NMU A;  4O4J A;  1U3L A;  2K1S A;  4ZOL A;  2OTM A;  2FC3 A;  2LBT A;  2L26 A;  2MQE A;  5GAP K;  4TV8 B;  4IIJ B;  4ZK7 A;  2UYN A;  5LXT A;  2LBX A;  5CA0 A;  4G4Z A;  4O4J B;  3ESJ A;  4ZOL B;  2YYE A;  1DBF A;  1XBI A;  1XHO A;  1YJW F;  5GON B;  2H8E A;  2UYN B;  5EO3 A;  3WGK A;  5LXT B;  3CPQ A;  5CA0 B;  2BTO A;  3DC2 A;  3I56 F;  3G6E F;  1GZ0 A;  2GZL A;  3CYQ A;  4XCQ A;  5AVM A;  3NVK E;  3E1Y A;  3RYF A;  3NMU C;  3G71 F;  1T0A A;  3HKB A;  3FBA A;  1KNK A;  2B33 A;  3OBW A;  3Q8H A;  1IV3 A;  2AIZ P;  1VQN F;  1FNK A;  3GHZ A;  3OW2 F;  4F6R A;  3ZO8 A;  1W5A A;  3RYF B;  5LA6 A;  3BYQ A;  4X3M A;  1Q7Y H;  2UYJ A;  4F6R B;  1W3E X;  1UFY A;  3F0G A;  5LA6 B;  1J7H A;  5EIB C;  5GIP C;  3CCS F;  3P10 A;  4EI9 A;  2KTV A;  5HY0 A;  3N4Z A;  3D00 A;  4BVT A;  1Q86 H;  2RHO A;  2UYK A;  1X25 A;  2GLZ A;  1H48 A;  2KG4 A;  2VAW A;  3C9U A;  5MN6 A;  3MCQ A;  3EOR A;  3FD6 A;  2Z1T A;  2OHW A;  2UZH A;  3JAK A;  3PLA C;  3LYB A;  2VGM A;  3I55 F;  4BT6 A;  3L7Q A;  1QVG F;  2BTQ B;  3CCJ F;  2IAF A;  4B46 A;  2QA4 F;  3TD5 A;  4ERH A;  1RA4 A;  3JAK B;  3F6M A;  1M90 H;  1COM A;  3R0P A;  5HY4 A;  2VAP A;  3ELC A;  1K73 H;  4WBN A;  3CC2 F;  5C8Y B;  3CG6 A;  4DRX A;  2KTU A;  2Q1X A;  1W58 1;  4E6E A;  3NVI B;  3K12 A;  3OON A;  1PF5 A;  1YJ9 F;  5G4U C;  3VYU C;  4WBN B;  3K2X A;  3LWP C;  3C8L A;  1E7K A;  3CC7 F;  1KNJ A;  4I55 B;  3VO8 A;  3GYQ A;  3V7Q A;  1NQ3 A;  4RQO A;  2G9I A;  5JVD A;  4TUY A;  1R1M A;  2CHT A;  2CWJ A;  2HS4 A;  3J81 M;  4HNA A;  4IHJ B;  2HRY A;  5EIB D;  1U43 A;  3VOB A;  1GO1 A;  4X1K A;  3CPW F;  3ZOP A;  2JNB A;  5J2T A;  3ERN A;  4I4T A;  4TUY B;  5JVD B;  4ZHY B;  4HNA B;  4I50 B;  3MBM A;  2KGW A;  5CA1 A;  3G4S F;  4X1K B;  1VQK F;  4TV9 A;  5J2T B;  1IV1 A;  2DYY A;  3HKE A;  4I4T B;  3JAM M;  2Z01 A;  3TD3 A;  5GON A;  1VH8 A;  3IEW A;  5CA1 B;  4TV9 B;  3F0E A;  3JAS A;  1W40 A;  3HKE B;  2VXY A;  2HP0 A;  1RQ2 A;  2QI2 A;  2ALE A;  3F0F A;  3PAF A;  2HP3 A;  3HWU A;  3IMP A;  3JAL A;  5HXU A;  3D01 A;  1JN1 A;  2WAL A;  4BVR A;  5HP8 A;  3CCE F;  3JAS B;  3HKD A;  3FPI A;  4X20 A;  1W55 A;  2IG8 A;  4BY9 D;  2HP0 B;  1QAH A;  3JAL B;  3N2G A;  4G4W A;  1VQ4 F;  4BT3 A;  5IJ0 A;  1N8R H;  3VCZ A;  5LOV A;  3HKD B;  3IKE A;  4X20 B;  3CCL F; 
#chains in the Genus database with same CATH homology
 3K14 A;  3ERN A;  1JY8 A;  3F0F A;  1U40 A;  2UZH A;  3B6N A;  1W57 A;  1YQN A;  1IV4 A;  1GX1 A;  4C8I A;  1IV2 A;  3IKF A;  1JN1 A;  2GZL A;  3JVH A;  4C8E A;  3QHD A;  3MBM A;  3F0G A;  3IEQ A;  3T80 A;  1U3L A;  3K2X A;  4C82 A;  1H47 A;  3FPI A;  3P10 A;  1T0A A;  1W55 A;  1IV1 A;  1KNJ A;  3FBA A;  1KNK A;  3Q8H A;  1IV3 A;  3P0Z A;  5B8F A;  3KE1 A;  1VH8 A;  3F6M A;  2PMP A;  3F0D A;  3GHZ A;  1U3P A;  3IEW A;  3ELC A;  3ESJ A;  3IKE A;  1H48 A;  1VHA A;  3RE3 A;  4C81 A;  1U43 A;  3F0E A;  4C8G A;  2AMT A;  3EOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...