1KNKA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 38
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knkA00
2GZLA 3F0EA 1IV4A 3F6MA 3FBAA 3JVHA 3F0FA 1H48A 2PMPA 3IKFA 1GX1A 3IKEA 3FPIA 1JY8A 3MBMA 1T0AA 3ESJA 1W55A 3GHZA 1VHAA 3ERNA 3T80A 3IEWA 1U40A 1IV1A 3KE1A 3RE3A 3EORA 4C82A 3P10A 3F0GA 4C8GA 4C81A 1KNKA 3K2XA 5B8FA 1KNJA 1H47A 3ELCA 3K14A 2AMTA 3Q8HA 1U3LA 1U3PA 3QHDA 1W57A 2UZHA 3F0DA 4C8EA 1IV3A 1IV2A 4C8IA 1YQNA 3P0ZA 1U43A 3B6NA 1JN1A 1VH8A 3IEQA
chains in the Genus database with same CATH superfamily
3RA6A 3V3TA 4O2AA 1GZ0A 1RQ7A 3OONA 3VMFB 1JD1A 3JATA 3S0YA 5GONB 4ZHQB 3I56F 4G88A 1X7PA 5JH7A 3CMEF 4NUTA 2AIFA 3K14A 3UT5A 2HP0B 3JCMM 1GO0A 4O4JB 2VXYA 4BT5A 4ZI7A 2N48A 3CYPB 2GLZA 3E20B 3CCJF 3C9RA 1Q86H 3VO8A 1YJWF 3CCLF 1YHQF 2CW4A 2EWCA 4TV9B 5G4VC 3RYFB 5EO3A 3CCUF 1Q81H 3AGKA 5J2TB 3HWUA 2LBTA 3V7EA 5KMGB 5CA0A 5LA6A 5CB4B 4XCQA 1VQ8F 3RYHB 4X3LA 3HJWC 4I50B 5JCOC 5GIPC 2V9YA 1KNJA 3HKCA 5GINC 5EYPB 1JJ2F 1FSZA 3NVIB 3NVKE 3BYQA 1SZQA 4LNUB 1M1KH 5LXTA 2ZAUA 3OBWA 4O4LB 4WBNB 3G71F 3IEQA 3K12A 1VQOF 3O85A 5G4UC 5LP6C 5KX5A 2CZWA 1QU9A 5CA1B 4IIJA 2ZODA 2RHHA 5BMVB 2IG8A 4IHJB 2HS0A 5IJ9B 1NQ3A 1VQ4F 5MN4A 2JNBA 1E7KA 2OTMA 3IMPA 3I7TA 3G4SF 3LYBA 4U39A 1RA4A 5HP7A 3F6MA 4BT4A 4B46A 3G6EF 2UYNB 3D54A 1SDSA 1VHAA 4TV8A 1SA0B 5HY4A 4TZZA 5J2UA 3TD4A 1J7HA 4BVQA 1VQNF 3N2KB 4I4TA 2QA4F 2KGWA 5MN5A 4TUYB 3ZP4A 1RLGA 3NK7A 5FNVA 2Z01A 1YJNF 3DDNA 3VCZA 3JAWA 4BVSA 4O2AB 3CC2F 5LYJA 3WGMA 1H7MA 3JATB 4B62A 4YJ2A 4EB6B 3CPQA 2Z1UA 4ERHA 1KQSF 2HX0A 3VIUA 1Q8RA 5JH7B 3ERNA 1Q82H 1FNJA 4C8GA 3UT5B 1UI9A 3ZOPA 1VQVA 1W42A 3CPWF 3M4SA 1UFYA 4ZI7B 2CHSA 3CG6A 4I55A 4O2BA 4DRXA 4O4HA 1X7OA 1RQ2A 5C8YA 1IPAA 3JARA 3WXMB 2UYKA 2BTQB 3S03A 2VAMA 5LA6B 3TD3A 3I3FA 3LWRC 3N2GA 2YXZA 4E6EA 1TUBA 3T80A 4BT6A 1W3EX 3HKCB 1IV1A 3WPWA 4C82A 1K8AH 2QTPA 4B45A 1OAPA 2Q1XA 4EI9A 4G4XA 2UZHA 3HTNA 5LXTB 4FFBA 5LP6A 5LOVA 1XHOA 3J81M 5KX5B 1YITF 1H48A 5MN6A 4X1KA 3JASA 1W55A 1M90H 1X25A 3LWPC 2IAFA 4IIJB 3CYQA 3HAXD 1QVGF 3F0GA 3JALA 2HP3A 1KNKA 2HVYD 2Z1TA 1K73H 5JQGA 3LFOA 3ON1A 3SIUA 1VK3A 1QD9A 2QEXF 2I6RA 2F9ZC 5IJ0B 3WGLA 1COMA 2KG4A 2Z1EA 2DYYA 3N4ZA 2NMUA 1U43A 3M1XA 3CCQF 3C9SA 3RYCA 5EIBD 1R1MA 3U0OA 3KJKA 3FBAA 3WGKA 1VQKF 1GX1A 4TV8B 3R0PA 5J2UB 1JFFA 3NK6A 3ESJA 2G9IA 1W5AA 2ALEA 1OFUA 4I4TB 4BT7A 4ZHWA 1W5BA 3LWVC 3E22A 3VOAA 5IT9M 2AIZP 3RYIA 5B8FA 3VYTC 1H47A 4X1IB 1CK2A 1U3LA 1YGYA 3GYQA 5FNVB 1VQ9F 4C8EA 3JAWB 5FLXM 2LBXA 1ODEA 3VYUC 5LYJB 4BT3A 3CC4F 4BY9D 1VQ6F 1W5FA 5EIBC 5EAZA 4G4WA 3OW2F 4YJ2B 3MCQA 4EI8A 3VYSC 2HRUA 5HY0A 3OBYA 5AVMA 3J80M 3CCRF 4G4ZA 1TVKA 1KC8H 2FGYA 4X1YA 5ITZA 2HRYA 3RA5A 5HY1A 2OZBA 1U40A 3RE3A 2Q1YA 5CB4A 3L7QA 4LCKA 4I55B 4NWOB 4ZOLB 3ELCA 4O2BB 4X3MA 2VGNA 3WGNA 4DRXB 4O4HB 5JVDA 5C8YB 3JARB 3FD5A 4NQ3A 3S02A 2ZVZA 2HS3A 3DC2A 1YQNA 1FFXA 1ONIA 3S0HA 3B6NA 2LBWA 2CWJA 3JAMM 1VH8A 1QAHA 4DXDA 2WALA 4WBNA 2YYEA 1TUBB 2VAWA 3QTYA 2BO1A 3MCAB 5DCVA 5EZYA 1YJ9F 3CXCF 3M84A 3WJQA 2RB9A 4FFBB 3CCVF 5IYZA 3VTIC 4C4WC 5LP6B 5LOVB 1W2BF 4C8IA 3V4DA 3QUWA 2CVLA 5GIOC 5HP8A 3F0EA 4X1KB 3WPXA 3V7QA 3JASB 5CA0B 3HKDA 5EB1B 3IKEA 5JCOA 2HS4A 3JALB 3IEWA 3J7AR 4HNAA 3S0WA 5JQGB 1W41A 5GANK 5GAPK 5HXUA 1W59A 4O4IA 5FJ4C 1W5EA 3Q8HA 1U3PA 3E1YA 1Z5WA 4TUYA 3QHDA 1XV2A 1GO1A 4G4YA 3P4EA 3IR9A 3HKEA 3NMUC 3KIZA 2L26A 1YI2F 3RYCB 2H6LA 3C9TA 2LCAA 5A2QM 2OTLF 1PF5A 1Z5VA 2VGMA 2RHJA 5HXZA 3GHZA 1RLUA 1K9MH 1IV4A 1JFFB 3JVHA 4PWTA 2PMPA 3FPIA 1CLIA 4F6RA 1T0AA 4EB6A 3E22B 3RYIB 1VQMF 1XRGA 2IQQA 4YJ3A 3N4YA 4C81A 3HKBA 3K2XA 3JAKA 1QVFF 3ZO8A 5EWRA 1W57A 4BW0B 4BT2A 3F0DA 1Q7YH 2UYPA 1N8RH 4X20A 3WGJA 3KHNA 3CD6F 4BVTA 1FNKA 2I6DA 3LDTA 4U3JA 3CCMF 1TVKB 4X1YB 5ITZB 4EI7A 2W8BC 4M8IA 3KE1A 5JVDB 3TD5A 2UYJA 5GONA 4ZHQA 1W581 3KJJA 1X52A 2AMTA 3VOBA 2R751 3SIVA 2HP0A 4R40B 3S06A 1FFXB 1IV3A 3WJRA 4O4JA 1PXWA 3LWOC 1T0KB 2FC3A 2H8CA 5HWEA 3WJPA 2Z1FA 5EB0A 4TV9A 2RHOA 3RYFA 1CN7A 2DT4A 3MBMA 5J2TA 5EZYB 5KMGA 3ZP7A 3CB2A 4BVRA 2R6R1 3P10A 1VQ7F 2OHWA 2QI2A 3RYHA 3LWQC 4RHAA 4I50A 2HQSC 5IYZB 3FD6A 2ZVYA 5EYPA 3CC7F 1IV2A 3FFMA 3P0ZA 5IJ0A 2CHTA 4LNUA 3CMAF 3HKDB 3VI6A 3PLAC 1NMUB 1DT9A 4KWEA 2ZF8A 3K0TA 5HY2A 3N2GB 4O4LA 3MDOA 4HNAB 3CCSF 3PAFA 4O4IB 3EORA 4B5CA 4RQOA 1KD1H 2P6YA 5CA1A 3HKEB 4X1IA 1DBFA 1YIJF 5BMVA 2H8EA 4IHJA 2GVIA 2CSLA 5IJ9A 1VQ5F 2MQEA 3C8LA 2BTUA 1VQPF 3GTZA 4F6RB 2GZLA 3LMEA 4ZHVA 3F0FA 3IKFA 1ZWZA 1JY8A 3D00A 4YJ3B 2BTOA 2UYNA 4ZHYB 2B33A 1VQLF 2RHLA 3HKBB 3JAKB 2OTJF 3MQWA 1SA0A 2PHNA 1W40A 1XBIA 2KTUA 3N2KA 4ZOLA 3CCEF 2KTVA 4X20B 4G4VA 2VAPA 2K1SA 4U3JB 3I55F 3D01A 3C9UA 1S72F 1NJIH 1JN1A 4ZK7A 2ZOVA
chains in the Genus database with same CATH topology
2GZLA 3F0EA 1IV4A 3F6MA 3FBAA 3JVHA 3F0FA 1H48A 2PMPA 3IKFA 1GX1A 3IKEA 3FPIA 1JY8A 3MBMA 1T0AA 3ESJA 1W55A 3GHZA 1VHAA 3ERNA 3T80A 3IEWA 1U40A 1IV1A 3KE1A 3RE3A 3EORA 4C82A 3P10A 3F0GA 4C8GA 4C81A 1KNKA 3K2XA 5B8FA 1KNJA 1H47A 3ELCA 3K14A 2AMTA 3Q8HA 1U3LA 1U3PA 3QHDA 1W57A 2UZHA 3F0DA 4C8EA 1IV3A 1IV2A 4C8IA 1YQNA 3P0ZA 1U43A 3B6NA 1JN1A 1VH8A 3IEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZL A;  3F0E A;  1IV4 A;  3F6M A;  3FBA A;  3JVH A;  3F0F A;  1H48 A;  2PMP A;  3IKF A;  1GX1 A;  3IKE A;  3FPI A;  1JY8 A;  3MBM A;  1T0A A;  3ESJ A;  1W55 A;  3GHZ A;  1VHA A;  3ERN A;  3T80 A;  3IEW A;  1U40 A;  1IV1 A;  3KE1 A;  3RE3 A;  3EOR A;  4C82 A;  3P10 A;  3F0G A;  4C8G A;  4C81 A;  1KNK A;  3K2X A;  5B8F A;  1KNJ A;  1H47 A;  3ELC A;  3K14 A;  2AMT A;  3Q8H A;  1U3L A;  1U3P A;  3QHD A;  1W57 A;  2UZH A;  3F0D A;  4C8E A;  1IV3 A;  1IV2 A;  4C8I A;  1YQN A;  3P0Z A;  1U43 A;  3B6N A;  1JN1 A;  1VH8 A;  3IEQ A; 
#chains in the Genus database with same CATH topology
 3RA6 A;  3V3T A;  4O2A A;  1GZ0 A;  1RQ7 A;  3OON A;  3VMF B;  1JD1 A;  3JAT A;  3S0Y A;  5GON B;  4ZHQ B;  3I56 F;  4G88 A;  1X7P A;  5JH7 A;  3CME F;  4NUT A;  2AIF A;  3K14 A;  3UT5 A;  2HP0 B;  3JCM M;  1GO0 A;  4O4J B;  2VXY A;  4BT5 A;  4ZI7 A;  2N48 A;  3CYP B;  2GLZ A;  3E20 B;  3CCJ F;  3C9R A;  1Q86 H;  3VO8 A;  1YJW F;  3CCL F;  1YHQ F;  2CW4 A;  2EWC A;  4TV9 B;  5G4V C;  3RYF B;  5EO3 A;  3CCU F;  1Q81 H;  3AGK A;  5J2T B;  3HWU A;  2LBT A;  3V7E A;  5KMG B;  5CA0 A;  5LA6 A;  5CB4 B;  4XCQ A;  1VQ8 F;  3RYH B;  4X3L A;  3HJW C;  4I50 B;  5JCO C;  5GIP C;  2V9Y A;  1KNJ A;  3HKC A;  5GIN C;  5EYP B;  1JJ2 F;  1FSZ A;  3NVI B;  3NVK E;  3BYQ A;  1SZQ A;  4LNU B;  1M1K H;  5LXT A;  2ZAU A;  3OBW A;  4O4L B;  4WBN B;  3G71 F;  3IEQ A;  3K12 A;  1VQO F;  3O85 A;  5G4U C;  5LP6 C;  5KX5 A;  2CZW A;  1QU9 A;  5CA1 B;  4IIJ A;  2ZOD A;  2RHH A;  5BMV B;  2IG8 A;  4IHJ B;  2HS0 A;  5IJ9 B;  1NQ3 A;  1VQ4 F;  5MN4 A;  2JNB A;  1E7K A;  2OTM A;  3IMP A;  3I7T A;  3G4S F;  3LYB A;  4U39 A;  1RA4 A;  5HP7 A;  3F6M A;  4BT4 A;  4B46 A;  3G6E F;  2UYN B;  3D54 A;  1SDS A;  1VHA A;  4TV8 A;  1SA0 B;  5HY4 A;  4TZZ A;  5J2U A;  3TD4 A;  1J7H A;  4BVQ A;  1VQN F;  3N2K B;  4I4T A;  2QA4 F;  2KGW A;  5MN5 A;  4TUY B;  3ZP4 A;  1RLG A;  3NK7 A;  5FNV A;  2Z01 A;  1YJN F;  3DDN A;  3VCZ A;  3JAW A;  4BVS A;  4O2A B;  3CC2 F;  5LYJ A;  3WGM A;  1H7M A;  3JAT B;  4B62 A;  4YJ2 A;  4EB6 B;  3CPQ A;  2Z1U A;  4ERH A;  1KQS F;  2HX0 A;  3VIU A;  1Q8R A;  5JH7 B;  3ERN A;  1Q82 H;  1FNJ A;  4C8G A;  3UT5 B;  1UI9 A;  3ZOP A;  1VQV A;  1W42 A;  3CPW F;  3M4S A;  1UFY A;  4ZI7 B;  2CHS A;  3CG6 A;  4I55 A;  4O2B A;  4DRX A;  4O4H A;  1X7O A;  1RQ2 A;  5C8Y A;  1IPA A;  3JAR A;  3WXM B;  2UYK A;  2BTQ B;  3S03 A;  2VAM A;  5LA6 B;  3TD3 A;  3I3F A;  3LWR C;  3N2G A;  2YXZ A;  4E6E A;  1TUB A;  3T80 A;  4BT6 A;  1W3E X;  3HKC B;  1IV1 A;  3WPW A;  4C82 A;  1K8A H;  2QTP A;  4B45 A;  1OAP A;  2Q1X A;  4EI9 A;  4G4X A;  2UZH A;  3HTN A;  5LXT B;  4FFB A;  5LP6 A;  5LOV A;  1XHO A;  3J81 M;  5KX5 B;  1YIT F;  1H48 A;  5MN6 A;  4X1K A;  3JAS A;  1W55 A;  1M90 H;  1X25 A;  3LWP C;  2IAF A;  4IIJ B;  3CYQ A;  3HAX D;  1QVG F;  3F0G A;  3JAL A;  2HP3 A;  1KNK A;  2HVY D;  2Z1T A;  1K73 H;  5JQG A;  3LFO A;  3ON1 A;  3SIU A;  1VK3 A;  1QD9 A;  2QEX F;  2I6R A;  2F9Z C;  5IJ0 B;  3WGL A;  1COM A;  2KG4 A;  2Z1E A;  2DYY A;  3N4Z A;  2NMU A;  1U43 A;  3M1X A;  3CCQ F;  3C9S A;  3RYC A;  5EIB D;  1R1M A;  3U0O A;  3KJK A;  3FBA A;  3WGK A;  1VQK F;  1GX1 A;  4TV8 B;  3R0P A;  5J2U B;  1JFF A;  3NK6 A;  3ESJ A;  2G9I A;  1W5A A;  2ALE A;  1OFU A;  4I4T B;  4BT7 A;  4ZHW A;  1W5B A;  3LWV C;  3E22 A;  3VOA A;  5IT9 M;  2AIZ P;  3RYI A;  5B8F A;  3VYT C;  1H47 A;  4X1I B;  1CK2 A;  1U3L A;  1YGY A;  3GYQ A;  5FNV B;  1VQ9 F;  4C8E A;  3JAW B;  5FLX M;  2LBX A;  1ODE A;  3VYU C;  5LYJ B;  4BT3 A;  3CC4 F;  4BY9 D;  1VQ6 F;  1W5F A;  5EIB C;  5EAZ A;  4G4W A;  3OW2 F;  4YJ2 B;  3MCQ A;  4EI8 A;  3VYS C;  2HRU A;  5HY0 A;  3OBY A;  5AVM A;  3J80 M;  3CCR F;  4G4Z A;  1TVK A;  1KC8 H;  2FGY A;  4X1Y A;  5ITZ A;  2HRY A;  3RA5 A;  5HY1 A;  2OZB A;  1U40 A;  3RE3 A;  2Q1Y A;  5CB4 A;  3L7Q A;  4LCK A;  4I55 B;  4NWO B;  4ZOL B;  3ELC A;  4O2B B;  4X3M A;  2VGN A;  3WGN A;  4DRX B;  4O4H B;  5JVD A;  5C8Y B;  3JAR B;  3FD5 A;  4NQ3 A;  3S02 A;  2ZVZ A;  2HS3 A;  3DC2 A;  1YQN A;  1FFX A;  1ONI A;  3S0H A;  3B6N A;  2LBW A;  2CWJ A;  3JAM M;  1VH8 A;  1QAH A;  4DXD A;  2WAL A;  4WBN A;  2YYE A;  1TUB B;  2VAW A;  3QTY A;  2BO1 A;  3MCA B;  5DCV A;  5EZY A;  1YJ9 F;  3CXC F;  3M84 A;  3WJQ A;  2RB9 A;  4FFB B;  3CCV F;  5IYZ A;  3VTI C;  4C4W C;  5LP6 B;  5LOV B;  1W2B F;  4C8I A;  3V4D A;  3QUW A;  2CVL A;  5GIO C;  5HP8 A;  3F0E A;  4X1K B;  3WPX A;  3V7Q A;  3JAS B;  5CA0 B;  3HKD A;  5EB1 B;  3IKE A;  5JCO A;  2HS4 A;  3JAL B;  3IEW A;  3J7A R;  4HNA A;  3S0W A;  5JQG B;  1W41 A;  5GAN K;  5GAP K;  5HXU A;  1W59 A;  4O4I A;  5FJ4 C;  1W5E A;  3Q8H A;  1U3P A;  3E1Y A;  1Z5W A;  4TUY A;  3QHD A;  1XV2 A;  1GO1 A;  4G4Y A;  3P4E A;  3IR9 A;  3HKE A;  3NMU C;  3KIZ A;  2L26 A;  1YI2 F;  3RYC B;  2H6L A;  3C9T A;  2LCA A;  5A2Q M;  2OTL F;  1PF5 A;  1Z5V A;  2VGM A;  2RHJ A;  5HXZ A;  3GHZ A;  1RLU A;  1K9M H;  1IV4 A;  1JFF B;  3JVH A;  4PWT A;  2PMP A;  3FPI A;  1CLI A;  4F6R A;  1T0A A;  4EB6 A;  3E22 B;  3RYI B;  1VQM F;  1XRG A;  2IQQ A;  4YJ3 A;  3N4Y A;  4C81 A;  3HKB A;  3K2X A;  3JAK A;  1QVF F;  3ZO8 A;  5EWR A;  1W57 A;  4BW0 B;  4BT2 A;  3F0D A;  1Q7Y H;  2UYP A;  1N8R H;  4X20 A;  3WGJ A;  3KHN A;  3CD6 F;  4BVT A;  1FNK A;  2I6D A;  3LDT A;  4U3J A;  3CCM F;  1TVK B;  4X1Y B;  5ITZ B;  4EI7 A;  2W8B C;  4M8I A;  3KE1 A;  5JVD B;  3TD5 A;  2UYJ A;  5GON A;  4ZHQ A;  1W58 1;  3KJJ A;  1X52 A;  2AMT A;  3VOB A;  2R75 1;  3SIV A;  2HP0 A;  4R40 B;  3S06 A;  1FFX B;  1IV3 A;  3WJR A;  4O4J A;  1PXW A;  3LWO C;  1T0K B;  2FC3 A;  2H8C A;  5HWE A;  3WJP A;  2Z1F A;  5EB0 A;  4TV9 A;  2RHO A;  3RYF A;  1CN7 A;  2DT4 A;  3MBM A;  5J2T A;  5EZY B;  5KMG A;  3ZP7 A;  3CB2 A;  4BVR A;  2R6R 1;  3P10 A;  1VQ7 F;  2OHW A;  2QI2 A;  3RYH A;  3LWQ C;  4RHA A;  4I50 A;  2HQS C;  5IYZ B;  3FD6 A;  2ZVY A;  5EYP A;  3CC7 F;  1IV2 A;  3FFM A;  3P0Z A;  5IJ0 A;  2CHT A;  4LNU A;  3CMA F;  3HKD B;  3VI6 A;  3PLA C;  1NMU B;  1DT9 A;  4KWE A;  2ZF8 A;  3K0T A;  5HY2 A;  3N2G B;  4O4L A;  3MDO A;  4HNA B;  3CCS F;  3PAF A;  4O4I B;  3EOR A;  4B5C A;  4RQO A;  1KD1 H;  2P6Y A;  5CA1 A;  3HKE B;  4X1I A;  1DBF A;  1YIJ F;  5BMV A;  2H8E A;  4IHJ A;  2GVI A;  2CSL A;  5IJ9 A;  1VQ5 F;  2MQE A;  3C8L A;  2BTU A;  1VQP F;  3GTZ A;  4F6R B;  2GZL A;  3LME A;  4ZHV A;  3F0F A;  3IKF A;  1ZWZ A;  1JY8 A;  3D00 A;  4YJ3 B;  2BTO A;  2UYN A;  4ZHY B;  2B33 A;  1VQL F;  2RHL A;  3HKB B;  3JAK B;  2OTJ F;  3MQW A;  1SA0 A;  2PHN A;  1W40 A;  1XBI A;  2KTU A;  3N2K A;  4ZOL A;  3CCE F;  2KTV A;  4X20 B;  4G4V A;  2VAP A;  2K1S A;  4U3J B;  3I55 F;  3D01 A;  3C9U A;  1S72 F;  1NJI H;  1JN1 A;  4ZK7 A;  2ZOV A; 
#chains in the Genus database with same CATH homology
 2GZL A;  3F0E A;  1IV4 A;  3F6M A;  3FBA A;  3JVH A;  3F0F A;  1H48 A;  2PMP A;  3IKF A;  1GX1 A;  3IKE A;  3FPI A;  1JY8 A;  3MBM A;  1T0A A;  3ESJ A;  1W55 A;  3GHZ A;  1VHA A;  3ERN A;  3T80 A;  3IEW A;  1U40 A;  1IV1 A;  3KE1 A;  3RE3 A;  3EOR A;  4C82 A;  3P10 A;  3F0G A;  4C8G A;  4C81 A;  1KNK A;  3K2X A;  5B8F A;  1KNJ A;  1H47 A;  3ELC A;  3K14 A;  2AMT A;  3Q8H A;  1U3L A;  1U3P A;  3QHD A;  1W57 A;  2UZH A;  3F0D A;  4C8E A;  1IV3 A;  1IV2 A;  4C8I A;  1YQN A;  3P0Z A;  1U43 A;  3B6N A;  1JN1 A;  1VH8 A;  3IEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...