3F0FA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0fA00
1W57A 3F0EA 3MBMA 4C8EA 3K14A 3KE1A 3F0GA 2AMTA 1U3LA 1GX1A 4C8GA 2PMPA 3JVHA 3Q8HA 3RE3A 1H48A 3F0FA 3ESJA 1VH8A 5B8FA 3K2XA 3IEWA 3F6MA 1YQNA 1IV4A 3ELCA 3ERNA 1JY8A 3FPIA 1KNKA 3GHZA 2UZHA 3P10A 4C82A 1W55A 1IV2A 3QHDA 3F0DA 1JN1A 3IEQA 3FBAA 3T80A 3IKEA 1VHAA 1U3PA 3IKFA 1IV3A 3B6NA 1U40A 3EORA 3P0ZA 1T0AA 4C8IA 2GZLA 1IV1A 1KNJA 1U43A 4C81A 1H47A
chains in the Genus database with same CATH superfamily
2H6LA 1W57A 4E6EA 5CA0B 3JARA 3OBYA 2LBWA 3LWPC 3LDTA 4EI9A 4X20B 3S06A 4O4LB 3OW2F 3VYUC 1FNKA 3MDOA 1DT9A 5KMGB 3VMFB 4C82A 3OONA 4NQ3A 2Z01A 4I55A 3CCLF 3WXMB 1VQ6F 2HP0A 3WJQA 1X7OA 1GO0A 3IMPA 4C8EA 3QTYA 5HY0A 3O85A 2R6R1 4I4TA 3JATA 1T0KB 5EO3A 4ERHA 3K12A 4I4TB 5EZYA 4DRXA 5FNVB 5C8YB 1SZQA 1YQNA 3ERNA 5C8YA 4BW0B 5LXTA 3E22B 3IKEA 1RA4A 3CCMF 3N2KB 5LYJA 1X7PA 5IJ9B 1PXWA 3JAWA 4BT7A 3WGMA 1U43A 2F9ZC 4G88A 3LYBA 1OAPA 2HS3A 3CB2A 1TUBA 3I3FA 3RYIA 4B5CA 3S0HA 2VAPA 3K2XA 1QU9A 5HY4A 3JCMM 5KX5A 5GANK 1VQMF 4IIJB 4C4WC 2P6YA 3U0OA 5HY1A 5FLXM 2Z1EA 3C9SA 3JATB 1W40A 4U39A 3E1YA 4BT3A 3TD4A 2OTLF 4O2BA 3C9RA 3CPQA 5HXUA 4YJ3A 1U40A 2GLZA 3V3TA 1K8AH 4X1YB 4IIJA 2BTQB 3CMAF 3CPWF 4TZZA 5IT9M 5IJ9A 2ZAUA 5J2TB 2PMPA 1XRGA 3NK7A 2CW4A 4LNUA 3ESJA 3ON1A 4BT4A 3FD6A 1CK2A 1VQKF 3GYQA 2RHLA 1W581 3GHZA 2UYPA 3TD5A 1JFFA 5DCVA 1W5FA 2RHHA 3B6NA 5JH7A 3HKDA 3LFOA 3JALA 3CG6A 4RQOA 3I7TA 3S0WA 4ZHVA 5CA1A 4G4WA 1IV2A 3MBMA 3M1XA 3KE1A 4M8IA 4X3MA 3DC2A 5J2UB 1GX1A 4X1IB 5KX5B 3VI6A 1VQNF 3UT5A 2CHTA 3MQWA 3HWUA 1VQ7F 5LP6A 3FFMA 2KTUA 4O2BB 2W8BC 4LNUB 2HRUA 4ZHYB 5G4VC 3FBAA 3HKCA 4BT6A 2H8EA 1M90H 1QD9A 2MQEA 4BVRA 3RA5A 5IJ0A 3F0EA 5GONB 3LWVC 4BVQA 2B33A 2Z1FA 4WBNB 5A2QM 1U3LA 4O4HB 3C8LA 3RYCB 3JVHA 3RE3A 4WBNA 4FFBA 2VAMA 5AVMA 1E7KA 2HQSC 3LMEA 1QVFF 2L26A 5EB1B 1JJ2F 3I56F 1NQ3A 4EB6A 1JY8A 3FPIA 3OBWA 3P10A 3PAFA 4ZHQA 4ZI7A 3CCVF 3MCQA 2YXZA 3RYFB 2RB9A 5BMVB 3CCRF 4U3JA 4I50B 5JCOC 5CA1B 5HXZA 3J80M 3D00A 5HY2A 4C8IA 1GZ0A 3HKDB 4G4ZA 3VIUA 3FD5A 3VTIC 1K73H 3DDNA 1TVKB 4EB6B 1RLGA 3D54A 3ZO8A 3CC2F 3HKEA 4NUTA 3IEWA 4BVTA 1H7MA 2CSLA 3HKEB 3JALB 1QVGF 2UZHA 1GO1A 1FFXB 2FGYA 4EI8A 3HKBA 1J7HA 4ZHWA 1U3PA 5FJ4C 2VGNA 1IV3A 4G4VA 4O4JA 2OTJF 1PF5A 3RYHB 1KNJA 3SIUA 2NMUA 1YITF 3E22A 2Z1UA 1UFYA 4O4IA 5GINC 2KG4A 2RHOA 4TV8A 3JAWB 1ODEA 2VXYA 3S02A 4O2AB 5GIPC 2YYEA 5EAZA 5G4UC 4X1KA 2K1SA 3N2GB 3ZP7A 3MCAB 3WGKA 2DYYA 1YI2F 2RHJA 1YJNF 2JNBA 1NJIH 4U3JB 1UI9A 3JAMM 1Q81H 4TV9B 5EYPA 4X1IA 1YJWF 3RYIB 2R751 3VYSC 4YJ2A 2IG8A 3CCQF 3LWQC 5B8FA 2EWCA 1YHQF 1IPAA 2QTPA 3F6MA 5GONA 2CVLA 2LCAA 4TUYA 4TV9A 3WJRA 2PHNA 1W3EX 3T80A 1TVKA 1VHAA 2ZVYA 4IHJA 4ZOLA 3BYQA 2VGMA 2WALA 2BTUA 5EIBC 1VK3A 4F6RB 3P4EA 5BMVA 5LA6A 2UYJA 3G71F 3JAKB 2I6DA 1W2BF 1COMA 2AIZP 5IYZA 1ZWZA 2OHWA 3JAKA 5JCOA 1NMUB 1XBIA 2HX0A 4FFBB 3WGLA 4G4YA 3ZOPA 1KC8H 4RHAA 5MN4A 1SA0A 1W5BA 2CHSA 2UYNA 3VOBA 1JN1A 5HP7A 5JH7B 1FNJA 2Z1TA 3NVKE 3HTNA 3P0ZA 3N4YA 4BY9D 3VO8A 3N2KA 5LYJB 3G6EF 2ZVZA 3L7QA 3QUWA 3CYPB 3K14A 3HKCB 2BTOA 2QI2A 3KIZA 4B46A 3HAXD 2QA4F 4YJ2B 1CN7A 3KJJA 1Z5VA 3UT5B 2FC3A 2ZF8A 3V4DA 1IV4A 4XCQA 3J81M 2VAWA 3HKBB 5LP6C 1RQ7A 1YJ9F 3GTZA 3CXCF 5MN6A 1FFXA 1CLIA 1VQ8F 4R40B 4ZOLB 1OFUA 2GVIA 5LOVA 2HRYA 3CC7F 4BT5A 3JASB 3VCZA 2IAFA 1XV2A 4TUYB 3F0GA 4F6RA 1KD1H 4BVSA 2CZWA 2KGWA 3N4ZA 3Q8HA 1RQ2A 5GAPK 3NK6A 3VOAA 1W41A 2QEXF 1VQ4F 3KHNA 1Z5WA 4X20A 1M1KH 3RYHA 2KTVA 2OTMA 1JFFB 3CYQA 3JASA 3WJPA 4BT2A 4TV8B 2GZLA 2ALEA 3CMEF 4KWEA 2ZODA 1H47A 3C9TA 3K0TA 4X1KB 5HP8A 3WGNA 3JARB 2BO1A 5JQGB 4ZI7B 1RLUA 3CCJF 4X1YA 1SDSA 2G9IA 1VQ5F 2IQQA 4B62A 4LCKA 4O4HA 1W55A 1S72F 2Q1XA 3SIVA 1W5AA 1KQSF 2HS0A 4X3LA 3EORA 1IV1A 4C81A 1SA0B 3IR9A 4O4IB 5HWEA 3M84A 5LP6B 4C8GA 1W5EA 4HNAA 3CC4F 1VH8A 1R1MA 2HP0B 2HVYD 4G4XA 3R0PA 4IHJB 5EZYB 5EYPB 4O4JB 1W59A 1KNKA 3C9UA 5J2UA 2DT4A 3WGJA 5JQGA 3QHDA 3VYTC 2ZOVA 5LA6B 3IKFA 1FSZA 1XHOA 3CCEF 5EB0A 3I55F 4HNAB 3RA6A 2H8CA 1QAHA 3J7AR 2AIFA 1VQLF 5GIOC 3V7EA 4O2AA 1VQOF 5ITZB 1N8RH 4ZHQB 1Q82H 1Q86H 2I6RA 2HS4A 3WPXA 5EIBD 3HJWC 1H48A 3F0FA 3WPWA 1YGYA 3ZP4A 5KMGA 1DBFA 4I50A 1Q7YH 3ELCA 3E20B 3LWOC 3RYCA 5EWRA 1K9MH 2CWJA 3F0DA 5IYZB 1VQ9F 5JVDB 4EI7A 3D01A 1X52A 1VQVA 3LWRC 3NVIB 5JVDA 5LOVB 3CCSF 1T0AA 4YJ3B 4ZK7A 1VQPF 3TD3A 2UYNB 2HP3A 3CD6F 3NMUC 4NWOB 3S03A 5IJ0B 1JD1A 2AMTA 3V7QA 5FNVA 4PWTA 1YIJF 3PLAC 5CB4B 2LBTA 2LBXA 5MN5A 1X25A 1W42A 2Q1YA 2UYKA 3S0YA 3M4SA 1TUBB 2OZBA 4B45A 4DXDA 1Q8RA 3IEQA 4O4LA 5LXTB 2V9YA 3N2GA 2N48A 3RYFA 5J2TA 3KJKA 3CCUF 5CA0A 5CB4A 4DRXB 4I55B 3G4SF 5ITZA 3AGKA 1ONIA
chains in the Genus database with same CATH topology
1W57A 3F0EA 3MBMA 4C8EA 3K14A 3KE1A 3F0GA 2AMTA 1U3LA 1GX1A 4C8GA 2PMPA 3JVHA 3Q8HA 3RE3A 1H48A 3F0FA 3ESJA 1VH8A 5B8FA 3K2XA 3IEWA 3F6MA 1YQNA 1IV4A 3ELCA 3ERNA 1JY8A 3FPIA 1KNKA 3GHZA 2UZHA 3P10A 4C82A 1W55A 1IV2A 3QHDA 3F0DA 1JN1A 3IEQA 3FBAA 3T80A 3IKEA 1VHAA 1U3PA 3IKFA 1IV3A 3B6NA 1U40A 3EORA 3P0ZA 1T0AA 4C8IA 2GZLA 1IV1A 1KNJA 1U43A 4C81A 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W57 A;  3F0E A;  3MBM A;  4C8E A;  3K14 A;  3KE1 A;  3F0G A;  2AMT A;  1U3L A;  1GX1 A;  4C8G A;  2PMP A;  3JVH A;  3Q8H A;  3RE3 A;  1H48 A;  3F0F A;  3ESJ A;  1VH8 A;  5B8F A;  3K2X A;  3IEW A;  3F6M A;  1YQN A;  1IV4 A;  3ELC A;  3ERN A;  1JY8 A;  3FPI A;  1KNK A;  3GHZ A;  2UZH A;  3P10 A;  4C82 A;  1W55 A;  1IV2 A;  3QHD A;  3F0D A;  1JN1 A;  3IEQ A;  3FBA A;  3T80 A;  3IKE A;  1VHA A;  1U3P A;  3IKF A;  1IV3 A;  3B6N A;  1U40 A;  3EOR A;  3P0Z A;  1T0A A;  4C8I A;  2GZL A;  1IV1 A;  1KNJ A;  1U43 A;  4C81 A;  1H47 A; 
#chains in the Genus database with same CATH topology
 2H6L A;  1W57 A;  4E6E A;  5CA0 B;  3JAR A;  3OBY A;  2LBW A;  3LWP C;  3LDT A;  4EI9 A;  4X20 B;  3S06 A;  4O4L B;  3OW2 F;  3VYU C;  1FNK A;  3MDO A;  1DT9 A;  5KMG B;  3VMF B;  4C82 A;  3OON A;  4NQ3 A;  2Z01 A;  4I55 A;  3CCL F;  3WXM B;  1VQ6 F;  2HP0 A;  3WJQ A;  1X7O A;  1GO0 A;  3IMP A;  4C8E A;  3QTY A;  5HY0 A;  3O85 A;  2R6R 1;  4I4T A;  3JAT A;  1T0K B;  5EO3 A;  4ERH A;  3K12 A;  4I4T B;  5EZY A;  4DRX A;  5FNV B;  5C8Y B;  1SZQ A;  1YQN A;  3ERN A;  5C8Y A;  4BW0 B;  5LXT A;  3E22 B;  3IKE A;  1RA4 A;  3CCM F;  3N2K B;  5LYJ A;  1X7P A;  5IJ9 B;  1PXW A;  3JAW A;  4BT7 A;  3WGM A;  1U43 A;  2F9Z C;  4G88 A;  3LYB A;  1OAP A;  2HS3 A;  3CB2 A;  1TUB A;  3I3F A;  3RYI A;  4B5C A;  3S0H A;  2VAP A;  3K2X A;  1QU9 A;  5HY4 A;  3JCM M;  5KX5 A;  5GAN K;  1VQM F;  4IIJ B;  4C4W C;  2P6Y A;  3U0O A;  5HY1 A;  5FLX M;  2Z1E A;  3C9S A;  3JAT B;  1W40 A;  4U39 A;  3E1Y A;  4BT3 A;  3TD4 A;  2OTL F;  4O2B A;  3C9R A;  3CPQ A;  5HXU A;  4YJ3 A;  1U40 A;  2GLZ A;  3V3T A;  1K8A H;  4X1Y B;  4IIJ A;  2BTQ B;  3CMA F;  3CPW F;  4TZZ A;  5IT9 M;  5IJ9 A;  2ZAU A;  5J2T B;  2PMP A;  1XRG A;  3NK7 A;  2CW4 A;  4LNU A;  3ESJ A;  3ON1 A;  4BT4 A;  3FD6 A;  1CK2 A;  1VQK F;  3GYQ A;  2RHL A;  1W58 1;  3GHZ A;  2UYP A;  3TD5 A;  1JFF A;  5DCV A;  1W5F A;  2RHH A;  3B6N A;  5JH7 A;  3HKD A;  3LFO A;  3JAL A;  3CG6 A;  4RQO A;  3I7T A;  3S0W A;  4ZHV A;  5CA1 A;  4G4W A;  1IV2 A;  3MBM A;  3M1X A;  3KE1 A;  4M8I A;  4X3M A;  3DC2 A;  5J2U B;  1GX1 A;  4X1I B;  5KX5 B;  3VI6 A;  1VQN F;  3UT5 A;  2CHT A;  3MQW A;  3HWU A;  1VQ7 F;  5LP6 A;  3FFM A;  2KTU A;  4O2B B;  2W8B C;  4LNU B;  2HRU A;  4ZHY B;  5G4V C;  3FBA A;  3HKC A;  4BT6 A;  2H8E A;  1M90 H;  1QD9 A;  2MQE A;  4BVR A;  3RA5 A;  5IJ0 A;  3F0E A;  5GON B;  3LWV C;  4BVQ A;  2B33 A;  2Z1F A;  4WBN B;  5A2Q M;  1U3L A;  4O4H B;  3C8L A;  3RYC B;  3JVH A;  3RE3 A;  4WBN A;  4FFB A;  2VAM A;  5AVM A;  1E7K A;  2HQS C;  3LME A;  1QVF F;  2L26 A;  5EB1 B;  1JJ2 F;  3I56 F;  1NQ3 A;  4EB6 A;  1JY8 A;  3FPI A;  3OBW A;  3P10 A;  3PAF A;  4ZHQ A;  4ZI7 A;  3CCV F;  3MCQ A;  2YXZ A;  3RYF B;  2RB9 A;  5BMV B;  3CCR F;  4U3J A;  4I50 B;  5JCO C;  5CA1 B;  5HXZ A;  3J80 M;  3D00 A;  5HY2 A;  4C8I A;  1GZ0 A;  3HKD B;  4G4Z A;  3VIU A;  3FD5 A;  3VTI C;  1K73 H;  3DDN A;  1TVK B;  4EB6 B;  1RLG A;  3D54 A;  3ZO8 A;  3CC2 F;  3HKE A;  4NUT A;  3IEW A;  4BVT A;  1H7M A;  2CSL A;  3HKE B;  3JAL B;  1QVG F;  2UZH A;  1GO1 A;  1FFX B;  2FGY A;  4EI8 A;  3HKB A;  1J7H A;  4ZHW A;  1U3P A;  5FJ4 C;  2VGN A;  1IV3 A;  4G4V A;  4O4J A;  2OTJ F;  1PF5 A;  3RYH B;  1KNJ A;  3SIU A;  2NMU A;  1YIT F;  3E22 A;  2Z1U A;  1UFY A;  4O4I A;  5GIN C;  2KG4 A;  2RHO A;  4TV8 A;  3JAW B;  1ODE A;  2VXY A;  3S02 A;  4O2A B;  5GIP C;  2YYE A;  5EAZ A;  5G4U C;  4X1K A;  2K1S A;  3N2G B;  3ZP7 A;  3MCA B;  3WGK A;  2DYY A;  1YI2 F;  2RHJ A;  1YJN F;  2JNB A;  1NJI H;  4U3J B;  1UI9 A;  3JAM M;  1Q81 H;  4TV9 B;  5EYP A;  4X1I A;  1YJW F;  3RYI B;  2R75 1;  3VYS C;  4YJ2 A;  2IG8 A;  3CCQ F;  3LWQ C;  5B8F A;  2EWC A;  1YHQ F;  1IPA A;  2QTP A;  3F6M A;  5GON A;  2CVL A;  2LCA A;  4TUY A;  4TV9 A;  3WJR A;  2PHN A;  1W3E X;  3T80 A;  1TVK A;  1VHA A;  2ZVY A;  4IHJ A;  4ZOL A;  3BYQ A;  2VGM A;  2WAL A;  2BTU A;  5EIB C;  1VK3 A;  4F6R B;  3P4E A;  5BMV A;  5LA6 A;  2UYJ A;  3G71 F;  3JAK B;  2I6D A;  1W2B F;  1COM A;  2AIZ P;  5IYZ A;  1ZWZ A;  2OHW A;  3JAK A;  5JCO A;  1NMU B;  1XBI A;  2HX0 A;  4FFB B;  3WGL A;  4G4Y A;  3ZOP A;  1KC8 H;  4RHA A;  5MN4 A;  1SA0 A;  1W5B A;  2CHS A;  2UYN A;  3VOB A;  1JN1 A;  5HP7 A;  5JH7 B;  1FNJ A;  2Z1T A;  3NVK E;  3HTN A;  3P0Z A;  3N4Y A;  4BY9 D;  3VO8 A;  3N2K A;  5LYJ B;  3G6E F;  2ZVZ A;  3L7Q A;  3QUW A;  3CYP B;  3K14 A;  3HKC B;  2BTO A;  2QI2 A;  3KIZ A;  4B46 A;  3HAX D;  2QA4 F;  4YJ2 B;  1CN7 A;  3KJJ A;  1Z5V A;  3UT5 B;  2FC3 A;  2ZF8 A;  3V4D A;  1IV4 A;  4XCQ A;  3J81 M;  2VAW A;  3HKB B;  5LP6 C;  1RQ7 A;  1YJ9 F;  3GTZ A;  3CXC F;  5MN6 A;  1FFX A;  1CLI A;  1VQ8 F;  4R40 B;  4ZOL B;  1OFU A;  2GVI A;  5LOV A;  2HRY A;  3CC7 F;  4BT5 A;  3JAS B;  3VCZ A;  2IAF A;  1XV2 A;  4TUY B;  3F0G A;  4F6R A;  1KD1 H;  4BVS A;  2CZW A;  2KGW A;  3N4Z A;  3Q8H A;  1RQ2 A;  5GAP K;  3NK6 A;  3VOA A;  1W41 A;  2QEX F;  1VQ4 F;  3KHN A;  1Z5W A;  4X20 A;  1M1K H;  3RYH A;  2KTV A;  2OTM A;  1JFF B;  3CYQ A;  3JAS A;  3WJP A;  4BT2 A;  4TV8 B;  2GZL A;  2ALE A;  3CME F;  4KWE A;  2ZOD A;  1H47 A;  3C9T A;  3K0T A;  4X1K B;  5HP8 A;  3WGN A;  3JAR B;  2BO1 A;  5JQG B;  4ZI7 B;  1RLU A;  3CCJ F;  4X1Y A;  1SDS A;  2G9I A;  1VQ5 F;  2IQQ A;  4B62 A;  4LCK A;  4O4H A;  1W55 A;  1S72 F;  2Q1X A;  3SIV A;  1W5A A;  1KQS F;  2HS0 A;  4X3L A;  3EOR A;  1IV1 A;  4C81 A;  1SA0 B;  3IR9 A;  4O4I B;  5HWE A;  3M84 A;  5LP6 B;  4C8G A;  1W5E A;  4HNA A;  3CC4 F;  1VH8 A;  1R1M A;  2HP0 B;  2HVY D;  4G4X A;  3R0P A;  4IHJ B;  5EZY B;  5EYP B;  4O4J B;  1W59 A;  1KNK A;  3C9U A;  5J2U A;  2DT4 A;  3WGJ A;  5JQG A;  3QHD A;  3VYT C;  2ZOV A;  5LA6 B;  3IKF A;  1FSZ A;  1XHO A;  3CCE F;  5EB0 A;  3I55 F;  4HNA B;  3RA6 A;  2H8C A;  1QAH A;  3J7A R;  2AIF A;  1VQL F;  5GIO C;  3V7E A;  4O2A A;  1VQO F;  5ITZ B;  1N8R H;  4ZHQ B;  1Q82 H;  1Q86 H;  2I6R A;  2HS4 A;  3WPX A;  5EIB D;  3HJW C;  1H48 A;  3F0F A;  3WPW A;  1YGY A;  3ZP4 A;  5KMG A;  1DBF A;  4I50 A;  1Q7Y H;  3ELC A;  3E20 B;  3LWO C;  3RYC A;  5EWR A;  1K9M H;  2CWJ A;  3F0D A;  5IYZ B;  1VQ9 F;  5JVD B;  4EI7 A;  3D01 A;  1X52 A;  1VQV A;  3LWR C;  3NVI B;  5JVD A;  5LOV B;  3CCS F;  1T0A A;  4YJ3 B;  4ZK7 A;  1VQP F;  3TD3 A;  2UYN B;  2HP3 A;  3CD6 F;  3NMU C;  4NWO B;  3S03 A;  5IJ0 B;  1JD1 A;  2AMT A;  3V7Q A;  5FNV A;  4PWT A;  1YIJ F;  3PLA C;  5CB4 B;  2LBT A;  2LBX A;  5MN5 A;  1X25 A;  1W42 A;  2Q1Y A;  2UYK A;  3S0Y A;  3M4S A;  1TUB B;  2OZB A;  4B45 A;  4DXD A;  1Q8R A;  3IEQ A;  4O4L A;  5LXT B;  2V9Y A;  3N2G A;  2N48 A;  3RYF A;  5J2T A;  3KJK A;  3CCU F;  5CA0 A;  5CB4 A;  4DRX B;  4I55 B;  3G4S F;  5ITZ A;  3AGK A;  1ONI A; 
#chains in the Genus database with same CATH homology
 1W57 A;  3F0E A;  3MBM A;  4C8E A;  3K14 A;  3KE1 A;  3F0G A;  2AMT A;  1U3L A;  1GX1 A;  4C8G A;  2PMP A;  3JVH A;  3Q8H A;  3RE3 A;  1H48 A;  3F0F A;  3ESJ A;  1VH8 A;  5B8F A;  3K2X A;  3IEW A;  3F6M A;  1YQN A;  1IV4 A;  3ELC A;  3ERN A;  1JY8 A;  3FPI A;  1KNK A;  3GHZ A;  2UZH A;  3P10 A;  4C82 A;  1W55 A;  1IV2 A;  3QHD A;  3F0D A;  1JN1 A;  3IEQ A;  3FBA A;  3T80 A;  3IKE A;  1VHA A;  1U3P A;  3IKF A;  1IV3 A;  3B6N A;  1U40 A;  3EOR A;  3P0Z A;  1T0A A;  4C8I A;  2GZL A;  1IV1 A;  1KNJ A;  1U43 A;  4C81 A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...