3HTNA

Crystal structure of a putative dna binding protein (bt_1116) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative DNA binding protein (NP_810029.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
molecule keywords Putative DNA binding protein
total genus 38
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 3htnA00
4BT2A 2NMUA 4BT4A 4BT7A 2P6YA 2DT4A 4BT3A 2HX0A 2H6LA 3HWUA 4BT6A 1XV2A 3HTNA 4BT5A
chains in the Genus database with same CATH superfamily
3V7QA 3CC4F 1R1MA 3HWUA 1YHQF 3CG6A 3QTYA 3OONA 5EWRA 5IJ9A 2HP0A 5EAZA 3E20B 3O85A 1YJWF 4B46A 4BY9D 3E1YA 1VQOF 2GVIA 3CB2A 3ELCA 3V4DA 3N2KB 2UYNA 1U43A 2KTVA 2H8EA 3CD6F 4O4LB 3SIUA 3TD3A 1KNJA 1Q86H 1GX1A 3JALB 3PAFA 2DYYA 1QU9A 5LP6B 4WBNB 2LBXA 4EB6A 5FNVA 4G4XA 4NUTA 1VQ4F 3RA5A 3LDTA 3J7AR 5C8YA 4O2AA 2CHSA 4BVRA 3JAMM 3JALA 3MBMA 3B6NA 2CZWA 4LNUB 3ON1A 4C8EA 3J80M 3K14A 1W59A 1X7PA 3OW2F 3QUWA 2CVLA 2HRYA 5IJ9B 2R6R1 5DCVA 4BVQA 3F6MA 3MDOA 3K0TA 2BTOA 1VQLF 2QI2A 3C8LA 4X1YB 3VO8A 1XBIA 3ERNA 1X52A 2LCAA 4IHJA 3NK6A 4TUYA 3M1XA 3RE3A 3P0ZA 1IV3A 2IQQA 3IEQA 1X7OA 1TVKA 4U39A 4X20B 3QHDA 3GHZA 2RHHA 1JD1A 3JVHA 3RYIA 3ZP7A 2ZODA 5GIOC 3MQWA 3CCVF 2KTUA 4BT5A 1NMUB 2ZAUA 5J2TB 3IR9A 4LNUA 1QVGF 1W5FA 3P4EA 3I7TA 1ODEA 5IJ0A 1GO1A 1Z5WA 5GANK 3UT5A 3C9RA 3WJRA 5GINC 3ZOPA 1K8AH 1SA0A 5EIBC 5KX5A 3CCLF 3D01A 2R751 5JH7B 3F0FA 4WBNA 1KC8H 2UZHA 2WALA 4B5CA 4TV8B 2CSLA 4TZZA 1W40A 4U3JA 3FBAA 4TUYB 3LWQC 1Q81H 1CN7A 2HS0A 4C8IA 3RYHA 3EORA 1VQNF 4BT7A 3LWOC 1W5BA 3HKDB 3CCMF 2F9ZC 5EO3A 3RYIB 3RYCA 3S02A 3HAXD 3JARA 4TV9A 3WGKA 3LWPC 4X20A 3VYSC 4HNAB 5LP6A 4I55B 1RLGA 1W2BF 2YXZA 2UYKA 2HP3A 4G4VA 4O4JA 2I6DA 3ESJA 3HJWC 3CYQA 4DRXB 2LBWA 5GAPK 3CCSF 5BMVA 1KQSF 4IHJB 3WGJA 3CPQA 2RHLA 5MN4A 1QVFF 5JH7A 3NK7A 1YIJF 5GONA 1W5EA 5CA0B 4O4HB 3WJQA 4EI9A 3LMEA 3KJKA 4LCKA 4G4ZA 3CCQF 1QAHA 4O2BB 1H48A 5ITZA 1JY8A 3VMFB 3S0WA 4ZI7B 3LFOA 5CA1A 4ZHVA 2QTPA 1S72F 4ZHQA 1VH8A 3D54A 3VYUC 1DT9A 5LYJA 5FLXM 4ZK7A 5KMGB 5EZYB 3NMUC 5JVDB 2ALEA 3P10A 2V9YA 3DC2A 2FC3A 5HY2A 5LXTA 4KWEA 3JAWA 2CHTA 3RYFB 1TUBB 3MCAB 4ZHYB 3F0EA 4IIJB 1W55A 3WGNA 5LOVA 3VCZA 4I50B 3J81M 1RQ2A 5HXUA 5CB4B 5LYJB 1VQKF 1IV4A 4FFBA 2EWCA 5IYZB 2HQSC 2W8BC 2ZOVA 1IV1A 3L7QA 1X25A 1PXWA 5JQGB 3CCJF 1DBFA 3GYQA 2Z1TA 5HP7A 2Z01A 2ZF8A 4F6RB 2H8CA 2OTJF 2N48A 3VOAA 5LP6C 1RA4A 3WXMB 5LA6A 3ZP4A 5C8YB 3SIVA 3CYPB 3LWRC 3OBYA 1NQ3A 4BT4A 3HKBB 5CA0A 3VYTC 3C9SA 1K9MH 4RQOA 1VQ8F 4B45A 4I4TA 5J2UB 5G4VC 3JASA 1ONIA 3LWVC 2Q1YA 3R0PA 3RA6A 3I55F 3HKCA 4BVSA 3HKEB 2OTLF 4X3LA 3LYBA 1FFXA 1U40A 5EYPB 2KG4A 4X1KA 3CCUF 2RHJA 5AVMA 4O4IA 4G88A 3JAKB 1Z5VA 3G71F 4YJ2A 3F0DA 4NWOB 2P6YA 1M1KH 3Q8HA 1OAPA 4DXDA 3BYQA 5EB0A 1H47A 1YGYA 2VGMA 4X3MA 2BTUA 1VQ6F 3KE1A 1W5AA 2VAWA 3FPIA 1KD1H 1VQ5F 3F0GA 2RHOA 2VAPA 2Q1XA 3D00A 5HY1A 1GO0A 3JASB 1SZQA 2AIZP 4ZHQB 1RQ7A 5LA6B 3UT5B 2GLZA 2KGWA 5JVDA 1UI9A 3TD4A 4BT3A 2VXYA 5EZYA 1W41A 3HKBA 1FFXB 5EYPA 4ZHWA 1PF5A 1VQVA 5HP8A 3CC2F 5EIBD 3TD5A 3N4ZA 2PHNA 4C8GA 3HKCB 3VOBA 3CMEF 3CCRF 5LOVB 3KJJA 2B33A 4X1IA 4NQ3A 3DDNA 3G4SF 3M84A 1U3LA 1RLUA 5JQGA 3JAWB 1JFFA 4E6EA 1J7HA 3E22A 5HXZA 3IEWA 5LXTB 2OHWA 1VQMF 1FNJA 2ZVYA 4O4JB 2G9IA 1NJIH 3WJPA 1Q8RA 4HNAA 3KHNA 1T0AA 5CB4A 3JARB 4TV9B 3K2XA 1K73H 1CLIA 2BO1A 5JCOA 3C9TA 2OZBA 4C82A 5IYZA 5HY0A 3VIUA 2HRUA 4DRXA 4C81A 2UYJA 3GTZA 4G4YA 3CC7F 3JAKA 1N8RH 1Q7YH 3NVIB 4M8IA 5J2UA 3JATB 3N2GA 3M4SA 3CXCF 2VAMA 4ZOLA 5GIPC 2CWJA 3KIZA 4XCQA 4TV8A 1U3PA 2GZLA 4PWTA 3N4YA 4X1KB 2I6RA 3FD5A 3IKFA 4ZOLB 3RYFA 1JFFB 3JCMM 3VTIC 1YQNA 2IAFA 4I4TB 2CW4A 2FGYA 2PMPA 4I55A 3CPWF 1W581 3OBWA 1QD9A 1FSZA 4BVTA 5EB1B 5G4UC 4R40B 3HKDA 3K12A 1CK2A 1YI2F 3IMPA 1YJ9F 1T0KB 1VHAA 3I56F 1JJ2F 3MCQA 3RYHB 5GONB 2L26A 4F6RA 2HVYD 1TUBA 1IV2A 1VQPF 1SDSA 2DT4A 3WGLA 1ZWZA 4YJ2B 4O2AB 4O4IB 1JN1A 1GZ0A 4I50A 3C9UA 1FNKA 1XRGA 1XV2A 4IIJA 2QA4F 1XHOA 5KX5B 1YITF 2RB9A 4C4WC 2UYPA 3U0OA 1W3EX 3S03A 5BMVB 2Z1FA 3JATA 3N2GB 5A2QM 2Z1EA 3HTNA 3WPWA 2AMTA 3CMAF 3FD6A 1COMA 3S0HA 2HS3A 3I3FA 1VQ9F 4O2BA 5ITZB 2IG8A 1SA0B 4EI8A 4U3JB 4BT6A 3HKEA 3WPXA 1H7MA 2HP0B 4BT2A 2VGNA 5CA1B 3G6EF 1Q82H 1UFYA 5FJ4C 2BTQB 4B62A 2MQEA 5IT9M 3E22B 2ZVZA 4EI7A 1VK3A 2HX0A 3AGKA 3S0YA 2HS4A 4X1IB 4BW0B 3NVKE 3V7EA 2QEXF 5KMGA 5HY4A 5J2TA 3IKEA 4EB6B 2UYNB 3WGMA 3S06A 1W42A 5B8FA 1KNKA 3RYCB 1M90H 2AIFA 4O4HA 1OFUA 4FFBB 2OTMA 2K1SA 4YJ3B 3CCEF 3FFMA 4G4WA 5IJ0B 1VQ7F 2JNBA 4ERHA 5HWEA 5JCOC 4O4LA 1TVKB 3N2KA 3VI6A 3V3TA 4RHAA 4YJ3A 3T80A 2H6LA 5MN6A 2NMUA 4X1YA 5MN5A 1E7KA 2LBTA 1IPAA 5FNVB 1W57A 1YJNF 3PLAC 3ZO8A 4ZI7A 2YYEA 2Z1UA
chains in the Genus database with same CATH topology
4BT2A 2NMUA 4BT4A 4BT7A 2P6YA 2DT4A 4BT3A 2HX0A 2H6LA 3HWUA 4BT6A 1XV2A 3HTNA 4BT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT2 A;  2NMU A;  4BT4 A;  4BT7 A;  2P6Y A;  2DT4 A;  4BT3 A;  2HX0 A;  2H6L A;  3HWU A;  4BT6 A;  1XV2 A;  3HTN A;  4BT5 A; 
#chains in the Genus database with same CATH topology
 3V7Q A;  3CC4 F;  1R1M A;  3HWU A;  1YHQ F;  3CG6 A;  3QTY A;  3OON A;  5EWR A;  5IJ9 A;  2HP0 A;  5EAZ A;  3E20 B;  3O85 A;  1YJW F;  4B46 A;  4BY9 D;  3E1Y A;  1VQO F;  2GVI A;  3CB2 A;  3ELC A;  3V4D A;  3N2K B;  2UYN A;  1U43 A;  2KTV A;  2H8E A;  3CD6 F;  4O4L B;  3SIU A;  3TD3 A;  1KNJ A;  1Q86 H;  1GX1 A;  3JAL B;  3PAF A;  2DYY A;  1QU9 A;  5LP6 B;  4WBN B;  2LBX A;  4EB6 A;  5FNV A;  4G4X A;  4NUT A;  1VQ4 F;  3RA5 A;  3LDT A;  3J7A R;  5C8Y A;  4O2A A;  2CHS A;  4BVR A;  3JAM M;  3JAL A;  3MBM A;  3B6N A;  2CZW A;  4LNU B;  3ON1 A;  4C8E A;  3J80 M;  3K14 A;  1W59 A;  1X7P A;  3OW2 F;  3QUW A;  2CVL A;  2HRY A;  5IJ9 B;  2R6R 1;  5DCV A;  4BVQ A;  3F6M A;  3MDO A;  3K0T A;  2BTO A;  1VQL F;  2QI2 A;  3C8L A;  4X1Y B;  3VO8 A;  1XBI A;  3ERN A;  1X52 A;  2LCA A;  4IHJ A;  3NK6 A;  4TUY A;  3M1X A;  3RE3 A;  3P0Z A;  1IV3 A;  2IQQ A;  3IEQ A;  1X7O A;  1TVK A;  4U39 A;  4X20 B;  3QHD A;  3GHZ A;  2RHH A;  1JD1 A;  3JVH A;  3RYI A;  3ZP7 A;  2ZOD A;  5GIO C;  3MQW A;  3CCV F;  2KTU A;  4BT5 A;  1NMU B;  2ZAU A;  5J2T B;  3IR9 A;  4LNU A;  1QVG F;  1W5F A;  3P4E A;  3I7T A;  1ODE A;  5IJ0 A;  1GO1 A;  1Z5W A;  5GAN K;  3UT5 A;  3C9R A;  3WJR A;  5GIN C;  3ZOP A;  1K8A H;  1SA0 A;  5EIB C;  5KX5 A;  3CCL F;  3D01 A;  2R75 1;  5JH7 B;  3F0F A;  4WBN A;  1KC8 H;  2UZH A;  2WAL A;  4B5C A;  4TV8 B;  2CSL A;  4TZZ A;  1W40 A;  4U3J A;  3FBA A;  4TUY B;  3LWQ C;  1Q81 H;  1CN7 A;  2HS0 A;  4C8I A;  3RYH A;  3EOR A;  1VQN F;  4BT7 A;  3LWO C;  1W5B A;  3HKD B;  3CCM F;  2F9Z C;  5EO3 A;  3RYI B;  3RYC A;  3S02 A;  3HAX D;  3JAR A;  4TV9 A;  3WGK A;  3LWP C;  4X20 A;  3VYS C;  4HNA B;  5LP6 A;  4I55 B;  1RLG A;  1W2B F;  2YXZ A;  2UYK A;  2HP3 A;  4G4V A;  4O4J A;  2I6D A;  3ESJ A;  3HJW C;  3CYQ A;  4DRX B;  2LBW A;  5GAP K;  3CCS F;  5BMV A;  1KQS F;  4IHJ B;  3WGJ A;  3CPQ A;  2RHL A;  5MN4 A;  1QVF F;  5JH7 A;  3NK7 A;  1YIJ F;  5GON A;  1W5E A;  5CA0 B;  4O4H B;  3WJQ A;  4EI9 A;  3LME A;  3KJK A;  4LCK A;  4G4Z A;  3CCQ F;  1QAH A;  4O2B B;  1H48 A;  5ITZ A;  1JY8 A;  3VMF B;  3S0W A;  4ZI7 B;  3LFO A;  5CA1 A;  4ZHV A;  2QTP A;  1S72 F;  4ZHQ A;  1VH8 A;  3D54 A;  3VYU C;  1DT9 A;  5LYJ A;  5FLX M;  4ZK7 A;  5KMG B;  5EZY B;  3NMU C;  5JVD B;  2ALE A;  3P10 A;  2V9Y A;  3DC2 A;  2FC3 A;  5HY2 A;  5LXT A;  4KWE A;  3JAW A;  2CHT A;  3RYF B;  1TUB B;  3MCA B;  4ZHY B;  3F0E A;  4IIJ B;  1W55 A;  3WGN A;  5LOV A;  3VCZ A;  4I50 B;  3J81 M;  1RQ2 A;  5HXU A;  5CB4 B;  5LYJ B;  1VQK F;  1IV4 A;  4FFB A;  2EWC A;  5IYZ B;  2HQS C;  2W8B C;  2ZOV A;  1IV1 A;  3L7Q A;  1X25 A;  1PXW A;  5JQG B;  3CCJ F;  1DBF A;  3GYQ A;  2Z1T A;  5HP7 A;  2Z01 A;  2ZF8 A;  4F6R B;  2H8C A;  2OTJ F;  2N48 A;  3VOA A;  5LP6 C;  1RA4 A;  3WXM B;  5LA6 A;  3ZP4 A;  5C8Y B;  3SIV A;  3CYP B;  3LWR C;  3OBY A;  1NQ3 A;  4BT4 A;  3HKB B;  5CA0 A;  3VYT C;  3C9S A;  1K9M H;  4RQO A;  1VQ8 F;  4B45 A;  4I4T A;  5J2U B;  5G4V C;  3JAS A;  1ONI A;  3LWV C;  2Q1Y A;  3R0P A;  3RA6 A;  3I55 F;  3HKC A;  4BVS A;  3HKE B;  2OTL F;  4X3L A;  3LYB A;  1FFX A;  1U40 A;  5EYP B;  2KG4 A;  4X1K A;  3CCU F;  2RHJ A;  5AVM A;  4O4I A;  4G88 A;  3JAK B;  1Z5V A;  3G71 F;  4YJ2 A;  3F0D A;  4NWO B;  2P6Y A;  1M1K H;  3Q8H A;  1OAP A;  4DXD A;  3BYQ A;  5EB0 A;  1H47 A;  1YGY A;  2VGM A;  4X3M A;  2BTU A;  1VQ6 F;  3KE1 A;  1W5A A;  2VAW A;  3FPI A;  1KD1 H;  1VQ5 F;  3F0G A;  2RHO A;  2VAP A;  2Q1X A;  3D00 A;  5HY1 A;  1GO0 A;  3JAS B;  1SZQ A;  2AIZ P;  4ZHQ B;  1RQ7 A;  5LA6 B;  3UT5 B;  2GLZ A;  2KGW A;  5JVD A;  1UI9 A;  3TD4 A;  4BT3 A;  2VXY A;  5EZY A;  1W41 A;  3HKB A;  1FFX B;  5EYP A;  4ZHW A;  1PF5 A;  1VQV A;  5HP8 A;  3CC2 F;  5EIB D;  3TD5 A;  3N4Z A;  2PHN A;  4C8G A;  3HKC B;  3VOB A;  3CME F;  3CCR F;  5LOV B;  3KJJ A;  2B33 A;  4X1I A;  4NQ3 A;  3DDN A;  3G4S F;  3M84 A;  1U3L A;  1RLU A;  5JQG A;  3JAW B;  1JFF A;  4E6E A;  1J7H A;  3E22 A;  5HXZ A;  3IEW A;  5LXT B;  2OHW A;  1VQM F;  1FNJ A;  2ZVY A;  4O4J B;  2G9I A;  1NJI H;  3WJP A;  1Q8R A;  4HNA A;  3KHN A;  1T0A A;  5CB4 A;  3JAR B;  4TV9 B;  3K2X A;  1K73 H;  1CLI A;  2BO1 A;  5JCO A;  3C9T A;  2OZB A;  4C82 A;  5IYZ A;  5HY0 A;  3VIU A;  2HRU A;  4DRX A;  4C81 A;  2UYJ A;  3GTZ A;  4G4Y A;  3CC7 F;  3JAK A;  1N8R H;  1Q7Y H;  3NVI B;  4M8I A;  5J2U A;  3JAT B;  3N2G A;  3M4S A;  3CXC F;  2VAM A;  4ZOL A;  5GIP C;  2CWJ A;  3KIZ A;  4XCQ A;  4TV8 A;  1U3P A;  2GZL A;  4PWT A;  3N4Y A;  4X1K B;  2I6R A;  3FD5 A;  3IKF A;  4ZOL B;  3RYF A;  1JFF B;  3JCM M;  3VTI C;  1YQN A;  2IAF A;  4I4T B;  2CW4 A;  2FGY A;  2PMP A;  4I55 A;  3CPW F;  1W58 1;  3OBW A;  1QD9 A;  1FSZ A;  4BVT A;  5EB1 B;  5G4U C;  4R40 B;  3HKD A;  3K12 A;  1CK2 A;  1YI2 F;  3IMP A;  1YJ9 F;  1T0K B;  1VHA A;  3I56 F;  1JJ2 F;  3MCQ A;  3RYH B;  5GON B;  2L26 A;  4F6R A;  2HVY D;  1TUB A;  1IV2 A;  1VQP F;  1SDS A;  2DT4 A;  3WGL A;  1ZWZ A;  4YJ2 B;  4O2A B;  4O4I B;  1JN1 A;  1GZ0 A;  4I50 A;  3C9U A;  1FNK A;  1XRG A;  1XV2 A;  4IIJ A;  2QA4 F;  1XHO A;  5KX5 B;  1YIT F;  2RB9 A;  4C4W C;  2UYP A;  3U0O A;  1W3E X;  3S03 A;  5BMV B;  2Z1F A;  3JAT A;  3N2G B;  5A2Q M;  2Z1E A;  3HTN A;  3WPW A;  2AMT A;  3CMA F;  3FD6 A;  1COM A;  3S0H A;  2HS3 A;  3I3F A;  1VQ9 F;  4O2B A;  5ITZ B;  2IG8 A;  1SA0 B;  4EI8 A;  4U3J B;  4BT6 A;  3HKE A;  3WPX A;  1H7M A;  2HP0 B;  4BT2 A;  2VGN A;  5CA1 B;  3G6E F;  1Q82 H;  1UFY A;  5FJ4 C;  2BTQ B;  4B62 A;  2MQE A;  5IT9 M;  3E22 B;  2ZVZ A;  4EI7 A;  1VK3 A;  2HX0 A;  3AGK A;  3S0Y A;  2HS4 A;  4X1I B;  4BW0 B;  3NVK E;  3V7E A;  2QEX F;  5KMG A;  5HY4 A;  5J2T A;  3IKE A;  4EB6 B;  2UYN B;  3WGM A;  3S06 A;  1W42 A;  5B8F A;  1KNK A;  3RYC B;  1M90 H;  2AIF A;  4O4H A;  1OFU A;  4FFB B;  2OTM A;  2K1S A;  4YJ3 B;  3CCE F;  3FFM A;  4G4W A;  5IJ0 B;  1VQ7 F;  2JNB A;  4ERH A;  5HWE A;  5JCO C;  4O4L A;  1TVK B;  3N2K A;  3VI6 A;  3V3T A;  4RHA A;  4YJ3 A;  3T80 A;  2H6L A;  5MN6 A;  2NMU A;  4X1Y A;  5MN5 A;  1E7K A;  2LBT A;  1IPA A;  5FNV B;  1W57 A;  1YJN F;  3PLA C;  3ZO8 A;  4ZI7 A;  2YYE A;  2Z1U A; 
#chains in the Genus database with same CATH homology
 4BT2 A;  2NMU A;  4BT4 A;  4BT7 A;  2P6Y A;  2DT4 A;  4BT3 A;  2HX0 A;  2H6L A;  3HWU A;  4BT6 A;  1XV2 A;  3HTN A;  4BT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...