1KNKA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knkA00
3IKFA 3B6NA 3JVHA 4C8GA 3ERNA 3P10A 3Q8HA 1U40A 3T80A 5B8FA 3IEQA 4C8IA 1IV2A 3GHZA 1W57A 1W55A 3F0FA 3ELCA 1T0AA 3IEWA 3KE1A 3QHDA 1JN1A 1GX1A 3EORA 3F0GA 1H48A 4C81A 3IKEA 2GZLA 3P0ZA 3RE3A 1IV1A 3F0EA 3K14A 2AMTA 3K2XA 1IV3A 1VHAA 1VH8A 3MBMA 1U3PA 1U43A 2PMPA 3FBAA 3F6MA 2UZHA 3F0DA 4C82A 1KNKA 1H47A 1JY8A 1YQNA 1IV4A 3FPIA 4C8EA 3ESJA 1U3LA 1KNJA
chains in the Genus database with same CATH superfamily
3JARB 3LWOC 3CCVF 1W41A 1YGYA 2VGMA 2IG8A 2HS4A 5J2UA 1OAPA 2JNBA 1YHQF 4I55B 1W2BF 5EO3A 3CB2A 2GLZA 3CCMF 4G4ZA 3CCQF 3KE1A 2IQQA 3IEWA 3TD5A 2Q1XA 1TVKA 3S0WA 1W59A 2GZLA 3F0EA 5IJ0A 4BVSA 3JARA 4O4HB 5JH7A 1KD1H 3DC2A 1H47A 2HRUA 1JY8A 1W581 1PF5A 4I55A 3MCAB 4WBNB 4KWEA 1GO1A 2UYPA 2YXZA 1JFFB 5LA6B 4ZHWA 5HP8A 1Q7YH 3CG6A 4M8IA 2AIFA 2KGWA 3CCUF 4G4XA 3F0FA 3VYTC 2GVIA 3C9SA 1CN7A 4O4HA 5ITZB 1H48A 3FFMA 4WBNA 3IMPA 3N4ZA 2PMPA 1VQLF 1JFFA 5LA6A 4HNAB 3WPXA 5MN5A 5HP7A 3S0HA 3CXCF 3VYSC 3WXMB 5ITZA 1KC8H 4X3MA 3C8LA 5EYPB 2KTVA 2Z1EA 3LWPC 4DXDA 3EORA 5HY4A 5IJ9B 5MN4A 3HKEB 1XHOA 1IV3A 2RHLA 5EZYB 4BT4A 2OTLF 3VCZA 5LOVB 4X3LA 5EYPA 3HKBB 3N4YA 4C8EA 1RA4A 3OW2F 4G4WA 5HWEA 1N8RH 5MN6A 2Z1FA 3UT5B 3GHZA 3JAMM 3HKEA 3RA6A 2N48A 1W55A 3TD3A 5EZYA 4NQ3A 3MQWA 5LOVA 3LDTA 1XV2A 3HKBA 3ON1A 5LXTB 4O2BB 2VAWA 1GO0A 2PHNA 2ZVZA 1T0KB 2MQEA 4X1IB 3LWVC 2R6R1 3J81M 3UT5A 1W5BA 2FC3A 4BT5A 2UYKA 3PLAC 3OONA 1K9MH 3VOBA 1IV2A 4YJ2B 5LXTA 4O2BA 2HX0A 2IAFA 4X1IA 5IT9M 1SZQA 3CCEF 1NJIH 1FFXB 3K14A 2KTUA 1Q81H 3C9UA 2HQSC 2CZWA 5KMGB 3NK7A 2BO1A 3GTZA 4YJ2A 2LBXA 5HXZA 3RYFA 5B8FA 3JAKA 1XBIA 4B5CA 3NK6A 3KJJA 5JQGB 1FFXA 2RB9A 4LCKA 4BW0B 2AIZP 3CPWF 3N2GB 4E6EA 3JCMM 5KMGA 5GINC 2LCAA 5EB1B 4ZI7B 1W5FA 3RYCB 2QTPA 2UYNB 3FBAA 4O4IB 3KHNA 4R40B 4B45A 3I55F 4B46A 1TUBB 1M90H 3VYUC 1VQVA 5JQGA 3CC4F 4O2AB 1KQSF 3JVHA 3S0YA 1VQMF 3D54A 1VQ7F 3N2GA 2R751 1CLIA 5HY2A 5JVDB 4ZK7A 2DT4A 4ZI7A 5LYJB 3RYCA 1ODEA 1NQ3A 4ERHA 1ZWZA 1YITF 3JASB 2ALEA 3N2KB 3IKEA 1W5AA 1TUBA 1SDSA 2KG4A 4O2AA 1W40A 2OZBA 2BTUA 3LYBA 3LMEA 2Q1YA 3MDOA 1VQ9F 2HP0B 3CPQA 4U39A 3WJRA 5LYJA 5JVDA 5DCVA 4FFBB 1QU9A 4F6RB 3BYQA 1VQ8F 3JASA 3LFOA 4U3JB 4BT2A 2CWJA 3N2KA 3SIVA 1VQKF 2H8CA 4PWTA 4BT7A 3ELCA 5J2TB 3LWQC 3SIUA 1UFYA 2HP0A 2ZOVA 1FSZA 3M4SA 3F0GA 4HNAA 3VOAA 4RHAA 3CCJF 1OFUA 1COMA 3CYPB 1VQOF 2UYJA 1VH8A 2K1SA 1VQ5F 4FFBA 4F6RA 1DBFA 3JATB 3WGKA 5IYZB 3F0DA 5AVMA 1RQ2A 2L26A 3HAXD 2OTJF 5GANK 2CHSA 3MBMA 4TV9B 4TV8B 3FD5A 3PAFA 5J2TA 3P10A 3V3TA 1U40A 5EWRA 5IJ9A 2OHWA 1RQ7A 2YYEA 5GIPC 5GAPK 3JATA 2RHOA 5FJ4C 1DT9A 2ZAUA 3QUWA 2Z1UA 3V4DA 5EB0A 3RE3A 3CMEF 2NMUA 4I4TB 3RYIB 1S72F 1VHAA 1J7HA 4TV9A 4TV8A 1VQPF 3CC7F 3WPWA 3HWUA 1FNKA 2HS3A 1YJ9F 3IR9A 4ZHQB 4O4JB 3HJWC 5C8YB 4C8GA 1Q86H 3J7AR 1W42A 3S06A 1X7OA 1VK3A 3RYIA 3ZO8A 3QHDA 4EB6B 5HXUA 1XRGA 3ZOPA 3HKDB 3FD6A 3I56F 4IHJB 1H7MA 5EIBC 5KX5B 2ZVYA 1NMUB 4O4JA 1U3PA 4BY9D 2CVLA 4BVTA 5A2QM 3CCSF 4G88A 4LNUB 4X1KB 3JAWB 5HY1A 3HTNA 3K0TA 3ZP7A 2QEXF 3VI6A 1YI2F 3IKFA 3WGLA 4EB6A 4X20B 4EI7A 3T80A 3HKDA 2VAPA 3VIUA 3CMAF 4IHJA 3WJQA 2P6YA 5KX5A 1Z5VA 3V7QA 1R1MA 3I7TA 3JALB 4EI8A 2V9YA 3M84A 1GX1A 3U0OA 4LNUA 4X1KA 3JAWA 3WGMA 1K73H 3L7QA 2ZODA 3E20B 5HY0A 3S02A 1X7PA 5GIOC 2F9ZC 1M1KH 4C82A 4ZHYB 5IJ0B 2DYYA 1U3LA 1KNJA 5FLXM 1VQNF 4BT3A 4O4LB 5JH7B 3B6NA 3JALA 3TD4A 2G9IA 2FGYA 4XCQA 1ONIA 1FNJA 4NUTA 1QAHA 2UYNA 4O4IA 4TUYB 4C81A 5FNVB 3VMFB 5JCOA 3E1YA 3G4SF 1Q82H 4EI9A 4YJ3B 3CD6F 2OTMA 4BVQA 4O4LA 3G71F 2HVYD 1YJNF 3K12A 1YJWF 4RQOA 1GZ0A 5CB4B 3CYQA 3WGJA 1PXWA 4TUYA 1E7KA 5FNVA 3LWRC 4YJ3A 3V7EA 2HRYA 2RHHA 5CB4A 4DRXB 4ZOLB 3G6EF 4TZZA 2VGNA 1YIJF 1X25A 3WJPA 1RLUA 2W8BC 5LP6B 5JCOC 2UZHA 3OBWA 4BVRA 2CSLA 4IIJB 4U3JA 3GYQA 3KIZA 1IV4A 3WGNA 4B62A 4ZHVA 3NVIB 1UI9A 4NWOB 2BTOA 3J80M 3NMUC 3E22B 5CA0B 2RHJA 3Q8HA 2WALA 1Q8RA 4DRXA 4ZOLA 1JD1A 3ZP4A 4I50B 1W5EA 3RYHB 1T0AA 5LP6A 3AGKA 1JN1A 4G4YA 3P4EA 5IYZA 4IIJA 2Z1TA 2CHTA 3KJKA 5EIBD 5G4VC 2LBTA 3O85A 2ZF8A 3E22A 5CA0A 2BTQB 5CA1B 3F6MA 3CC2F 1QD9A 5GONB 2H6LA 2Z01A 4I50A 5G4UC 3HKCB 3RYHA 2I6DA 2B33A 3IEQA 4C8IA 4BT6A 1SA0B 5BMVB 3D00A 4I4TA 1W57A 4G4VA 3M1XA 1JJ2F 5CA1A 1RLGA 1W3EX 4X1YB 3VO8A 5GONA 5LP6C 2LBWA 2QA4F 1CK2A 1VQ4F 1IPAA 1IV1A 3K2XA 2AMTA 3VTIC 3RA5A 1K8AH 3HKCA 1U43A 4ZHQA 2QI2A 5EAZA 5C8YA 2EWCA 2VXYA 3S03A 1QVFF 3FPIA 3OBYA 1SA0A 3ESJA 5BMVA 3ERNA 3C9TA 4X1YA 3MCQA 3CCLF 3DDNA 2HS0A 3RYFB 3D01A 2HP3A 3JAKB 3I3FA 2VAMA 5J2UB 2I6RA 1VQ6F 3P0ZA 1X52A 3C9RA 3QTYA 1QVGF 3CCRF 4X20A 3NVKE 1KNKA 1TVKB 3R0PA 2CW4A 2H8EA 4C4WC 1YQNA 1Z5WA
chains in the Genus database with same CATH topology
3IKFA 3B6NA 3JVHA 4C8GA 3ERNA 3P10A 3Q8HA 1U40A 3T80A 5B8FA 3IEQA 4C8IA 1IV2A 3GHZA 1W57A 1W55A 3F0FA 3ELCA 1T0AA 3IEWA 3KE1A 3QHDA 1JN1A 1GX1A 3EORA 3F0GA 1H48A 4C81A 3IKEA 2GZLA 3P0ZA 3RE3A 1IV1A 3F0EA 3K14A 2AMTA 3K2XA 1IV3A 1VHAA 1VH8A 3MBMA 1U3PA 1U43A 2PMPA 3FBAA 3F6MA 2UZHA 3F0DA 4C82A 1KNKA 1H47A 1JY8A 1YQNA 1IV4A 3FPIA 4C8EA 3ESJA 1U3LA 1KNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKF A;  3B6N A;  3JVH A;  4C8G A;  3ERN A;  3P10 A;  3Q8H A;  1U40 A;  3T80 A;  5B8F A;  3IEQ A;  4C8I A;  1IV2 A;  3GHZ A;  1W57 A;  1W55 A;  3F0F A;  3ELC A;  1T0A A;  3IEW A;  3KE1 A;  3QHD A;  1JN1 A;  1GX1 A;  3EOR A;  3F0G A;  1H48 A;  4C81 A;  3IKE A;  2GZL A;  3P0Z A;  3RE3 A;  1IV1 A;  3F0E A;  3K14 A;  2AMT A;  3K2X A;  1IV3 A;  1VHA A;  1VH8 A;  3MBM A;  1U3P A;  1U43 A;  2PMP A;  3FBA A;  3F6M A;  2UZH A;  3F0D A;  4C82 A;  1KNK A;  1H47 A;  1JY8 A;  1YQN A;  1IV4 A;  3FPI A;  4C8E A;  3ESJ A;  1U3L A;  1KNJ A; 
#chains in the Genus database with same CATH topology
 3JAR B;  3LWO C;  3CCV F;  1W41 A;  1YGY A;  2VGM A;  2IG8 A;  2HS4 A;  5J2U A;  1OAP A;  2JNB A;  1YHQ F;  4I55 B;  1W2B F;  5EO3 A;  3CB2 A;  2GLZ A;  3CCM F;  4G4Z A;  3CCQ F;  3KE1 A;  2IQQ A;  3IEW A;  3TD5 A;  2Q1X A;  1TVK A;  3S0W A;  1W59 A;  2GZL A;  3F0E A;  5IJ0 A;  4BVS A;  3JAR A;  4O4H B;  5JH7 A;  1KD1 H;  3DC2 A;  1H47 A;  2HRU A;  1JY8 A;  1W58 1;  1PF5 A;  4I55 A;  3MCA B;  4WBN B;  4KWE A;  1GO1 A;  2UYP A;  2YXZ A;  1JFF B;  5LA6 B;  4ZHW A;  5HP8 A;  1Q7Y H;  3CG6 A;  4M8I A;  2AIF A;  2KGW A;  3CCU F;  4G4X A;  3F0F A;  3VYT C;  2GVI A;  3C9S A;  1CN7 A;  4O4H A;  5ITZ B;  1H48 A;  3FFM A;  4WBN A;  3IMP A;  3N4Z A;  2PMP A;  1VQL F;  1JFF A;  5LA6 A;  4HNA B;  3WPX A;  5MN5 A;  5HP7 A;  3S0H A;  3CXC F;  3VYS C;  3WXM B;  5ITZ A;  1KC8 H;  4X3M A;  3C8L A;  5EYP B;  2KTV A;  2Z1E A;  3LWP C;  4DXD A;  3EOR A;  5HY4 A;  5IJ9 B;  5MN4 A;  3HKE B;  1XHO A;  1IV3 A;  2RHL A;  5EZY B;  4BT4 A;  2OTL F;  3VCZ A;  5LOV B;  4X3L A;  5EYP A;  3HKB B;  3N4Y A;  4C8E A;  1RA4 A;  3OW2 F;  4G4W A;  5HWE A;  1N8R H;  5MN6 A;  2Z1F A;  3UT5 B;  3GHZ A;  3JAM M;  3HKE A;  3RA6 A;  2N48 A;  1W55 A;  3TD3 A;  5EZY A;  4NQ3 A;  3MQW A;  5LOV A;  3LDT A;  1XV2 A;  3HKB A;  3ON1 A;  5LXT B;  4O2B B;  2VAW A;  1GO0 A;  2PHN A;  2ZVZ A;  1T0K B;  2MQE A;  4X1I B;  3LWV C;  2R6R 1;  3J81 M;  3UT5 A;  1W5B A;  2FC3 A;  4BT5 A;  2UYK A;  3PLA C;  3OON A;  1K9M H;  3VOB A;  1IV2 A;  4YJ2 B;  5LXT A;  4O2B A;  2HX0 A;  2IAF A;  4X1I A;  5IT9 M;  1SZQ A;  3CCE F;  1NJI H;  1FFX B;  3K14 A;  2KTU A;  1Q81 H;  3C9U A;  2HQS C;  2CZW A;  5KMG B;  3NK7 A;  2BO1 A;  3GTZ A;  4YJ2 A;  2LBX A;  5HXZ A;  3RYF A;  5B8F A;  3JAK A;  1XBI A;  4B5C A;  3NK6 A;  3KJJ A;  5JQG B;  1FFX A;  2RB9 A;  4LCK A;  4BW0 B;  2AIZ P;  3CPW F;  3N2G B;  4E6E A;  3JCM M;  5KMG A;  5GIN C;  2LCA A;  5EB1 B;  4ZI7 B;  1W5F A;  3RYC B;  2QTP A;  2UYN B;  3FBA A;  4O4I B;  3KHN A;  4R40 B;  4B45 A;  3I55 F;  4B46 A;  1TUB B;  1M90 H;  3VYU C;  1VQV A;  5JQG A;  3CC4 F;  4O2A B;  1KQS F;  3JVH A;  3S0Y A;  1VQM F;  3D54 A;  1VQ7 F;  3N2G A;  2R75 1;  1CLI A;  5HY2 A;  5JVD B;  4ZK7 A;  2DT4 A;  4ZI7 A;  5LYJ B;  3RYC A;  1ODE A;  1NQ3 A;  4ERH A;  1ZWZ A;  1YIT F;  3JAS B;  2ALE A;  3N2K B;  3IKE A;  1W5A A;  1TUB A;  1SDS A;  2KG4 A;  4O2A A;  1W40 A;  2OZB A;  2BTU A;  3LYB A;  3LME A;  2Q1Y A;  3MDO A;  1VQ9 F;  2HP0 B;  3CPQ A;  4U39 A;  3WJR A;  5LYJ A;  5JVD A;  5DCV A;  4FFB B;  1QU9 A;  4F6R B;  3BYQ A;  1VQ8 F;  3JAS A;  3LFO A;  4U3J B;  4BT2 A;  2CWJ A;  3N2K A;  3SIV A;  1VQK F;  2H8C A;  4PWT A;  4BT7 A;  3ELC A;  5J2T B;  3LWQ C;  3SIU A;  1UFY A;  2HP0 A;  2ZOV A;  1FSZ A;  3M4S A;  3F0G A;  4HNA A;  3VOA A;  4RHA A;  3CCJ F;  1OFU A;  1COM A;  3CYP B;  1VQO F;  2UYJ A;  1VH8 A;  2K1S A;  1VQ5 F;  4FFB A;  4F6R A;  1DBF A;  3JAT B;  3WGK A;  5IYZ B;  3F0D A;  5AVM A;  1RQ2 A;  2L26 A;  3HAX D;  2OTJ F;  5GAN K;  2CHS A;  3MBM A;  4TV9 B;  4TV8 B;  3FD5 A;  3PAF A;  5J2T A;  3P10 A;  3V3T A;  1U40 A;  5EWR A;  5IJ9 A;  2OHW A;  1RQ7 A;  2YYE A;  5GIP C;  5GAP K;  3JAT A;  2RHO A;  5FJ4 C;  1DT9 A;  2ZAU A;  3QUW A;  2Z1U A;  3V4D A;  5EB0 A;  3RE3 A;  3CME F;  2NMU A;  4I4T B;  3RYI B;  1S72 F;  1VHA A;  1J7H A;  4TV9 A;  4TV8 A;  1VQP F;  3CC7 F;  3WPW A;  3HWU A;  1FNK A;  2HS3 A;  1YJ9 F;  3IR9 A;  4ZHQ B;  4O4J B;  3HJW C;  5C8Y B;  4C8G A;  1Q86 H;  3J7A R;  1W42 A;  3S06 A;  1X7O A;  1VK3 A;  3RYI A;  3ZO8 A;  3QHD A;  4EB6 B;  5HXU A;  1XRG A;  3ZOP A;  3HKD B;  3FD6 A;  3I56 F;  4IHJ B;  1H7M A;  5EIB C;  5KX5 B;  2ZVY A;  1NMU B;  4O4J A;  1U3P A;  4BY9 D;  2CVL A;  4BVT A;  5A2Q M;  3CCS F;  4G88 A;  4LNU B;  4X1K B;  3JAW B;  5HY1 A;  3HTN A;  3K0T A;  3ZP7 A;  2QEX F;  3VI6 A;  1YI2 F;  3IKF A;  3WGL A;  4EB6 A;  4X20 B;  4EI7 A;  3T80 A;  3HKD A;  2VAP A;  3VIU A;  3CMA F;  4IHJ A;  3WJQ A;  2P6Y A;  5KX5 A;  1Z5V A;  3V7Q A;  1R1M A;  3I7T A;  3JAL B;  4EI8 A;  2V9Y A;  3M84 A;  1GX1 A;  3U0O A;  4LNU A;  4X1K A;  3JAW A;  3WGM A;  1K73 H;  3L7Q A;  2ZOD A;  3E20 B;  5HY0 A;  3S02 A;  1X7P A;  5GIO C;  2F9Z C;  1M1K H;  4C82 A;  4ZHY B;  5IJ0 B;  2DYY A;  1U3L A;  1KNJ A;  5FLX M;  1VQN F;  4BT3 A;  4O4L B;  5JH7 B;  3B6N A;  3JAL A;  3TD4 A;  2G9I A;  2FGY A;  4XCQ A;  1ONI A;  1FNJ A;  4NUT A;  1QAH A;  2UYN A;  4O4I A;  4TUY B;  4C81 A;  5FNV B;  3VMF B;  5JCO A;  3E1Y A;  3G4S F;  1Q82 H;  4EI9 A;  4YJ3 B;  3CD6 F;  2OTM A;  4BVQ A;  4O4L A;  3G71 F;  2HVY D;  1YJN F;  3K12 A;  1YJW F;  4RQO A;  1GZ0 A;  5CB4 B;  3CYQ A;  3WGJ A;  1PXW A;  4TUY A;  1E7K A;  5FNV A;  3LWR C;  4YJ3 A;  3V7E A;  2HRY A;  2RHH A;  5CB4 A;  4DRX B;  4ZOL B;  3G6E F;  4TZZ A;  2VGN A;  1YIJ F;  1X25 A;  3WJP A;  1RLU A;  2W8B C;  5LP6 B;  5JCO C;  2UZH A;  3OBW A;  4BVR A;  2CSL A;  4IIJ B;  4U3J A;  3GYQ A;  3KIZ A;  1IV4 A;  3WGN A;  4B62 A;  4ZHV A;  3NVI B;  1UI9 A;  4NWO B;  2BTO A;  3J80 M;  3NMU C;  3E22 B;  5CA0 B;  2RHJ A;  3Q8H A;  2WAL A;  1Q8R A;  4DRX A;  4ZOL A;  1JD1 A;  3ZP4 A;  4I50 B;  1W5E A;  3RYH B;  1T0A A;  5LP6 A;  3AGK A;  1JN1 A;  4G4Y A;  3P4E A;  5IYZ A;  4IIJ A;  2Z1T A;  2CHT A;  3KJK A;  5EIB D;  5G4V C;  2LBT A;  3O85 A;  2ZF8 A;  3E22 A;  5CA0 A;  2BTQ B;  5CA1 B;  3F6M A;  3CC2 F;  1QD9 A;  5GON B;  2H6L A;  2Z01 A;  4I50 A;  5G4U C;  3HKC B;  3RYH A;  2I6D A;  2B33 A;  3IEQ A;  4C8I A;  4BT6 A;  1SA0 B;  5BMV B;  3D00 A;  4I4T A;  1W57 A;  4G4V A;  3M1X A;  1JJ2 F;  5CA1 A;  1RLG A;  1W3E X;  4X1Y B;  3VO8 A;  5GON A;  5LP6 C;  2LBW A;  2QA4 F;  1CK2 A;  1VQ4 F;  1IPA A;  1IV1 A;  3K2X A;  2AMT A;  3VTI C;  3RA5 A;  1K8A H;  3HKC A;  1U43 A;  4ZHQ A;  2QI2 A;  5EAZ A;  5C8Y A;  2EWC A;  2VXY A;  3S03 A;  1QVF F;  3FPI A;  3OBY A;  1SA0 A;  3ESJ A;  5BMV A;  3ERN A;  3C9T A;  4X1Y A;  3MCQ A;  3CCL F;  3DDN A;  2HS0 A;  3RYF B;  3D01 A;  2HP3 A;  3JAK B;  3I3F A;  2VAM A;  5J2U B;  2I6R A;  1VQ6 F;  3P0Z A;  1X52 A;  3C9R A;  3QTY A;  1QVG F;  3CCR F;  4X20 A;  3NVK E;  1KNK A;  1TVK B;  3R0P A;  2CW4 A;  2H8E A;  4C4W C;  1YQN A;  1Z5W A; 
#chains in the Genus database with same CATH homology
 3IKF A;  3B6N A;  3JVH A;  4C8G A;  3ERN A;  3P10 A;  3Q8H A;  1U40 A;  3T80 A;  5B8F A;  3IEQ A;  4C8I A;  1IV2 A;  3GHZ A;  1W57 A;  1W55 A;  3F0F A;  3ELC A;  1T0A A;  3IEW A;  3KE1 A;  3QHD A;  1JN1 A;  1GX1 A;  3EOR A;  3F0G A;  1H48 A;  4C81 A;  3IKE A;  2GZL A;  3P0Z A;  3RE3 A;  1IV1 A;  3F0E A;  3K14 A;  2AMT A;  3K2X A;  1IV3 A;  1VHA A;  1VH8 A;  3MBM A;  1U3P A;  1U43 A;  2PMP A;  3FBA A;  3F6M A;  2UZH A;  3F0D A;  4C82 A;  1KNK A;  1H47 A;  1JY8 A;  1YQN A;  1IV4 A;  3FPI A;  4C8E A;  3ESJ A;  1U3L A;  1KNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...