1KNKA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
b'MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Metal binding protein
source organism Escherichia coli
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
total genus 38
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knkA00
1U3LA 1W55A 1U3PA 1VH8A 5B8FA 1IV4A 1H47A 1W57A 1U40A 3F0GA 3GHZA 3IKFA 3JVHA 3K14A 4C8EA 3B6NA 3IKEA 1JY8A 2PMPA 2GZLA 3Q8HA 1IV2A 1YQNA 3RE3A 3QHDA 1JN1A 3EORA 4C8GA 1GX1A 3F6MA 4C82A 3IEQA 1T0AA 1IV1A 3ERNA 3FBAA 3T80A 3F0DA 3K2XA 4C8IA 1KNKA 1VHAA 3IEWA 3KE1A 3MBMA 1H48A 4C81A 3F0FA 2UZHA 3P0ZA 3F0EA 3P10A 2AMTA 3FPIA 1KNJA 1U43A 1IV3A 3ESJA 3ELCA
chains in the Genus database with same CATH superfamily
1CN7A 2CSLA 5B8FA 3HKBA 1U40A 4ZOLB 4BT5A 1XRGA 4RQOA 5LA6B 3ZP4A 4TV8B 3B6NA 5G4VC 1W3EX 1W42A 2Q1XA 4ZI7B 1Q81H 3WJQA 1SZQA 3E22B 5HP8A 3ERNA 2VAPA 4EI7A 5EIBC 2HS3A 2OTLF 3JATB 5JH7A 4M8IA 3S03A 2PHNA 2AMTA 3CCQF 3OW2F 1Z5VA 3JATA 4F6RB 3U0OA 3CC2F 3CYPB 2H6LA 4O4HA 2I6RA 1JJ2F 3F0GA 4C8EA 5J2UB 3K14A 3MCQA 5HXZA 3CCSF 1IV2A 1YQNA 4C8GA 4F6RA 1ZWZA 3N2KA 3JAKA 4U39A 2CW4A 1CLIA 3JASA 1W41A 1PF5A 3FBAA 5DCVA 3LWPC 3WGKA 1W581 4PWTA 5EB1B 4G4VA 1RLGA 2EWCA 4X1IB 1VQ9F 3CC7F 1W5EA 3G6EF 5KMGA 2ZVYA 2AIZP 4BT6A 2ALEA 4DRXB 1Q86H 3JVHA 1DT9A 5HXUA 5FJ4C 1RQ7A 1VQMF 1UI9A 5J2TA 5CA0A 3D54A 2LBTA 1X7PA 4ZK7A 3CCLF 1RQ2A 3FD5A 1GO1A 4TV9B 5LYJA 5HY4A 5BMVA 2R751 4C8IA 1CK2A 4B5CA 1UFYA 4G4ZA 1E7KA 3HKBB 5AVMA 2BO1A 3E1YA 5HY2A 3RYHA 1W57A 4IHJB 5MN5A 1YI2F 2PMPA 4KWEA 3OBYA 3JAMM 3BYQA 4WBNA 4U3JB 4TV8A 3WGLA 3HKDA 2RHHA 3N4ZA 1X25A 4YJ3B 3CCMF 1VQKF 3D00A 1YHQF 1W40A 2IG8A 3E20B 2HVYD 5IJ0B 2BTQB 2HS0A 1K8AH 3CD6F 3K0TA 4FFBB 4NWOB 5IYZA 2UYNA 3DC2A 1VQLF 4IHJA 3NK6A 3VO8A 3M1XA 5JCOC 3LWRC 3EORA 1RA4A 2I6DA 1VQOF 4O4JB 4E6EA 5J2TB 4BY9D 5EZYA 3NMUC 3IMPA 3I3FA 3ZP7A 2ZODA 3MBMA 3UT5A 2IAFA 1XBIA 4DXDA 3P10A 4X3MA 2HRUA 1X7OA 2CVLA 5EYPA 3WJRA 3CPWF 3PAFA 3TD3A 2WALA 1Z5WA 2LBXA 5LA6A 1FSZA 2P6YA 5JH7B 1K73H 3IKFA 4XCQA 4BVSA 5IJ9B 5ITZB 3CC4F 3CMAF 5LXTA 3C9TA 4X1KB 1VK3A 2NMUA 3S02A 3K2XA 2ZAUA 3KE1A 3IEWA 4ZOLA 5MN4A 3F0FA 3JASB 5EZYB 2GVIA 1YITF 3J80M 3NVKE 3I7TA 2B33A 3JALA 5JQGB 4G4WA 4LNUB 3HTNA 2CWJA 5EIBD 4ZHQA 3LWOC 3NK7A 4I50A 3NVIB 2OTMA 3TD5A 5C8YA 1OAPA 1Q7YH 3KJJA 3IR9A 3QHDA 1FFXA 5KX5B 2HQSC 1QVGF 3RYIB 1SA0B 2Z1TA 2G9IA 1IV1A 5GIOC 2OZBA 1X52A 4BT7A 3D01A 5IYZB 5KMGB 1YIJF 1KNJA 2YYEA 2IQQA 3LFOA 3VOBA 3ZOPA 3CCUF 1FNJA 1U3PA 5LP6B 5EAZA 3IKEA 3HKCA 3LWVC 3WGMA 2VGNA 2ZF8A 4B62A 4NUTA 3S0WA 1NQ3A 1OFUA 1QAHA 3JARB 3C9SA 3CB2A 2Z01A 3MCAB 2BTOA 5JVDB 3RYCB 2RB9A 1W5BA 2UZHA 2AIFA 3HAXD 4IIJA 3M84A 2CHTA 4I4TA 3VYTC 1ODEA 5EO3A 3K12A 4X20B 4BT4A 3R0PA 5FNVB 2ZOVA 3Q8HA 2QI2A 3GTZA 4FFBA 4X1YA 3WXMB 3QUWA 4ZHVA 5LP6A 4O2AA 1GZ0A 3IEQA 2KTVA 4EI9A 3I55F 4I55A 4TUYB 4LNUA 4O2BB 5CA1B 3CG6A 3S0HA 4O4IA 5IJ9A 3LYBA 2RHJA 3HKCB 1U43A 4YJ3A 3VYSC 4TUYA 3C9UA 3KHNA 1QU9A 3MDOA 3P4EA 4BW0B 1VH8A 5EYPB 2QEXF 3FFMA 2HRYA 3G4SF 2RHLA 3JAWA 1DBFA 1QD9A 4HNAA 1GX1A 3CYQA 3JCMM 4BVQA 3J7AR 5JQGA 2HS4A 4O2BA 2Z1EA 4ZHWA 5CA1A 3N2KB 1NJIH 1NMUB 2Z1UA 1VHAA 1TVKB 1H48A 1JFFB 1YGYA 1K9MH 4BT2A 3VMFB 3SIUA 2GLZA 5LYJB 1VQ7F 2RHOA 2L26A 3GYQA 3HKEA 3HWUA 3VOAA 5HWEA 1N8RH 1M1KH 2VXYA 3WPXA 1IV4A 4X3LA 2VAMA 5GONB 2GZLA 3CXCF 3LMEA 4ERHA 3RA5A 3LDTA 1VQ5F 3HKDB 3JAWB 2HP0A 4YJ2A 4NQ3A 1XHOA 2OHWA 3N2GA 4X1KA 1TUBB 3PLAC 1J7HA 5LP6C 5ITZA 1VQVA 2KG4A 3RYHB 5HP7A 2N48A 4O4IB 1U3LA 2Q1YA 2LBWA 4G4YA 1KQSF 3J81M 3V7EA 1TUBA 4G4XA 3GHZA 1YJ9F 3VIUA 3M4SA 5EB0A 3N4YA 4O2AB 2UYNB 5BMVB 5CB4A 4BT3A 3VI6A 1S72F 3C9RA 4C82A 4X20A 2QA4F 2R6R1 5EWRA 4ZHQB 1FNKA 3OBWA 2VAWA 3JALB 3FD6A 4C81A 1SA0A 2QTPA 3P0ZA 3F0EA 1W5FA 5JCOA 3ZO8A 3HJWC 3MQWA 2H8EA 3RYCA 5CB4B 2MQEA 2YXZA 5GAPK 3DDNA 4C4WC 1IPAA 4YJ2B 2H8CA 3JARA 3RYFA 1VQNF 1PXWA 2CHSA 3RE3A 2KGWA 3TD4A 3ON1A 1JD1A 3VYUC 4O4LB 4R40B 4ZHYB 4G88A 1R1MA 1T0AA 3C8LA 3KJKA 4U3JA 2FC3A 3RYFB 2VGMA 3WGNA 3AGKA 4EB6B 2UYJA 2KTUA 4O4HB 2HP0B 1W2BF 2OTJF 3ESJA 3ELCA 5MN6A 2LCAA 4RHAA 5IT9M 3CCEF 1TVKA 3QTYA 5LOVB 2BTUA 1KC8H 4B46A 5GONA 3CCVF 4O4JA 4B45A 1JY8A 3CMEF 4IIJB 3RYIA 3VTIC 1JN1A 5GANK 1T0KB 5J2UA 3SIVA 2HX0A 2K1SA 4X1YB 2DT4A 2UYKA 3I56F 3F0DA 4X1IA 4BVTA 2F9ZC 1YJNF 1GO0A 5LXTB 2CZWA 3FPIA 5CA0B 1IV3A 4DRXA 4LCKA 5FLXM 4O4LA 2V9YA 5GIPC 1ONIA 4HNAB 4TZZA 3S06A 3E22A 1Q8RA 3V4DA 1KD1H 1VQ4F 5JVDA 4WBNB 4I55B 1Q82H 3N2GB 3V3TA 1M90H 1H7MA 2UYPA 3UT5B 3CCJF 1SDSA 2JNBA 3F6MA 5FNVA 2DYYA 5HY0A 1VQ6F 5G4UC 3RA6A 3WGJA 1KNKA 3JAKB 3LWQC 2W8BC 3O85A 3HKEB 1VQPF 1VQ8F 5C8YB 3WPWA 1W55A 2HP3A 3V7QA 1JFFA 4BVRA 1H47A 3CCRF 4EI8A 3G71F 3L7QA 5IJ0A 3KIZA 2Z1FA 4I4TB 1COMA 3OONA 1RLUA 3CPQA 5LOVA 1FFXB 5KX5A 5GINC 5HY1A 1W59A 3WJPA 3S0YA 1QVFF 3T80A 5A2QM 4TV9A 4ZI7A 4I50B 3VCZA 1XV2A 2FGYA 1YJWF 4EB6A 1W5AA 2ZVZA
chains in the Genus database with same CATH topology
1U3LA 1W55A 1U3PA 1VH8A 5B8FA 1IV4A 1H47A 1W57A 1U40A 3F0GA 3GHZA 3IKFA 3JVHA 3K14A 4C8EA 3B6NA 3IKEA 1JY8A 2PMPA 2GZLA 3Q8HA 1IV2A 1YQNA 3RE3A 3QHDA 1JN1A 3EORA 4C8GA 1GX1A 3F6MA 4C82A 3IEQA 1T0AA 1IV1A 3ERNA 3FBAA 3T80A 3F0DA 3K2XA 4C8IA 1KNKA 1VHAA 3IEWA 3KE1A 3MBMA 1H48A 4C81A 3F0FA 2UZHA 3P0ZA 3F0EA 3P10A 2AMTA 3FPIA 1KNJA 1U43A 1IV3A 3ESJA 3ELCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  1W55 A;  1U3P A;  1VH8 A;  5B8F A;  1IV4 A;  1H47 A;  1W57 A;  1U40 A;  3F0G A;  3GHZ A;  3IKF A;  3JVH A;  3K14 A;  4C8E A;  3B6N A;  3IKE A;  1JY8 A;  2PMP A;  2GZL A;  3Q8H A;  1IV2 A;  1YQN A;  3RE3 A;  3QHD A;  1JN1 A;  3EOR A;  4C8G A;  1GX1 A;  3F6M A;  4C82 A;  3IEQ A;  1T0A A;  1IV1 A;  3ERN A;  3FBA A;  3T80 A;  3F0D A;  3K2X A;  4C8I A;  1KNK A;  1VHA A;  3IEW A;  3KE1 A;  3MBM A;  1H48 A;  4C81 A;  3F0F A;  2UZH A;  3P0Z A;  3F0E A;  3P10 A;  2AMT A;  3FPI A;  1KNJ A;  1U43 A;  1IV3 A;  3ESJ A;  3ELC A; 
#chains in the Genus database with same CATH topology
 1CN7 A;  2CSL A;  5B8F A;  3HKB A;  1U40 A;  4ZOL B;  4BT5 A;  1XRG A;  4RQO A;  5LA6 B;  3ZP4 A;  4TV8 B;  3B6N A;  5G4V C;  1W3E X;  1W42 A;  2Q1X A;  4ZI7 B;  1Q81 H;  3WJQ A;  1SZQ A;  3E22 B;  5HP8 A;  3ERN A;  2VAP A;  4EI7 A;  5EIB C;  2HS3 A;  2OTL F;  3JAT B;  5JH7 A;  4M8I A;  3S03 A;  2PHN A;  2AMT A;  3CCQ F;  3OW2 F;  1Z5V A;  3JAT A;  4F6R B;  3U0O A;  3CC2 F;  3CYP B;  2H6L A;  4O4H A;  2I6R A;  1JJ2 F;  3F0G A;  4C8E A;  5J2U B;  3K14 A;  3MCQ A;  5HXZ A;  3CCS F;  1IV2 A;  1YQN A;  4C8G A;  4F6R A;  1ZWZ A;  3N2K A;  3JAK A;  4U39 A;  2CW4 A;  1CLI A;  3JAS A;  1W41 A;  1PF5 A;  3FBA A;  5DCV A;  3LWP C;  3WGK A;  1W58 1;  4PWT A;  5EB1 B;  4G4V A;  1RLG A;  2EWC A;  4X1I B;  1VQ9 F;  3CC7 F;  1W5E A;  3G6E F;  5KMG A;  2ZVY A;  2AIZ P;  4BT6 A;  2ALE A;  4DRX B;  1Q86 H;  3JVH A;  1DT9 A;  5HXU A;  5FJ4 C;  1RQ7 A;  1VQM F;  1UI9 A;  5J2T A;  5CA0 A;  3D54 A;  2LBT A;  1X7P A;  4ZK7 A;  3CCL F;  1RQ2 A;  3FD5 A;  1GO1 A;  4TV9 B;  5LYJ A;  5HY4 A;  5BMV A;  2R75 1;  4C8I A;  1CK2 A;  4B5C A;  1UFY A;  4G4Z A;  1E7K A;  3HKB B;  5AVM A;  2BO1 A;  3E1Y A;  5HY2 A;  3RYH A;  1W57 A;  4IHJ B;  5MN5 A;  1YI2 F;  2PMP A;  4KWE A;  3OBY A;  3JAM M;  3BYQ A;  4WBN A;  4U3J B;  4TV8 A;  3WGL A;  3HKD A;  2RHH A;  3N4Z A;  1X25 A;  4YJ3 B;  3CCM F;  1VQK F;  3D00 A;  1YHQ F;  1W40 A;  2IG8 A;  3E20 B;  2HVY D;  5IJ0 B;  2BTQ B;  2HS0 A;  1K8A H;  3CD6 F;  3K0T A;  4FFB B;  4NWO B;  5IYZ A;  2UYN A;  3DC2 A;  1VQL F;  4IHJ A;  3NK6 A;  3VO8 A;  3M1X A;  5JCO C;  3LWR C;  3EOR A;  1RA4 A;  2I6D A;  1VQO F;  4O4J B;  4E6E A;  5J2T B;  4BY9 D;  5EZY A;  3NMU C;  3IMP A;  3I3F A;  3ZP7 A;  2ZOD A;  3MBM A;  3UT5 A;  2IAF A;  1XBI A;  4DXD A;  3P10 A;  4X3M A;  2HRU A;  1X7O A;  2CVL A;  5EYP A;  3WJR A;  3CPW F;  3PAF A;  3TD3 A;  2WAL A;  1Z5W A;  2LBX A;  5LA6 A;  1FSZ A;  2P6Y A;  5JH7 B;  1K73 H;  3IKF A;  4XCQ A;  4BVS A;  5IJ9 B;  5ITZ B;  3CC4 F;  3CMA F;  5LXT A;  3C9T A;  4X1K B;  1VK3 A;  2NMU A;  3S02 A;  3K2X A;  2ZAU A;  3KE1 A;  3IEW A;  4ZOL A;  5MN4 A;  3F0F A;  3JAS B;  5EZY B;  2GVI A;  1YIT F;  3J80 M;  3NVK E;  3I7T A;  2B33 A;  3JAL A;  5JQG B;  4G4W A;  4LNU B;  3HTN A;  2CWJ A;  5EIB D;  4ZHQ A;  3LWO C;  3NK7 A;  4I50 A;  3NVI B;  2OTM A;  3TD5 A;  5C8Y A;  1OAP A;  1Q7Y H;  3KJJ A;  3IR9 A;  3QHD A;  1FFX A;  5KX5 B;  2HQS C;  1QVG F;  3RYI B;  1SA0 B;  2Z1T A;  2G9I A;  1IV1 A;  5GIO C;  2OZB A;  1X52 A;  4BT7 A;  3D01 A;  5IYZ B;  5KMG B;  1YIJ F;  1KNJ A;  2YYE A;  2IQQ A;  3LFO A;  3VOB A;  3ZOP A;  3CCU F;  1FNJ A;  1U3P A;  5LP6 B;  5EAZ A;  3IKE A;  3HKC A;  3LWV C;  3WGM A;  2VGN A;  2ZF8 A;  4B62 A;  4NUT A;  3S0W A;  1NQ3 A;  1OFU A;  1QAH A;  3JAR B;  3C9S A;  3CB2 A;  2Z01 A;  3MCA B;  2BTO A;  5JVD B;  3RYC B;  2RB9 A;  1W5B A;  2UZH A;  2AIF A;  3HAX D;  4IIJ A;  3M84 A;  2CHT A;  4I4T A;  3VYT C;  1ODE A;  5EO3 A;  3K12 A;  4X20 B;  4BT4 A;  3R0P A;  5FNV B;  2ZOV A;  3Q8H A;  2QI2 A;  3GTZ A;  4FFB A;  4X1Y A;  3WXM B;  3QUW A;  4ZHV A;  5LP6 A;  4O2A A;  1GZ0 A;  3IEQ A;  2KTV A;  4EI9 A;  3I55 F;  4I55 A;  4TUY B;  4LNU A;  4O2B B;  5CA1 B;  3CG6 A;  3S0H A;  4O4I A;  5IJ9 A;  3LYB A;  2RHJ A;  3HKC B;  1U43 A;  4YJ3 A;  3VYS C;  4TUY A;  3C9U A;  3KHN A;  1QU9 A;  3MDO A;  3P4E A;  4BW0 B;  1VH8 A;  5EYP B;  2QEX F;  3FFM A;  2HRY A;  3G4S F;  2RHL A;  3JAW A;  1DBF A;  1QD9 A;  4HNA A;  1GX1 A;  3CYQ A;  3JCM M;  4BVQ A;  3J7A R;  5JQG A;  2HS4 A;  4O2B A;  2Z1E A;  4ZHW A;  5CA1 A;  3N2K B;  1NJI H;  1NMU B;  2Z1U A;  1VHA A;  1TVK B;  1H48 A;  1JFF B;  1YGY A;  1K9M H;  4BT2 A;  3VMF B;  3SIU A;  2GLZ A;  5LYJ B;  1VQ7 F;  2RHO A;  2L26 A;  3GYQ A;  3HKE A;  3HWU A;  3VOA A;  5HWE A;  1N8R H;  1M1K H;  2VXY A;  3WPX A;  1IV4 A;  4X3L A;  2VAM A;  5GON B;  2GZL A;  3CXC F;  3LME A;  4ERH A;  3RA5 A;  3LDT A;  1VQ5 F;  3HKD B;  3JAW B;  2HP0 A;  4YJ2 A;  4NQ3 A;  1XHO A;  2OHW A;  3N2G A;  4X1K A;  1TUB B;  3PLA C;  1J7H A;  5LP6 C;  5ITZ A;  1VQV A;  2KG4 A;  3RYH B;  5HP7 A;  2N48 A;  4O4I B;  1U3L A;  2Q1Y A;  2LBW A;  4G4Y A;  1KQS F;  3J81 M;  3V7E A;  1TUB A;  4G4X A;  3GHZ A;  1YJ9 F;  3VIU A;  3M4S A;  5EB0 A;  3N4Y A;  4O2A B;  2UYN B;  5BMV B;  5CB4 A;  4BT3 A;  3VI6 A;  1S72 F;  3C9R A;  4C82 A;  4X20 A;  2QA4 F;  2R6R 1;  5EWR A;  4ZHQ B;  1FNK A;  3OBW A;  2VAW A;  3JAL B;  3FD6 A;  4C81 A;  1SA0 A;  2QTP A;  3P0Z A;  3F0E A;  1W5F A;  5JCO A;  3ZO8 A;  3HJW C;  3MQW A;  2H8E A;  3RYC A;  5CB4 B;  2MQE A;  2YXZ A;  5GAP K;  3DDN A;  4C4W C;  1IPA A;  4YJ2 B;  2H8C A;  3JAR A;  3RYF A;  1VQN F;  1PXW A;  2CHS A;  3RE3 A;  2KGW A;  3TD4 A;  3ON1 A;  1JD1 A;  3VYU C;  4O4L B;  4R40 B;  4ZHY B;  4G88 A;  1R1M A;  1T0A A;  3C8L A;  3KJK A;  4U3J A;  2FC3 A;  3RYF B;  2VGM A;  3WGN A;  3AGK A;  4EB6 B;  2UYJ A;  2KTU A;  4O4H B;  2HP0 B;  1W2B F;  2OTJ F;  3ESJ A;  3ELC A;  5MN6 A;  2LCA A;  4RHA A;  5IT9 M;  3CCE F;  1TVK A;  3QTY A;  5LOV B;  2BTU A;  1KC8 H;  4B46 A;  5GON A;  3CCV F;  4O4J A;  4B45 A;  1JY8 A;  3CME F;  4IIJ B;  3RYI A;  3VTI C;  1JN1 A;  5GAN K;  1T0K B;  5J2U A;  3SIV A;  2HX0 A;  2K1S A;  4X1Y B;  2DT4 A;  2UYK A;  3I56 F;  3F0D A;  4X1I A;  4BVT A;  2F9Z C;  1YJN F;  1GO0 A;  5LXT B;  2CZW A;  3FPI A;  5CA0 B;  1IV3 A;  4DRX A;  4LCK A;  5FLX M;  4O4L A;  2V9Y A;  5GIP C;  1ONI A;  4HNA B;  4TZZ A;  3S06 A;  3E22 A;  1Q8R A;  3V4D A;  1KD1 H;  1VQ4 F;  5JVD A;  4WBN B;  4I55 B;  1Q82 H;  3N2G B;  3V3T A;  1M90 H;  1H7M A;  2UYP A;  3UT5 B;  3CCJ F;  1SDS A;  2JNB A;  3F6M A;  5FNV A;  2DYY A;  5HY0 A;  1VQ6 F;  5G4U C;  3RA6 A;  3WGJ A;  1KNK A;  3JAK B;  3LWQ C;  2W8B C;  3O85 A;  3HKE B;  1VQP F;  1VQ8 F;  5C8Y B;  3WPW A;  1W55 A;  2HP3 A;  3V7Q A;  1JFF A;  4BVR A;  1H47 A;  3CCR F;  4EI8 A;  3G71 F;  3L7Q A;  5IJ0 A;  3KIZ A;  2Z1F A;  4I4T B;  1COM A;  3OON A;  1RLU A;  3CPQ A;  5LOV A;  1FFX B;  5KX5 A;  5GIN C;  5HY1 A;  1W59 A;  3WJP A;  3S0Y A;  1QVF F;  3T80 A;  5A2Q M;  4TV9 A;  4ZI7 A;  4I50 B;  3VCZ A;  1XV2 A;  2FGY A;  1YJW F;  4EB6 A;  1W5A A;  2ZVZ A; 
#chains in the Genus database with same CATH homology
 1U3L A;  1W55 A;  1U3P A;  1VH8 A;  5B8F A;  1IV4 A;  1H47 A;  1W57 A;  1U40 A;  3F0G A;  3GHZ A;  3IKF A;  3JVH A;  3K14 A;  4C8E A;  3B6N A;  3IKE A;  1JY8 A;  2PMP A;  2GZL A;  3Q8H A;  1IV2 A;  1YQN A;  3RE3 A;  3QHD A;  1JN1 A;  3EOR A;  4C8G A;  1GX1 A;  3F6M A;  4C82 A;  3IEQ A;  1T0A A;  1IV1 A;  3ERN A;  3FBA A;  3T80 A;  3F0D A;  3K2X A;  4C8I A;  1KNK A;  1VHA A;  3IEW A;  3KE1 A;  3MBM A;  1H48 A;  4C81 A;  3F0F A;  2UZH A;  3P0Z A;  3F0E A;  3P10 A;  2AMT A;  3FPI A;  1KNJ A;  1U43 A;  1IV3 A;  3ESJ A;  3ELC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...