1KNKA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 38
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knkA00
3EORA 3FBAA 3F0FA 3P0ZA 4C8IA 4C82A 3IKEA 1KNKA 1W57A 2GZLA 3ELCA 1VHAA 3QHDA 5B8FA 3JVHA 3MBMA 3GHZA 3ESJA 1KNJA 3Q8HA 1IV4A 1JY8A 3B6NA 4C81A 4C8EA 1U43A 1VH8A 1IV3A 2PMPA 1H48A 3IEWA 3F0EA 1YQNA 3ERNA 2AMTA 2UZHA 1W55A 3RE3A 1T0AA 3KE1A 4C8GA 1U3PA 1H47A 1JN1A 3IKFA 1GX1A 3F0DA 1IV2A 3K14A 3IEQA 3T80A 1U40A 1U3LA 3F6MA 3K2XA 3P10A 3F0GA 1IV1A 3FPIA
chains in the Genus database with same CATH superfamily
3C9SA 4C8IA 3CC7F 3ZP7A 1OAPA 2FGYA 2YYEA 1Q7YH 5BMVA 5JVDA 4G4VA 3QHDA 1J7HA 4G4XA 3CCQF 1XV2A 1KD1H 2CWJA 4BT2A 4BVQA 1K9MH 2OZBA 2VGMA 1VQLF 3F0EA 2N48A 1R1MA 1QD9A 1CK2A 3LMEA 4O4IB 3IKFA 3JCMM 3G4SF 5HP7A 3LWPC 3ZP4A 2YXZA 1UFYA 5EWRA 3V7QA 2CW4A 1GZ0A 2RHOA 3D00A 4R40B 4X20B 1Z5VA 4X3MA 1S72F 3N2GB 4O4IA 4TUYB 3J81M 4O4HB 3HWUA 4YJ2B 2CSLA 2HRUA 2F9ZC 4BT4A 1VK3A 5LOVB 4X20A 3B6NA 3CB2A 3N2GA 3NMUC 1Z5WA 4ZHWA 4YJ2A 3AGKA 3RYHB 2VAWA 4BT5A 1JN1A 3ZO8A 4ZHQA 1XRGA 2OHWA 3FD6A 4I4TA 3VO8A 2Q1XA 1VQOF 5GANK 5J2UB 3VOBA 3VIUA 2BTQB 3M84A 4X3LA 4F6RA 3FFMA 4LCKA 3VCZA 3WGJA 4RQOA 3S06A 3WPWA 5JH7B 3N4ZA 3NVKE 4U3JA 2IG8A 4BT7A 4X1YB 3CCVF 1SA0B 3J80M 2ZAUA 1ODEA 1COMA 1GX1A 3E22B 5KMGB 5JH7A 5HY0A 3JATB 2BTUA 3HKDB 5J2TA 1JD1A 4M8IA 3S02A 4X1IB 3KHNA 5G4UC 4XCQA 3CCRF 3P10A 5HY4A 5HY2A 1W5BA 1FFXB 3PLAC 4B62A 1KNKA 3E22A 5EIBD 5KMGA 3JARA 1VQVA 3HKDA 4PWTA 5B8FA 5EB0A 4ZK7A 1VQPF 4NUTA 3LFOA 4EB6B 3HAXD 5IYZB 3RYFA 3WGMA 3CC2F 3JAWA 3HJWC 3LWVC 3V3TA 2BTOA 3I56F 4BW0B 3HKEA 3NVIB 3S03A 3ZOPA 1RQ2A 2CZWA 3F0GA 3BYQA 1IV1A 4I50B 1ZWZA 1YJWF 3V4DA 1TVKB 1VQ9F 2JNBA 3C8LA 3N4YA 3R0PA 5LP6A 4O2AA 3CXCF 3HKCB 1W5FA 4EI7A 4ZI7B 3NK7A 1YQNA 3FD5A 4G4YA 2AIFA 1Q82H 2AMTA 5A2QM 2UZHA 4YJ3B 3VOAA 4BVRA 5LA6B 4DRXB 3N2KB 1JFFA 1U40A 3G6EF 3VYTC 3F6MA 4ZI7A 3HTNA 3JAKA 2BO1A 3F0FA 4DRXA 4G88A 2NMUA 3JALB 1VQ8F 1KNJA 2UYNB 1SZQA 2HQSC 4IIJB 3LWQC 1IPAA 4O4LB 3CCEF 2H6LA 3TD5A 1RA4A 1PF5A 1KQSF 5EYPB 5HXUA 2B33A 3WGKA 5HY1A 3JALA 3JAMM 3SIVA 3E1YA 4NQ3A 2LBTA 5HWEA 4O4LA 3CCMF 5JCOA 5FLXM 3I3FA 4LNUB 1XHOA 3HKBB 3M1XA 2ZOVA 5EYPA 2ALEA 4O4JB 4ZHVA 3K12A 3WPXA 3ELCA 1Q86H 1W3EX 3JVHA 3MBMA 3Q8HA 4LNUA 1UI9A 5CB4B 5FJ4C 1DT9A 2OTMA 1TUBB 2HX0A 3I7TA 4O2BB 4TUYA 4O4HA 4G4ZA 4B46A 2I6DA 4TV9B 5CB4A 2IAFA 1Q8RA 3PAFA 4EI9A 5LOVA 2QEXF 3CD6F 4O2BA 1XBIA 3CCUF 1JJ2F 1RLUA 1QU9A 2LBXA 2VGNA 5AVMA 5G4VC 3LWOC 4TV9A 3IR9A 3RYHA 4C82A 1Q81H 1W57A 3GTZA 2K1SA 4C8EA 5GIPC 3D01A 3C9TA 5J2UA 1RQ7A 2R751 2R6R1 4X1KB 4FFBB 3RA5A 3RYIB 1U3PA 2CHTA 2HP3A 3K14A 1NJIH 4WBNA 2PHNA 1NMUB 4X1YA 5ITZB 2QI2A 1SA0A 4FFBA 3FPIA 5FNVB 1VQNF 2Q1YA 2VAPA 4BY9D 3JATA 2FC3A 3CMEF 2HVYD 1IV4A 3RYCB 4X1IA 4ZOLB 3WGNA 1NQ3A 3IEWA 4IHJB 2IQQA 5IJ0B 1FFXA 3JASB 3SIUA 1FNKA 2HP0B 3KE1A 3KJJA 3OBYA 4EB6A 2ZF8A 5IYZA 2UYKA 3TD4A 4TV8B 2I6RA 4IHJA 3JASA 3VYUC 2KTVA 1W5EA 4U39A 3P0ZA 2KGWA 2OTJF 3OONA 3RA6A 3VI6A 3MDOA 4G4WA 1QVGF 3VYSC 5MN5A 3WJQA 2ZODA 5KX5B 5JQGB 5C8YB 4I50A 1VQKF 3WXMB 1TVKA 3C9RA 5LXTB 2CVLA 3UT5B 3WGLA 1IV2A 3HKCA 5JQGA 3I55F 5CA1B 1YJ9F 1W42A 4YJ3A 5LA6A 3O85A 3S0WA 3LWRC 3N2KA 1YITF 1VHAA 2Z1TA 3G71F 1RLGA 1VQ4F 3LDTA 5EAZA 4BT3A 3KJKA 1H48A 1X52A 2LBWA 2UYPA 4E6EA 5IJ9B 3VMFB 3J7AR 1H7MA 3VTIC 1ONIA 3WJPA 2H8CA 3MCQA 5JVDB 5BMVB 2ZVYA 4TZZA 2UYNA 2QTPA 2RHJA 3IEQA 5GINC 4IIJA 5HXZA 1X7PA 1VQ7F 5MN6A 2HS0A 3T80A 3M4SA 5EZYB 2Z1UA 5LP6C 3U0OA 1W2BF 1K73H 3CG6A 2LCAA 4C81A 3HKBA 1U43A 2RHLA 5EZYA 4O4JA 3CCLF 3MCAB 2KTUA 4HNAB 3ERNA 2P6YA 1VQ6F 4C4WC 3RE3A 3QUWA 1K8AH 2WALA 3CC4F 1YIJF 1M90H 3CMAF 1W41A 1TUBA 4HNAA 3LYBA 3OBWA 5EB1B 5GONB 3EORA 3E20B 3CCSF 1X7OA 1QAHA 2GLZA 2RHHA 2V9YA 2ZVZA 4ZHQB 5GAPK 4I4TB 5GONA 4ZHYB 2PMPA 3CCJF 1GO1A 3OW2F 1SDSA 2OTLF 5CA0B 5JCOC 4DXDA 5DCVA 1H47A 4NWOB 2MQEA 4F6RB 5LYJB 4EI8A 1U3LA 3K2XA 4U3JB 1VQ5F 2L26A 1CN7A 3CYPB 4X1KA 3FBAA 5CA0A 3RYIA 1DBFA 1W59A 3IMPA 2GZLA 2HRYA 5LYJA 5MN4A 2Z01A 3GHZA 1E7KA 1JY8A 5J2TB 3K0TA 2HS4A 4BT6A 2GVIA 3CYQA 5ITZA 1FNJA 5FNVA 5EIBC 1W581 3P4EA 2DYYA 2DT4A 3JARB 3MQWA 3RYCA 3S0YA 1QVFF 4ZOLA 2QA4F 3WJRA 2KG4A 3RYFB 3D54A 5IJ0A 1W5AA 2G9IA 3JAWB 2HS3A 3KIZA 4ERHA 2HP0A 2H8EA 1YHQF 4I55B 3HKEB 3ESJA 2Z1FA 2RB9A 3CPQA 4TV8A 1T0KB 1PXWA 1CLIA 4B45A 1KC8H 2EWCA 5HP8A 5IT9M 4I55A 4BVTA 1W40A 3F0DA 4BVSA 2CHSA 4O2AB 5LP6B 3NK6A 5KX5A 5C8YA 4RHAA 1N8RH 1GO0A 1M1KH 2AIZP 3GYQA 3IKEA 5LXTA 1YGYA 3S0HA 3UT5A 1VQMF 1YI2F 1JFFB 3CPWF 2Z1EA 2UYJA 1VH8A 1IV3A 5CA1A 3ON1A 1FSZA 3V7EA 3DC2A 3JAKB 3C9UA 2VXYA 4KWEA 1X25A 4WBNB 1W55A 3L7QA 1T0AA 3QTYA 2VAMA 3DDNA 4C8GA 5GIOC 3TD3A 5EO3A 1OFUA 2W8BC 5IJ9A 4B5CA 1YJNF
chains in the Genus database with same CATH topology
3EORA 3FBAA 3F0FA 3P0ZA 4C8IA 4C82A 3IKEA 1KNKA 1W57A 2GZLA 3ELCA 1VHAA 3QHDA 5B8FA 3JVHA 3MBMA 3GHZA 3ESJA 1KNJA 3Q8HA 1IV4A 1JY8A 3B6NA 4C81A 4C8EA 1U43A 1VH8A 1IV3A 2PMPA 1H48A 3IEWA 3F0EA 1YQNA 3ERNA 2AMTA 2UZHA 1W55A 3RE3A 1T0AA 3KE1A 4C8GA 1U3PA 1H47A 1JN1A 3IKFA 1GX1A 3F0DA 1IV2A 3K14A 3IEQA 3T80A 1U40A 1U3LA 3F6MA 3K2XA 3P10A 3F0GA 1IV1A 3FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  3FBA A;  3F0F A;  3P0Z A;  4C8I A;  4C82 A;  3IKE A;  1KNK A;  1W57 A;  2GZL A;  3ELC A;  1VHA A;  3QHD A;  5B8F A;  3JVH A;  3MBM A;  3GHZ A;  3ESJ A;  1KNJ A;  3Q8H A;  1IV4 A;  1JY8 A;  3B6N A;  4C81 A;  4C8E A;  1U43 A;  1VH8 A;  1IV3 A;  2PMP A;  1H48 A;  3IEW A;  3F0E A;  1YQN A;  3ERN A;  2AMT A;  2UZH A;  1W55 A;  3RE3 A;  1T0A A;  3KE1 A;  4C8G A;  1U3P A;  1H47 A;  1JN1 A;  3IKF A;  1GX1 A;  3F0D A;  1IV2 A;  3K14 A;  3IEQ A;  3T80 A;  1U40 A;  1U3L A;  3F6M A;  3K2X A;  3P10 A;  3F0G A;  1IV1 A;  3FPI A; 
#chains in the Genus database with same CATH topology
 3C9S A;  4C8I A;  3CC7 F;  3ZP7 A;  1OAP A;  2FGY A;  2YYE A;  1Q7Y H;  5BMV A;  5JVD A;  4G4V A;  3QHD A;  1J7H A;  4G4X A;  3CCQ F;  1XV2 A;  1KD1 H;  2CWJ A;  4BT2 A;  4BVQ A;  1K9M H;  2OZB A;  2VGM A;  1VQL F;  3F0E A;  2N48 A;  1R1M A;  1QD9 A;  1CK2 A;  3LME A;  4O4I B;  3IKF A;  3JCM M;  3G4S F;  5HP7 A;  3LWP C;  3ZP4 A;  2YXZ A;  1UFY A;  5EWR A;  3V7Q A;  2CW4 A;  1GZ0 A;  2RHO A;  3D00 A;  4R40 B;  4X20 B;  1Z5V A;  4X3M A;  1S72 F;  3N2G B;  4O4I A;  4TUY B;  3J81 M;  4O4H B;  3HWU A;  4YJ2 B;  2CSL A;  2HRU A;  2F9Z C;  4BT4 A;  1VK3 A;  5LOV B;  4X20 A;  3B6N A;  3CB2 A;  3N2G A;  3NMU C;  1Z5W A;  4ZHW A;  4YJ2 A;  3AGK A;  3RYH B;  2VAW A;  4BT5 A;  1JN1 A;  3ZO8 A;  4ZHQ A;  1XRG A;  2OHW A;  3FD6 A;  4I4T A;  3VO8 A;  2Q1X A;  1VQO F;  5GAN K;  5J2U B;  3VOB A;  3VIU A;  2BTQ B;  3M84 A;  4X3L A;  4F6R A;  3FFM A;  4LCK A;  3VCZ A;  3WGJ A;  4RQO A;  3S06 A;  3WPW A;  5JH7 B;  3N4Z A;  3NVK E;  4U3J A;  2IG8 A;  4BT7 A;  4X1Y B;  3CCV F;  1SA0 B;  3J80 M;  2ZAU A;  1ODE A;  1COM A;  1GX1 A;  3E22 B;  5KMG B;  5JH7 A;  5HY0 A;  3JAT B;  2BTU A;  3HKD B;  5J2T A;  1JD1 A;  4M8I A;  3S02 A;  4X1I B;  3KHN A;  5G4U C;  4XCQ A;  3CCR F;  3P10 A;  5HY4 A;  5HY2 A;  1W5B A;  1FFX B;  3PLA C;  4B62 A;  1KNK A;  3E22 A;  5EIB D;  5KMG A;  3JAR A;  1VQV A;  3HKD A;  4PWT A;  5B8F A;  5EB0 A;  4ZK7 A;  1VQP F;  4NUT A;  3LFO A;  4EB6 B;  3HAX D;  5IYZ B;  3RYF A;  3WGM A;  3CC2 F;  3JAW A;  3HJW C;  3LWV C;  3V3T A;  2BTO A;  3I56 F;  4BW0 B;  3HKE A;  3NVI B;  3S03 A;  3ZOP A;  1RQ2 A;  2CZW A;  3F0G A;  3BYQ A;  1IV1 A;  4I50 B;  1ZWZ A;  1YJW F;  3V4D A;  1TVK B;  1VQ9 F;  2JNB A;  3C8L A;  3N4Y A;  3R0P A;  5LP6 A;  4O2A A;  3CXC F;  3HKC B;  1W5F A;  4EI7 A;  4ZI7 B;  3NK7 A;  1YQN A;  3FD5 A;  4G4Y A;  2AIF A;  1Q82 H;  2AMT A;  5A2Q M;  2UZH A;  4YJ3 B;  3VOA A;  4BVR A;  5LA6 B;  4DRX B;  3N2K B;  1JFF A;  1U40 A;  3G6E F;  3VYT C;  3F6M A;  4ZI7 A;  3HTN A;  3JAK A;  2BO1 A;  3F0F A;  4DRX A;  4G88 A;  2NMU A;  3JAL B;  1VQ8 F;  1KNJ A;  2UYN B;  1SZQ A;  2HQS C;  4IIJ B;  3LWQ C;  1IPA A;  4O4L B;  3CCE F;  2H6L A;  3TD5 A;  1RA4 A;  1PF5 A;  1KQS F;  5EYP B;  5HXU A;  2B33 A;  3WGK A;  5HY1 A;  3JAL A;  3JAM M;  3SIV A;  3E1Y A;  4NQ3 A;  2LBT A;  5HWE A;  4O4L A;  3CCM F;  5JCO A;  5FLX M;  3I3F A;  4LNU B;  1XHO A;  3HKB B;  3M1X A;  2ZOV A;  5EYP A;  2ALE A;  4O4J B;  4ZHV A;  3K12 A;  3WPX A;  3ELC A;  1Q86 H;  1W3E X;  3JVH A;  3MBM A;  3Q8H A;  4LNU A;  1UI9 A;  5CB4 B;  5FJ4 C;  1DT9 A;  2OTM A;  1TUB B;  2HX0 A;  3I7T A;  4O2B B;  4TUY A;  4O4H A;  4G4Z A;  4B46 A;  2I6D A;  4TV9 B;  5CB4 A;  2IAF A;  1Q8R A;  3PAF A;  4EI9 A;  5LOV A;  2QEX F;  3CD6 F;  4O2B A;  1XBI A;  3CCU F;  1JJ2 F;  1RLU A;  1QU9 A;  2LBX A;  2VGN A;  5AVM A;  5G4V C;  3LWO C;  4TV9 A;  3IR9 A;  3RYH A;  4C82 A;  1Q81 H;  1W57 A;  3GTZ A;  2K1S A;  4C8E A;  5GIP C;  3D01 A;  3C9T A;  5J2U A;  1RQ7 A;  2R75 1;  2R6R 1;  4X1K B;  4FFB B;  3RA5 A;  3RYI B;  1U3P A;  2CHT A;  2HP3 A;  3K14 A;  1NJI H;  4WBN A;  2PHN A;  1NMU B;  4X1Y A;  5ITZ B;  2QI2 A;  1SA0 A;  4FFB A;  3FPI A;  5FNV B;  1VQN F;  2Q1Y A;  2VAP A;  4BY9 D;  3JAT A;  2FC3 A;  3CME F;  2HVY D;  1IV4 A;  3RYC B;  4X1I A;  4ZOL B;  3WGN A;  1NQ3 A;  3IEW A;  4IHJ B;  2IQQ A;  5IJ0 B;  1FFX A;  3JAS B;  3SIU A;  1FNK A;  2HP0 B;  3KE1 A;  3KJJ A;  3OBY A;  4EB6 A;  2ZF8 A;  5IYZ A;  2UYK A;  3TD4 A;  4TV8 B;  2I6R A;  4IHJ A;  3JAS A;  3VYU C;  2KTV A;  1W5E A;  4U39 A;  3P0Z A;  2KGW A;  2OTJ F;  3OON A;  3RA6 A;  3VI6 A;  3MDO A;  4G4W A;  1QVG F;  3VYS C;  5MN5 A;  3WJQ A;  2ZOD A;  5KX5 B;  5JQG B;  5C8Y B;  4I50 A;  1VQK F;  3WXM B;  1TVK A;  3C9R A;  5LXT B;  2CVL A;  3UT5 B;  3WGL A;  1IV2 A;  3HKC A;  5JQG A;  3I55 F;  5CA1 B;  1YJ9 F;  1W42 A;  4YJ3 A;  5LA6 A;  3O85 A;  3S0W A;  3LWR C;  3N2K A;  1YIT F;  1VHA A;  2Z1T A;  3G71 F;  1RLG A;  1VQ4 F;  3LDT A;  5EAZ A;  4BT3 A;  3KJK A;  1H48 A;  1X52 A;  2LBW A;  2UYP A;  4E6E A;  5IJ9 B;  3VMF B;  3J7A R;  1H7M A;  3VTI C;  1ONI A;  3WJP A;  2H8C A;  3MCQ A;  5JVD B;  5BMV B;  2ZVY A;  4TZZ A;  2UYN A;  2QTP A;  2RHJ A;  3IEQ A;  5GIN C;  4IIJ A;  5HXZ A;  1X7P A;  1VQ7 F;  5MN6 A;  2HS0 A;  3T80 A;  3M4S A;  5EZY B;  2Z1U A;  5LP6 C;  3U0O A;  1W2B F;  1K73 H;  3CG6 A;  2LCA A;  4C81 A;  3HKB A;  1U43 A;  2RHL A;  5EZY A;  4O4J A;  3CCL F;  3MCA B;  2KTU A;  4HNA B;  3ERN A;  2P6Y A;  1VQ6 F;  4C4W C;  3RE3 A;  3QUW A;  1K8A H;  2WAL A;  3CC4 F;  1YIJ F;  1M90 H;  3CMA F;  1W41 A;  1TUB A;  4HNA A;  3LYB A;  3OBW A;  5EB1 B;  5GON B;  3EOR A;  3E20 B;  3CCS F;  1X7O A;  1QAH A;  2GLZ A;  2RHH A;  2V9Y A;  2ZVZ A;  4ZHQ B;  5GAP K;  4I4T B;  5GON A;  4ZHY B;  2PMP A;  3CCJ F;  1GO1 A;  3OW2 F;  1SDS A;  2OTL F;  5CA0 B;  5JCO C;  4DXD A;  5DCV A;  1H47 A;  4NWO B;  2MQE A;  4F6R B;  5LYJ B;  4EI8 A;  1U3L A;  3K2X A;  4U3J B;  1VQ5 F;  2L26 A;  1CN7 A;  3CYP B;  4X1K A;  3FBA A;  5CA0 A;  3RYI A;  1DBF A;  1W59 A;  3IMP A;  2GZL A;  2HRY A;  5LYJ A;  5MN4 A;  2Z01 A;  3GHZ A;  1E7K A;  1JY8 A;  5J2T B;  3K0T A;  2HS4 A;  4BT6 A;  2GVI A;  3CYQ A;  5ITZ A;  1FNJ A;  5FNV A;  5EIB C;  1W58 1;  3P4E A;  2DYY A;  2DT4 A;  3JAR B;  3MQW A;  3RYC A;  3S0Y A;  1QVF F;  4ZOL A;  2QA4 F;  3WJR A;  2KG4 A;  3RYF B;  3D54 A;  5IJ0 A;  1W5A A;  2G9I A;  3JAW B;  2HS3 A;  3KIZ A;  4ERH A;  2HP0 A;  2H8E A;  1YHQ F;  4I55 B;  3HKE B;  3ESJ A;  2Z1F A;  2RB9 A;  3CPQ A;  4TV8 A;  1T0K B;  1PXW A;  1CLI A;  4B45 A;  1KC8 H;  2EWC A;  5HP8 A;  5IT9 M;  4I55 A;  4BVT A;  1W40 A;  3F0D A;  4BVS A;  2CHS A;  4O2A B;  5LP6 B;  3NK6 A;  5KX5 A;  5C8Y A;  4RHA A;  1N8R H;  1GO0 A;  1M1K H;  2AIZ P;  3GYQ A;  3IKE A;  5LXT A;  1YGY A;  3S0H A;  3UT5 A;  1VQM F;  1YI2 F;  1JFF B;  3CPW F;  2Z1E A;  2UYJ A;  1VH8 A;  1IV3 A;  5CA1 A;  3ON1 A;  1FSZ A;  3V7E A;  3DC2 A;  3JAK B;  3C9U A;  2VXY A;  4KWE A;  1X25 A;  4WBN B;  1W55 A;  3L7Q A;  1T0A A;  3QTY A;  2VAM A;  3DDN A;  4C8G A;  5GIO C;  3TD3 A;  5EO3 A;  1OFU A;  2W8B C;  5IJ9 A;  4B5C A;  1YJN F; 
#chains in the Genus database with same CATH homology
 3EOR A;  3FBA A;  3F0F A;  3P0Z A;  4C8I A;  4C82 A;  3IKE A;  1KNK A;  1W57 A;  2GZL A;  3ELC A;  1VHA A;  3QHD A;  5B8F A;  3JVH A;  3MBM A;  3GHZ A;  3ESJ A;  1KNJ A;  3Q8H A;  1IV4 A;  1JY8 A;  3B6N A;  4C81 A;  4C8E A;  1U43 A;  1VH8 A;  1IV3 A;  2PMP A;  1H48 A;  3IEW A;  3F0E A;  1YQN A;  3ERN A;  2AMT A;  2UZH A;  1W55 A;  3RE3 A;  1T0A A;  3KE1 A;  4C8G A;  1U3P A;  1H47 A;  1JN1 A;  3IKF A;  1GX1 A;  3F0D A;  1IV2 A;  3K14 A;  3IEQ A;  3T80 A;  1U40 A;  1U3L A;  3F6M A;  3K2X A;  3P10 A;  3F0G A;  1IV1 A;  3FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...