3HTNA

Crystal structure of a putative dna binding protein (bt_1116) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA binding protein
publication title Crystal structure of Putative DNA binding protein (NP_810029.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
total genus 38
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 3htnA00
1XV2A 4BT3A 4BT2A 2P6YA 3HWUA 4BT4A 4BT6A 2DT4A 4BT7A 2HX0A 2H6LA 2NMUA 3HTNA 4BT5A
chains in the Genus database with same CATH superfamily
5LP6B 3RYHB 2F9ZC 1YHQF 1VK3A 3OONA 3RYIB 5FLXM 3E1YA 5IJ0B 3CCUF 4O4IA 3LWRC 3G6EF 3SIUA 5CB4A 4DRXA 3JASA 4FFBB 4NUTA 3V7QA 5DCVA 5EO3A 2ZVZA 4ZHQA 4G88A 2RHJA 4O2BB 3WXMB 3K14A 2UYPA 4XCQA 4YJ2B 3ELCA 5EYPB 2PMPA 3IEQA 1QD9A 2W8BC 3HKBA 4B45A 5IT9M 3HAXD 3NVKE 3JARB 1YGYA 3E22A 2GVIA 2JNBA 5AVMA 2AIFA 2LCAA 2HVYD 1XV2A 5HP8A 4WBNA 1X25A 1KNJA 3DC2A 5LXTB 1YITF 2VAWA 5GINC 3NVIB 4I55A 4TV8A 3FPIA 2HP3A 5EIBC 5IJ9A 2H8EA 1SA0B 5EB0A 3CD6F 3CYPB 1KNKA 3RA6A 2OTMA 3CCLF 4HNAA 2BTUA 3EORA 3KE1A 1H47A 3JAKA 2BTQB 2MQEA 2YYEA 2HS3A 3CYQA 3D00A 4FFBA 3M4SA 1NJIH 3JVHA 4U3JB 2CSLA 3VYSC 4M8IA 4BVQA 3RYCB 2LBWA 3WGJA 1VQ8F 1YJ9F 2WALA 5LA6B 2ZVYA 4YJ2A 1CN7A 4I4TB 3S06A 1TUBB 3HKDB 5EYPA 3WPXA 3N2GB 4G4YA 1E7KA 2KG4A 4G4WA 1VHAA 3FBAA 4EI7A 3JARA 2UYNB 1ZWZA 5JQGB 3OBWA 4BT4A 5J2TB 4I50B 4LCKA 2LBTA 2CZWA 2Q1YA 5LYJB 5LXTA 4O4HA 2RHLA 3M1XA 3ZO8A 2N48A 3JCMM 1QVGF 2VGNA 3I7TA 1W581 4F6RB 3T80A 1SA0A 3CPWF 1Q81H 4BVSA 5ITZA 2I6DA 2AMTA 3I55F 1N8RH 1TVKB 1XHOA 1IV1A 2DYYA 5JCOC 3SIVA 3F0FA 2HS4A 5JVDB 3RE3A 3F0DA 4X1KB 4BT7A 5A2QM 3LWOC 2UYJA 5EZYB 2QI2A 2RB9A 1K8AH 4B5CA 1U40A 1QVFF 3MBMA 3CMAF 4U3JA 3N2KB 3J81M 2OZBA 5GIOC 1Q86H 4I4TA 1TUBA 3HKDA 3E20B 4LNUB 3WJPA 5KX5B 3LWVC 4BVRA 3GTZA 3VTIC 1W59A 4IHJB 2UYNA 3RYFB 1M1KH 3KJJA 2YXZA 4I50A 3N4YA 3GHZA 3R0PA 4TUYB 3C9UA 3K12A 4X3MA 5LYJA 5LOVB 3KJKA 1S72F 1T0AA 2VAMA 4YJ3B 3UT5B 2H6LA 3BYQA 5C8YB 3VYTC 4C8IA 2G9IA 3I3FA 4F6RA 4C81A 5GIPC 1VQNF 3V4DA 1TVKA 2KGWA 4X1YB 3ZOPA 1H7MA 3CCJF 3LMEA 1OFUA 1W40A 3CC4F 4O4JB 2ZAUA 1Q82H 1RQ7A 1KQSF 5EZYA 4TZZA 1SDSA 4EB6B 5GANK 1OAPA 1GO0A 5HY2A 3N2KA 1XBIA 4O2AB 4G4ZA 1VQ5F 2VGMA 4NWOB 3PAFA 5JH7A 1Z5WA 2QTPA 3ERNA 2CWJA 5LP6A 2K1SA 3RYHA 3IKEA 5CA1B 3CCMF 4IHJA 3RYIA 3U0OA 4RQOA 5IJ0A 5B8FA 3RYFA 4ERHA 4ZHWA 1CK2A 3D54A 4ZOLB 4ZI7B 5HXUA 4X1IB 4ZHVA 1VQ6F 3M84A 3C8LA 2Z1TA 3QHDA 3UT5A 3K0TA 3WJQA 3CCVF 1RLUA 1IV3A 4O2BA 2Z01A 4X20B 5HY0A 3CPQA 2CVLA 4EI9A 2FC3A 3JALB 1W57A 3IR9A 4X1YA 1YI2F 2I6RA 5GONB 3CXCF 3WGKA 3FD6A 1IPAA 3C9RA 3N4ZA 4EB6A 3O85A 4C4WC 1QAHA 1IV4A 3D01A 3MQWA 4C8EA 3CC7F 1UI9A 2Q1XA 2VXYA 3GYQA 1COMA 4O2AA 4BVTA 1YJWF 3V3TA 2ZODA 1RQ2A 1VQLF 4BY9D 2CHSA 2HRUA 1VH8A 3V7EA 2OHWA 5MN6A 3F0EA 3J7AR 1FNKA 2ZOVA 5CB4B 1YIJF 1UFYA 4E6EA 1W5AA 3OW2F 4IIJB 4EI8A 3S03A 3G71F 2Z1FA 5MN4A 4ZOLA 1VQKF 1W2BF 5EB1B 4B46A 2IQQA 4RHAA 1DT9A 3ON1A 4TV9B 5KMGB 1W55A 2R6R1 3RYCA 3JAMM 3F0GA 3TD4A 4X20A 1NMUB 1R1MA 3PLAC 1K73H 1XRGA 4KWEA 5LA6A 3JAWB 1X7PA 3JALA 3I56F 1JD1A 3N2GA 2B33A 1J7HA 5HY1A 2R751 3G4SF 3HTNA 4BW0B 2HP0B 3AGKA 4WBNB 3C9TA 3VYUC 1K9MH 5JQGA 1M90H 2VAPA 3MDOA 3LWPC 5J2TA 2AIZP 2IG8A 1Q8RA 5HP7A 3CG6A 1RA4A 2QEXF 2GLZA 5J2UB 4G4VA 4BT5A 5EAZA 3LDTA 2V9YA 2Z1EA 1DBFA 1W42A 2QA4F 5HXZA 1JJ2F 3TD3A 5EWRA 3F6MA 1H48A 3JAKB 1U43A 3KIZA 1FFXB 2P6YA 3S0HA 3HKCB 1VQPF 1YJNF 5JVDA 4X1KA 1CLIA 2OTJF 4BT3A 3LWQC 4IIJA 4DXDA 3VMFB 3ZP4A 4C82A 4O4LB 5BMVB 2HX0A 1YQNA 5FJ4C 1Q7YH 1SZQA 1VQ4F 1KD1H 2PHNA 3HWUA 4X3LA 1W5BA 4TV9A 3WGMA 5KMGA 3B6NA 5G4VC 1W3EX 2CW4A 1GO1A 3IMPA 2IAFA 3JAWA 1VQMF 4PWTA 4C8GA 3LFOA 2RHOA 3IEWA 4R40B 1VQ9F 1VQOF 4LNUA 2CHTA 3K2XA 5KX5A 3JATB 2HS0A 5CA0B 1PF5A 2HP0A 3VOAA 1FNJA 5HWEA 2RHHA 2ZF8A 4O4HB 1U3PA 3C9SA 2ALEA 3QUWA 3VI6A 2L26A 3WGNA 4B62A 2OTLF 1VQVA 4TUYA 5MN5A 1JFFB 5LOVA 5LP6C 3WGLA 4YJ3A 3MCQA 3CCSF 5ITZB 5J2UA 5C8YA 3NK6A 1FSZA 3NMUC 2KTVA 3HJWC 3S0YA 1GZ0A 1FFXA 2UZHA 5IYZB 3HKCA 1VQ7F 4O4JA 2EWCA 1ONIA 3FFMA 3FD5A 3NK7A 3WPWA 1GX1A 3ESJA 3S0WA 2KTUA 1NQ3A 5FNVB 5BMVA 4O4LA 3TD5A 3LYBA 4NQ3A 3P0ZA 1JY8A 3Q8HA 3ZP7A 3VCZA 3CCQF 3HKEB 2H8CA 3CC2F 3S02A 1KC8H 4BT2A 1W5FA 4ZHYB 4O4IB 1X52A 4DRXB 3JASB 3L7QA 3JATA 5CA0A 5CA1A 5GAPK 3J80M 4ZHQB 2NMUA 5JCOA 4ZI7A 2LBXA 5EIBD 1RLGA 5HY4A 1PXWA 2DT4A 3P10A 2GZLA 4X1IA 1JFFA 3IKFA 3VOBA 3VO8A 4ZK7A 3P4EA 1Z5VA 3HKBB 3MCAB 1W5EA 2HRYA 3VIUA 3E22B 1ODEA 2FGYA 5IYZA 3WJRA 3CCRF 5GONA 1IV2A 2UYKA 1QU9A 3OBYA 5G4UC 3CMEF 1U3LA 2Z1UA 1JN1A 4U39A 4I55B 4TV8B 5FNVA 1T0KB 3CB2A 2BO1A 3CCEF 3RA5A 5IJ9B 1X7OA 1W41A 5JH7B 3DDNA 3QTYA 4G4XA 3HKEA 4BT6A 2HQSC 3KHNA 4HNAB 2BTOA
chains in the Genus database with same CATH topology
1XV2A 4BT3A 4BT2A 2P6YA 3HWUA 4BT4A 4BT6A 2DT4A 4BT7A 2HX0A 2H6LA 2NMUA 3HTNA 4BT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XV2 A;  4BT3 A;  4BT2 A;  2P6Y A;  3HWU A;  4BT4 A;  4BT6 A;  2DT4 A;  4BT7 A;  2HX0 A;  2H6L A;  2NMU A;  3HTN A;  4BT5 A; 
#chains in the Genus database with same CATH topology
 5LP6 B;  3RYH B;  2F9Z C;  1YHQ F;  1VK3 A;  3OON A;  3RYI B;  5FLX M;  3E1Y A;  5IJ0 B;  3CCU F;  4O4I A;  3LWR C;  3G6E F;  3SIU A;  5CB4 A;  4DRX A;  3JAS A;  4FFB B;  4NUT A;  3V7Q A;  5DCV A;  5EO3 A;  2ZVZ A;  4ZHQ A;  4G88 A;  2RHJ A;  4O2B B;  3WXM B;  3K14 A;  2UYP A;  4XCQ A;  4YJ2 B;  3ELC A;  5EYP B;  2PMP A;  3IEQ A;  1QD9 A;  2W8B C;  3HKB A;  4B45 A;  5IT9 M;  3HAX D;  3NVK E;  3JAR B;  1YGY A;  3E22 A;  2GVI A;  2JNB A;  5AVM A;  2AIF A;  2LCA A;  2HVY D;  1XV2 A;  5HP8 A;  4WBN A;  1X25 A;  1KNJ A;  3DC2 A;  5LXT B;  1YIT F;  2VAW A;  5GIN C;  3NVI B;  4I55 A;  4TV8 A;  3FPI A;  2HP3 A;  5EIB C;  5IJ9 A;  2H8E A;  1SA0 B;  5EB0 A;  3CD6 F;  3CYP B;  1KNK A;  3RA6 A;  2OTM A;  3CCL F;  4HNA A;  2BTU A;  3EOR A;  3KE1 A;  1H47 A;  3JAK A;  2BTQ B;  2MQE A;  2YYE A;  2HS3 A;  3CYQ A;  3D00 A;  4FFB A;  3M4S A;  1NJI H;  3JVH A;  4U3J B;  2CSL A;  3VYS C;  4M8I A;  4BVQ A;  3RYC B;  2LBW A;  3WGJ A;  1VQ8 F;  1YJ9 F;  2WAL A;  5LA6 B;  2ZVY A;  4YJ2 A;  1CN7 A;  4I4T B;  3S06 A;  1TUB B;  3HKD B;  5EYP A;  3WPX A;  3N2G B;  4G4Y A;  1E7K A;  2KG4 A;  4G4W A;  1VHA A;  3FBA A;  4EI7 A;  3JAR A;  2UYN B;  1ZWZ A;  5JQG B;  3OBW A;  4BT4 A;  5J2T B;  4I50 B;  4LCK A;  2LBT A;  2CZW A;  2Q1Y A;  5LYJ B;  5LXT A;  4O4H A;  2RHL A;  3M1X A;  3ZO8 A;  2N48 A;  3JCM M;  1QVG F;  2VGN A;  3I7T A;  1W58 1;  4F6R B;  3T80 A;  1SA0 A;  3CPW F;  1Q81 H;  4BVS A;  5ITZ A;  2I6D A;  2AMT A;  3I55 F;  1N8R H;  1TVK B;  1XHO A;  1IV1 A;  2DYY A;  5JCO C;  3SIV A;  3F0F A;  2HS4 A;  5JVD B;  3RE3 A;  3F0D A;  4X1K B;  4BT7 A;  5A2Q M;  3LWO C;  2UYJ A;  5EZY B;  2QI2 A;  2RB9 A;  1K8A H;  4B5C A;  1U40 A;  1QVF F;  3MBM A;  3CMA F;  4U3J A;  3N2K B;  3J81 M;  2OZB A;  5GIO C;  1Q86 H;  4I4T A;  1TUB A;  3HKD A;  3E20 B;  4LNU B;  3WJP A;  5KX5 B;  3LWV C;  4BVR A;  3GTZ A;  3VTI C;  1W59 A;  4IHJ B;  2UYN A;  3RYF B;  1M1K H;  3KJJ A;  2YXZ A;  4I50 A;  3N4Y A;  3GHZ A;  3R0P A;  4TUY B;  3C9U A;  3K12 A;  4X3M A;  5LYJ A;  5LOV B;  3KJK A;  1S72 F;  1T0A A;  2VAM A;  4YJ3 B;  3UT5 B;  2H6L A;  3BYQ A;  5C8Y B;  3VYT C;  4C8I A;  2G9I A;  3I3F A;  4F6R A;  4C81 A;  5GIP C;  1VQN F;  3V4D A;  1TVK A;  2KGW A;  4X1Y B;  3ZOP A;  1H7M A;  3CCJ F;  3LME A;  1OFU A;  1W40 A;  3CC4 F;  4O4J B;  2ZAU A;  1Q82 H;  1RQ7 A;  1KQS F;  5EZY A;  4TZZ A;  1SDS A;  4EB6 B;  5GAN K;  1OAP A;  1GO0 A;  5HY2 A;  3N2K A;  1XBI A;  4O2A B;  4G4Z A;  1VQ5 F;  2VGM A;  4NWO B;  3PAF A;  5JH7 A;  1Z5W A;  2QTP A;  3ERN A;  2CWJ A;  5LP6 A;  2K1S A;  3RYH A;  3IKE A;  5CA1 B;  3CCM F;  4IHJ A;  3RYI A;  3U0O A;  4RQO A;  5IJ0 A;  5B8F A;  3RYF A;  4ERH A;  4ZHW A;  1CK2 A;  3D54 A;  4ZOL B;  4ZI7 B;  5HXU A;  4X1I B;  4ZHV A;  1VQ6 F;  3M84 A;  3C8L A;  2Z1T A;  3QHD A;  3UT5 A;  3K0T A;  3WJQ A;  3CCV F;  1RLU A;  1IV3 A;  4O2B A;  2Z01 A;  4X20 B;  5HY0 A;  3CPQ A;  2CVL A;  4EI9 A;  2FC3 A;  3JAL B;  1W57 A;  3IR9 A;  4X1Y A;  1YI2 F;  2I6R A;  5GON B;  3CXC F;  3WGK A;  3FD6 A;  1IPA A;  3C9R A;  3N4Z A;  4EB6 A;  3O85 A;  4C4W C;  1QAH A;  1IV4 A;  3D01 A;  3MQW A;  4C8E A;  3CC7 F;  1UI9 A;  2Q1X A;  2VXY A;  3GYQ A;  1COM A;  4O2A A;  4BVT A;  1YJW F;  3V3T A;  2ZOD A;  1RQ2 A;  1VQL F;  4BY9 D;  2CHS A;  2HRU A;  1VH8 A;  3V7E A;  2OHW A;  5MN6 A;  3F0E A;  3J7A R;  1FNK A;  2ZOV A;  5CB4 B;  1YIJ F;  1UFY A;  4E6E A;  1W5A A;  3OW2 F;  4IIJ B;  4EI8 A;  3S03 A;  3G71 F;  2Z1F A;  5MN4 A;  4ZOL A;  1VQK F;  1W2B F;  5EB1 B;  4B46 A;  2IQQ A;  4RHA A;  1DT9 A;  3ON1 A;  4TV9 B;  5KMG B;  1W55 A;  2R6R 1;  3RYC A;  3JAM M;  3F0G A;  3TD4 A;  4X20 A;  1NMU B;  1R1M A;  3PLA C;  1K73 H;  1XRG A;  4KWE A;  5LA6 A;  3JAW B;  1X7P A;  3JAL A;  3I56 F;  1JD1 A;  3N2G A;  2B33 A;  1J7H A;  5HY1 A;  2R75 1;  3G4S F;  3HTN A;  4BW0 B;  2HP0 B;  3AGK A;  4WBN B;  3C9T A;  3VYU C;  1K9M H;  5JQG A;  1M90 H;  2VAP A;  3MDO A;  3LWP C;  5J2T A;  2AIZ P;  2IG8 A;  1Q8R A;  5HP7 A;  3CG6 A;  1RA4 A;  2QEX F;  2GLZ A;  5J2U B;  4G4V A;  4BT5 A;  5EAZ A;  3LDT A;  2V9Y A;  2Z1E A;  1DBF A;  1W42 A;  2QA4 F;  5HXZ A;  1JJ2 F;  3TD3 A;  5EWR A;  3F6M A;  1H48 A;  3JAK B;  1U43 A;  3KIZ A;  1FFX B;  2P6Y A;  3S0H A;  3HKC B;  1VQP F;  1YJN F;  5JVD A;  4X1K A;  1CLI A;  2OTJ F;  4BT3 A;  3LWQ C;  4IIJ A;  4DXD A;  3VMF B;  3ZP4 A;  4C82 A;  4O4L B;  5BMV B;  2HX0 A;  1YQN A;  5FJ4 C;  1Q7Y H;  1SZQ A;  1VQ4 F;  1KD1 H;  2PHN A;  3HWU A;  4X3L A;  1W5B A;  4TV9 A;  3WGM A;  5KMG A;  3B6N A;  5G4V C;  1W3E X;  2CW4 A;  1GO1 A;  3IMP A;  2IAF A;  3JAW A;  1VQM F;  4PWT A;  4C8G A;  3LFO A;  2RHO A;  3IEW A;  4R40 B;  1VQ9 F;  1VQO F;  4LNU A;  2CHT A;  3K2X A;  5KX5 A;  3JAT B;  2HS0 A;  5CA0 B;  1PF5 A;  2HP0 A;  3VOA A;  1FNJ A;  5HWE A;  2RHH A;  2ZF8 A;  4O4H B;  1U3P A;  3C9S A;  2ALE A;  3QUW A;  3VI6 A;  2L26 A;  3WGN A;  4B62 A;  2OTL F;  1VQV A;  4TUY A;  5MN5 A;  1JFF B;  5LOV A;  5LP6 C;  3WGL A;  4YJ3 A;  3MCQ A;  3CCS F;  5ITZ B;  5J2U A;  5C8Y A;  3NK6 A;  1FSZ A;  3NMU C;  2KTV A;  3HJW C;  3S0Y A;  1GZ0 A;  1FFX A;  2UZH A;  5IYZ B;  3HKC A;  1VQ7 F;  4O4J A;  2EWC A;  1ONI A;  3FFM A;  3FD5 A;  3NK7 A;  3WPW A;  1GX1 A;  3ESJ A;  3S0W A;  2KTU A;  1NQ3 A;  5FNV B;  5BMV A;  4O4L A;  3TD5 A;  3LYB A;  4NQ3 A;  3P0Z A;  1JY8 A;  3Q8H A;  3ZP7 A;  3VCZ A;  3CCQ F;  3HKE B;  2H8C A;  3CC2 F;  3S02 A;  1KC8 H;  4BT2 A;  1W5F A;  4ZHY B;  4O4I B;  1X52 A;  4DRX B;  3JAS B;  3L7Q A;  3JAT A;  5CA0 A;  5CA1 A;  5GAP K;  3J80 M;  4ZHQ B;  2NMU A;  5JCO A;  4ZI7 A;  2LBX A;  5EIB D;  1RLG A;  5HY4 A;  1PXW A;  2DT4 A;  3P10 A;  2GZL A;  4X1I A;  1JFF A;  3IKF A;  3VOB A;  3VO8 A;  4ZK7 A;  3P4E A;  1Z5V A;  3HKB B;  3MCA B;  1W5E A;  2HRY A;  3VIU A;  3E22 B;  1ODE A;  2FGY A;  5IYZ A;  3WJR A;  3CCR F;  5GON A;  1IV2 A;  2UYK A;  1QU9 A;  3OBY A;  5G4U C;  3CME F;  1U3L A;  2Z1U A;  1JN1 A;  4U39 A;  4I55 B;  4TV8 B;  5FNV A;  1T0K B;  3CB2 A;  2BO1 A;  3CCE F;  3RA5 A;  5IJ9 B;  1X7O A;  1W41 A;  5JH7 B;  3DDN A;  3QTY A;  4G4X A;  3HKE A;  4BT6 A;  2HQS C;  3KHN A;  4HNA B;  2BTO A; 
#chains in the Genus database with same CATH homology
 1XV2 A;  4BT3 A;  4BT2 A;  2P6Y A;  3HWU A;  4BT4 A;  4BT6 A;  2DT4 A;  4BT7 A;  2HX0 A;  2H6L A;  2NMU A;  3HTN A;  4BT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...