3F0FA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0fA00
3Q8HA 1T0AA 3F0GA 3QHDA 1H47A 1U3LA 1W55A 1VH8A 3JVHA 1IV3A 3FPIA 1U43A 4C8GA 1GX1A 3KE1A 4C82A 4C8IA 3IKFA 3IKEA 1IV1A 1IV2A 3ESJA 3MBMA 3F6MA 4C8EA 3F0FA 4C81A 3B6NA 3EORA 3K14A 3P10A 1YQNA 3T80A 2GZLA 2UZHA 3IEWA 1KNJA 1H48A 3P0ZA 3ERNA 3IEQA 3F0DA 3F0EA 2AMTA 1JN1A 1IV4A 1KNKA 3ELCA 3GHZA 1U3PA 5B8FA 1W57A 1JY8A 3FBAA 3K2XA 1VHAA 1U40A 3RE3A 2PMPA
chains in the Genus database with same CATH superfamily
2CHTA 3L7QA 5FLXM 2BO1A 5JVDB 4X3LA 5HY4A 2OTLF 2UYNA 2W8BC 3DC2A 3RYFB 3I7TA 1VQNF 3IMPA 4C8GA 3G6EF 3IKEA 3RYFA 4BT5A 3ZOPA 3VI6A 1W41A 1W5AA 4C8EA 1KC8H 3BYQA 4TV8A 5IJ0B 3P10A 1YQNA 1VQKF 1RQ2A 2VXYA 1JD1A 3IEQA 5HXUA 1KNKA 1W40A 2L26A 4YJ2B 3CC2F 4I55A 5J2UB 3HTNA 2H6LA 3LMEA 1YJWF 5LA6B 5JQGA 4ZHQA 5EB1B 1VQ4F 4G4YA 4O4IA 2H8CA 1CN7A 4EI9A 5EB0A 3CMEF 2IAFA 3RA6A 3E1YA 3FD5A 3S06A 2HQSC 2OTJF 3WJPA 2HP0A 4DRXB 1CK2A 4TV8B 3O85A 2HRUA 1NQ3A 3SIVA 3I3FA 4ZK7A 1W59A 1TUBB 4BY9D 3HAXD 5A2QM 3CCQF 5LP6A 4ZI7A 4U3JB 5KX5B 1Z5VA 2UYNB 1VQMF 1TUBA 1W57A 1JY8A 2PHNA 4HNAA 5EZYA 3FBAA 4LNUB 2FC3A 3LDTA 1H47A 2RHJA 1W55A 1QAHA 4U39A 5JCOA 3RYCA 3HWUA 3HKDB 5EIBC 4RHAA 1W3EX 1W5BA 3E22B 1Q7YH 4EB6A 3OBYA 1W42A 2AIZP 3LFOA 2LBXA 1SZQA 3B6NA 1GO0A 2QTPA 3HKBA 2YXZA 4X1IB 1KQSF 3ZP7A 3HJWC 5MN4A 5J2UA 1SDSA 1VQ7F 2KGWA 3V4DA 3WJQA 3OBWA 2KTVA 4TV9B 4FFBB 3E22A 1T0KB 2P6YA 3V7EA 1RLUA 1IPAA 3NVKE 2G9IA 2CHSA 5EAZA 2K1SA 3F0GA 3C8LA 3VYUC 1K73H 3CCLF 2B33A 3CYQA 1SA0A 4NQ3A 3JASA 3CC7F 1W5FA 3JALB 3N2KB 3F0EA 4BVQA 4B45A 3S02A 3OW2F 3I55F 1Z5WA 5MN6A 1W5EA 3N2GA 1X25A 3G4SF 2ALEA 1QU9A 3VTIC 4C4WC 1IV1A 3ESJA 4XCQA 3QTYA 5G4UC 4O4JA 2VGMA 3CCSF 1YJ9F 3LWQC 2UZHA 4I50B 2VAWA 4I4TA 5JH7A 3CC4F 1YGYA 5FNVB 3RYHA 3RYCB 4R40B 4HNAB 1QVGF 2ZODA 3CXCF 1PF5A 1IV4A 3S0HA 3C9TA 5B8FA 1UFYA 5LP6B 2OHWA 1UI9A 3KJJA 1XRGA 4G4VA 5HP7A 1T0AA 2I6RA 5EIBD 3CG6A 3VYSC 5CB4B 2IQQA 3C9SA 4IIJA 1VQVA 4O2AB 2JNBA 1OAPA 3GTZA 4G4XA 4LCKA 5LP6C 4TUYB 1Q86H 5CA0B 2H8EA 1OFUA 4G4ZA 3M4SA 4O2BB 3WGMA 3S0WA 4ZOLB 5HY1A 3V3TA 5FJ4C 1ONIA 4NWOB 4F6RA 3CCEF 3N2KA 2MQEA 3CPWF 5ITZB 2HS0A 4PWTA 2HVYD 1TVKB 2HX0A 3CYPB 3EORA 4RQOA 2AIFA 5LYJA 3TD5A 3KHNA 1GZ0A 2CSLA 4X1KA 2HP0B 2F9ZC 1FNJA 3VO8A 3LYBA 1JN1A 4BT3A 3ELCA 3RYIB 1VQPF 4O4IB 5EWRA 3RE3A 1VQ9F 5C8YA 4IHJB 1VH8A 1H7MA 2BTQB 3LWPC 3HKCB 5HXZA 4BVTA 3MCQA 4X3MA 2ZAUA 5IJ9A 2ZOVA 3N2GB 3T80A 4O4LA 5CA0A 3KIZA 1VQ8F 4ZHWA 4BVRA 4TUYA 3M84A 4BW0B 5DCVA 5LXTB 5LOVB 2AMTA 3OONA 2Z1FA 3GHZA 2YYEA 1VQ6F 1JJ2F 3MDOA 3SIUA 4ZHVA 3F0DA 3ZP4A 1QVFF 2HS3A 1JFFA 1M90H 3KE1A 1JFFB 1VK3A 3IKFA 3JARA 1IV2A 1FNKA 5IT9M 1FFXA 2GZLA 3N4ZA 2VGNA 4TZZA 5JCOC 2QI2A 3WGKA 4I4TB 4ZHYB 3C9RA 3NVIB 2FGYA 3HKEB 3CCJF 1M1KH 3ZO8A 5HWEA 5CA1A 2PMPA 3JAMM 1XBIA 3CB2A 4YJ2A 1IV3A 3D54A 3CCRF 1DT9A 3MBMA 3K12A 3CCMF 3F6MA 5KMGB 4O2AA 2Z1UA 3NMUC 1NMUB 3WGLA 3JALA 3WXMB 3QUWA 4O4HB 4G4WA 1K9MH 2WALA 2OTMA 3JASB 2LBTA 5EZYB 5LYJB 1N8RH 3WGNA 2OZBA 3ERNA 1YIJF 2VAMA 3MQWA 1U3PA 1W2BF 4M8IA 5BMVA 4X1YB 3CMAF 1SA0B 3CPQA 1YI2F 5EYPB 1TVKA 1U40A 3P4EA 1W581 3JVHA 4WBNB 5JH7B 1E7KA 4B46A 3MCAB 2LCAA 3VOAA 3JAKB 5GIPC 4O4LB 1DBFA 5IYZA 2ZF8A 4B62A 4ZHQB 3LWRC 3VIUA 3TD3A 3K0TA 4E6EA 3RA5A 4X20A 1ODEA 1PXWA 2QEXF 5EO3A 3S03A 4BVSA 2DYYA 5GONB 1YITF 1XHOA 2UYKA 3D00A 2I6DA 2HRYA 4EI8A 3QHDA 4YJ3B 4G88A 3IR9A 2R6R1 2Z1EA 3JARB 3WPWA 4U3JA 2ZVZA 2KTUA 3V7QA 5CB4A 5HY0A 5J2TB 3WJRA 2Z01A 2BTUA 1X52A 2GVIA 2CW4A 2IG8A 4DRXA 3FD6A 4O4JB 3VYTC 4BT2A 5G4VC 3NK7A 3I56F 1COMA 5GAPK 3JATB 3UT5B 4TV9A 1RQ7A 4ZOLA 2EWCA 2V9YA 1XV2A 3Q8HA 4X1IA 4FFBA 1U3LA 3PLAC 5IYZB 1GO1A 2HP3A 1KD1H 1RLGA 3NK6A 3HKEA 3JATA 5MN5A 4EB6B 4BT7A 3F0FA 5AVMA 2LBWA 4IHJA 3WPXA 4C81A 3M1XA 1K8AH 4WBNA 3UT5A 3J80M 1H48A 3HKDA 2ZVYA 4X1YA 3WGJA 5GANK 5EYPA 4BT6A 5HP8A 5IJ0A 1NJIH 1RA4A 2GLZA 1Q82H 5BMVB 5JVDA 4YJ3A 3U0OA 3J81M 4ZI7B 5KX5A 4DXDA 4O4HA 5ITZA 1U43A 3PAFA 1GX1A 3CCVF 3J7AR 5LOVA 3TD4A 4I50A 2CWJA 3ON1A 4X20B 5KMGA 1Q81H 1X7PA 3LWVC 1KNJA 3P0ZA 3CCUF 4KWEA 4I55B 2RB9A 2VAPA 5LA6A 3VOBA 5JQGB 5C8YB 2UYPA 3K2XA 2BTOA 3R0PA 4BT4A 3JAKA 3HKCA 1ZWZA 3S0YA 2N48A 4C82A 2CZWA 3C9UA 4C8IA 4NUTA 1FFXB 4IIJB 1R1MA 1J7HA 4B5CA 3VMFB 2RHHA 5J2TA 3IEWA 4EI7A 3DDNA 3JCMM 3G71F 2RHLA 2RHOA 2UYJA 3AGKA 5GIOC 3GYQA 2Q1YA 5FNVA 3RYHB 2QA4F 5LXTA 1CLIA 3N4YA 5GONA 3JAWB 4ERHA 2Q1XA 4F6RB 5CA1B 5GINC 5IJ9B 3FPIA 2NMUA 2CVLA 3D01A 2KG4A 2Z1TA 4O2BA 3HKBB 3LWOC 1X7OA 3K14A 1YHQF 3VCZA 5HY2A 2HS4A 1FSZA 3CD6F 1VQOF 1Q8RA 2R751 1YJNF 1S72F 1QD9A 1VQLF 3RYIA 3JAWA 1VQ5F 2DT4A 3FFMA 3E20B 4X1KB 1VHAA 3KJKA 4LNUA
chains in the Genus database with same CATH topology
3Q8HA 1T0AA 3F0GA 3QHDA 1H47A 1U3LA 1W55A 1VH8A 3JVHA 1IV3A 3FPIA 1U43A 4C8GA 1GX1A 3KE1A 4C82A 4C8IA 3IKFA 3IKEA 1IV1A 1IV2A 3ESJA 3MBMA 3F6MA 4C8EA 3F0FA 4C81A 3B6NA 3EORA 3K14A 3P10A 1YQNA 3T80A 2GZLA 2UZHA 3IEWA 1KNJA 1H48A 3P0ZA 3ERNA 3IEQA 3F0DA 3F0EA 2AMTA 1JN1A 1IV4A 1KNKA 3ELCA 3GHZA 1U3PA 5B8FA 1W57A 1JY8A 3FBAA 3K2XA 1VHAA 1U40A 3RE3A 2PMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8H A;  1T0A A;  3F0G A;  3QHD A;  1H47 A;  1U3L A;  1W55 A;  1VH8 A;  3JVH A;  1IV3 A;  3FPI A;  1U43 A;  4C8G A;  1GX1 A;  3KE1 A;  4C82 A;  4C8I A;  3IKF A;  3IKE A;  1IV1 A;  1IV2 A;  3ESJ A;  3MBM A;  3F6M A;  4C8E A;  3F0F A;  4C81 A;  3B6N A;  3EOR A;  3K14 A;  3P10 A;  1YQN A;  3T80 A;  2GZL A;  2UZH A;  3IEW A;  1KNJ A;  1H48 A;  3P0Z A;  3ERN A;  3IEQ A;  3F0D A;  3F0E A;  2AMT A;  1JN1 A;  1IV4 A;  1KNK A;  3ELC A;  3GHZ A;  1U3P A;  5B8F A;  1W57 A;  1JY8 A;  3FBA A;  3K2X A;  1VHA A;  1U40 A;  3RE3 A;  2PMP A; 
#chains in the Genus database with same CATH topology
 2CHT A;  3L7Q A;  5FLX M;  2BO1 A;  5JVD B;  4X3L A;  5HY4 A;  2OTL F;  2UYN A;  2W8B C;  3DC2 A;  3RYF B;  3I7T A;  1VQN F;  3IMP A;  4C8G A;  3G6E F;  3IKE A;  3RYF A;  4BT5 A;  3ZOP A;  3VI6 A;  1W41 A;  1W5A A;  4C8E A;  1KC8 H;  3BYQ A;  4TV8 A;  5IJ0 B;  3P10 A;  1YQN A;  1VQK F;  1RQ2 A;  2VXY A;  1JD1 A;  3IEQ A;  5HXU A;  1KNK A;  1W40 A;  2L26 A;  4YJ2 B;  3CC2 F;  4I55 A;  5J2U B;  3HTN A;  2H6L A;  3LME A;  1YJW F;  5LA6 B;  5JQG A;  4ZHQ A;  5EB1 B;  1VQ4 F;  4G4Y A;  4O4I A;  2H8C A;  1CN7 A;  4EI9 A;  5EB0 A;  3CME F;  2IAF A;  3RA6 A;  3E1Y A;  3FD5 A;  3S06 A;  2HQS C;  2OTJ F;  3WJP A;  2HP0 A;  4DRX B;  1CK2 A;  4TV8 B;  3O85 A;  2HRU A;  1NQ3 A;  3SIV A;  3I3F A;  4ZK7 A;  1W59 A;  1TUB B;  4BY9 D;  3HAX D;  5A2Q M;  3CCQ F;  5LP6 A;  4ZI7 A;  4U3J B;  5KX5 B;  1Z5V A;  2UYN B;  1VQM F;  1TUB A;  1W57 A;  1JY8 A;  2PHN A;  4HNA A;  5EZY A;  3FBA A;  4LNU B;  2FC3 A;  3LDT A;  1H47 A;  2RHJ A;  1W55 A;  1QAH A;  4U39 A;  5JCO A;  3RYC A;  3HWU A;  3HKD B;  5EIB C;  4RHA A;  1W3E X;  1W5B A;  3E22 B;  1Q7Y H;  4EB6 A;  3OBY A;  1W42 A;  2AIZ P;  3LFO A;  2LBX A;  1SZQ A;  3B6N A;  1GO0 A;  2QTP A;  3HKB A;  2YXZ A;  4X1I B;  1KQS F;  3ZP7 A;  3HJW C;  5MN4 A;  5J2U A;  1SDS A;  1VQ7 F;  2KGW A;  3V4D A;  3WJQ A;  3OBW A;  2KTV A;  4TV9 B;  4FFB B;  3E22 A;  1T0K B;  2P6Y A;  3V7E A;  1RLU A;  1IPA A;  3NVK E;  2G9I A;  2CHS A;  5EAZ A;  2K1S A;  3F0G A;  3C8L A;  3VYU C;  1K73 H;  3CCL F;  2B33 A;  3CYQ A;  1SA0 A;  4NQ3 A;  3JAS A;  3CC7 F;  1W5F A;  3JAL B;  3N2K B;  3F0E A;  4BVQ A;  4B45 A;  3S02 A;  3OW2 F;  3I55 F;  1Z5W A;  5MN6 A;  1W5E A;  3N2G A;  1X25 A;  3G4S F;  2ALE A;  1QU9 A;  3VTI C;  4C4W C;  1IV1 A;  3ESJ A;  4XCQ A;  3QTY A;  5G4U C;  4O4J A;  2VGM A;  3CCS F;  1YJ9 F;  3LWQ C;  2UZH A;  4I50 B;  2VAW A;  4I4T A;  5JH7 A;  3CC4 F;  1YGY A;  5FNV B;  3RYH A;  3RYC B;  4R40 B;  4HNA B;  1QVG F;  2ZOD A;  3CXC F;  1PF5 A;  1IV4 A;  3S0H A;  3C9T A;  5B8F A;  1UFY A;  5LP6 B;  2OHW A;  1UI9 A;  3KJJ A;  1XRG A;  4G4V A;  5HP7 A;  1T0A A;  2I6R A;  5EIB D;  3CG6 A;  3VYS C;  5CB4 B;  2IQQ A;  3C9S A;  4IIJ A;  1VQV A;  4O2A B;  2JNB A;  1OAP A;  3GTZ A;  4G4X A;  4LCK A;  5LP6 C;  4TUY B;  1Q86 H;  5CA0 B;  2H8E A;  1OFU A;  4G4Z A;  3M4S A;  4O2B B;  3WGM A;  3S0W A;  4ZOL B;  5HY1 A;  3V3T A;  5FJ4 C;  1ONI A;  4NWO B;  4F6R A;  3CCE F;  3N2K A;  2MQE A;  3CPW F;  5ITZ B;  2HS0 A;  4PWT A;  2HVY D;  1TVK B;  2HX0 A;  3CYP B;  3EOR A;  4RQO A;  2AIF A;  5LYJ A;  3TD5 A;  3KHN A;  1GZ0 A;  2CSL A;  4X1K A;  2HP0 B;  2F9Z C;  1FNJ A;  3VO8 A;  3LYB A;  1JN1 A;  4BT3 A;  3ELC A;  3RYI B;  1VQP F;  4O4I B;  5EWR A;  3RE3 A;  1VQ9 F;  5C8Y A;  4IHJ B;  1VH8 A;  1H7M A;  2BTQ B;  3LWP C;  3HKC B;  5HXZ A;  4BVT A;  3MCQ A;  4X3M A;  2ZAU A;  5IJ9 A;  2ZOV A;  3N2G B;  3T80 A;  4O4L A;  5CA0 A;  3KIZ A;  1VQ8 F;  4ZHW A;  4BVR A;  4TUY A;  3M84 A;  4BW0 B;  5DCV A;  5LXT B;  5LOV B;  2AMT A;  3OON A;  2Z1F A;  3GHZ A;  2YYE A;  1VQ6 F;  1JJ2 F;  3MDO A;  3SIU A;  4ZHV A;  3F0D A;  3ZP4 A;  1QVF F;  2HS3 A;  1JFF A;  1M90 H;  3KE1 A;  1JFF B;  1VK3 A;  3IKF A;  3JAR A;  1IV2 A;  1FNK A;  5IT9 M;  1FFX A;  2GZL A;  3N4Z A;  2VGN A;  4TZZ A;  5JCO C;  2QI2 A;  3WGK A;  4I4T B;  4ZHY B;  3C9R A;  3NVI B;  2FGY A;  3HKE B;  3CCJ F;  1M1K H;  3ZO8 A;  5HWE A;  5CA1 A;  2PMP A;  3JAM M;  1XBI A;  3CB2 A;  4YJ2 A;  1IV3 A;  3D54 A;  3CCR F;  1DT9 A;  3MBM A;  3K12 A;  3CCM F;  3F6M A;  5KMG B;  4O2A A;  2Z1U A;  3NMU C;  1NMU B;  3WGL A;  3JAL A;  3WXM B;  3QUW A;  4O4H B;  4G4W A;  1K9M H;  2WAL A;  2OTM A;  3JAS B;  2LBT A;  5EZY B;  5LYJ B;  1N8R H;  3WGN A;  2OZB A;  3ERN A;  1YIJ F;  2VAM A;  3MQW A;  1U3P A;  1W2B F;  4M8I A;  5BMV A;  4X1Y B;  3CMA F;  1SA0 B;  3CPQ A;  1YI2 F;  5EYP B;  1TVK A;  1U40 A;  3P4E A;  1W58 1;  3JVH A;  4WBN B;  5JH7 B;  1E7K A;  4B46 A;  3MCA B;  2LCA A;  3VOA A;  3JAK B;  5GIP C;  4O4L B;  1DBF A;  5IYZ A;  2ZF8 A;  4B62 A;  4ZHQ B;  3LWR C;  3VIU A;  3TD3 A;  3K0T A;  4E6E A;  3RA5 A;  4X20 A;  1ODE A;  1PXW A;  2QEX F;  5EO3 A;  3S03 A;  4BVS A;  2DYY A;  5GON B;  1YIT F;  1XHO A;  2UYK A;  3D00 A;  2I6D A;  2HRY A;  4EI8 A;  3QHD A;  4YJ3 B;  4G88 A;  3IR9 A;  2R6R 1;  2Z1E A;  3JAR B;  3WPW A;  4U3J A;  2ZVZ A;  2KTU A;  3V7Q A;  5CB4 A;  5HY0 A;  5J2T B;  3WJR A;  2Z01 A;  2BTU A;  1X52 A;  2GVI A;  2CW4 A;  2IG8 A;  4DRX A;  3FD6 A;  4O4J B;  3VYT C;  4BT2 A;  5G4V C;  3NK7 A;  3I56 F;  1COM A;  5GAP K;  3JAT B;  3UT5 B;  4TV9 A;  1RQ7 A;  4ZOL A;  2EWC A;  2V9Y A;  1XV2 A;  3Q8H A;  4X1I A;  4FFB A;  1U3L A;  3PLA C;  5IYZ B;  1GO1 A;  2HP3 A;  1KD1 H;  1RLG A;  3NK6 A;  3HKE A;  3JAT A;  5MN5 A;  4EB6 B;  4BT7 A;  3F0F A;  5AVM A;  2LBW A;  4IHJ A;  3WPX A;  4C81 A;  3M1X A;  1K8A H;  4WBN A;  3UT5 A;  3J80 M;  1H48 A;  3HKD A;  2ZVY A;  4X1Y A;  3WGJ A;  5GAN K;  5EYP A;  4BT6 A;  5HP8 A;  5IJ0 A;  1NJI H;  1RA4 A;  2GLZ A;  1Q82 H;  5BMV B;  5JVD A;  4YJ3 A;  3U0O A;  3J81 M;  4ZI7 B;  5KX5 A;  4DXD A;  4O4H A;  5ITZ A;  1U43 A;  3PAF A;  1GX1 A;  3CCV F;  3J7A R;  5LOV A;  3TD4 A;  4I50 A;  2CWJ A;  3ON1 A;  4X20 B;  5KMG A;  1Q81 H;  1X7P A;  3LWV C;  1KNJ A;  3P0Z A;  3CCU F;  4KWE A;  4I55 B;  2RB9 A;  2VAP A;  5LA6 A;  3VOB A;  5JQG B;  5C8Y B;  2UYP A;  3K2X A;  2BTO A;  3R0P A;  4BT4 A;  3JAK A;  3HKC A;  1ZWZ A;  3S0Y A;  2N48 A;  4C82 A;  2CZW A;  3C9U A;  4C8I A;  4NUT A;  1FFX B;  4IIJ B;  1R1M A;  1J7H A;  4B5C A;  3VMF B;  2RHH A;  5J2T A;  3IEW A;  4EI7 A;  3DDN A;  3JCM M;  3G71 F;  2RHL A;  2RHO A;  2UYJ A;  3AGK A;  5GIO C;  3GYQ A;  2Q1Y A;  5FNV A;  3RYH B;  2QA4 F;  5LXT A;  1CLI A;  3N4Y A;  5GON A;  3JAW B;  4ERH A;  2Q1X A;  4F6R B;  5CA1 B;  5GIN C;  5IJ9 B;  3FPI A;  2NMU A;  2CVL A;  3D01 A;  2KG4 A;  2Z1T A;  4O2B A;  3HKB B;  3LWO C;  1X7O A;  3K14 A;  1YHQ F;  3VCZ A;  5HY2 A;  2HS4 A;  1FSZ A;  3CD6 F;  1VQO F;  1Q8R A;  2R75 1;  1YJN F;  1S72 F;  1QD9 A;  1VQL F;  3RYI A;  3JAW A;  1VQ5 F;  2DT4 A;  3FFM A;  3E20 B;  4X1K B;  1VHA A;  3KJK A;  4LNU A; 
#chains in the Genus database with same CATH homology
 3Q8H A;  1T0A A;  3F0G A;  3QHD A;  1H47 A;  1U3L A;  1W55 A;  1VH8 A;  3JVH A;  1IV3 A;  3FPI A;  1U43 A;  4C8G A;  1GX1 A;  3KE1 A;  4C82 A;  4C8I A;  3IKF A;  3IKE A;  1IV1 A;  1IV2 A;  3ESJ A;  3MBM A;  3F6M A;  4C8E A;  3F0F A;  4C81 A;  3B6N A;  3EOR A;  3K14 A;  3P10 A;  1YQN A;  3T80 A;  2GZL A;  2UZH A;  3IEW A;  1KNJ A;  1H48 A;  3P0Z A;  3ERN A;  3IEQ A;  3F0D A;  3F0E A;  2AMT A;  1JN1 A;  1IV4 A;  1KNK A;  3ELC A;  3GHZ A;  1U3P A;  5B8F A;  1W57 A;  1JY8 A;  3FBA A;  3K2X A;  1VHA A;  1U40 A;  3RE3 A;  2PMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...