3ZP4A

Arg90cit chorismate mutase of bacillus subtilis in complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 29
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zp4A00
2CVLA 5HP8A 3ZO8A 1ONIA 2DYYA 3M4SA 2CSLA 5HP7A 4ZK7A 2UYNA 1QU9A 1XHOA 1PF5A 2B33A 2CHSA 2OTMA 1QD9A 3D01A 3I7TA 2CW4A 1QAHA 3M1XA 3MQWA 1J7HA 1DBFA 3QUWA 1UFYA 3LMEA 3VCZA 1ODEA 2CWJA 2UYPA 1UI9A 3R0PA 3I3FA 3V4DA 2IG8A 3ZP7A 2CHTA 4NWOB 1NQ3A 3L7QA 1FNJA 3KJJA 1FNKA 1JD1A 1COMA 3ZP4A 2UYNB 3K0TA 3ZOPA 1XRGA 1X25A 2EWCA 3GTZA 2UYKA 3LYBA 2UYJA 3K12A 3KJKA
chains in the Genus database with same CATH superfamily
3JAKA 5EIBD 5JH7B 4B45A 3ON1A 3LWPC 5CB4A 3CCRF 4YJ3A 3LMEA 4G4ZA 2MQEA 3LFOA 1OAPA 2IQQA 3L7QA 2L26A 1RA4A 4TV9B 3V3TA 5CA1B 2FC3A 2HS4A 3CXCF 3KJKA 3I55F 5JQGB 1FFXB 3F0GA 3AGKA 1K8AH 1XV2A 3MQWA 4C8IA 2FGYA 3C9SA 3K14A 4O2BB 1CK2A 1VQOF 1N8RH 2OZBA 4O4HB 3VOBA 3CPWF 3RYCB 4LNUB 3TD4A 5JQGA 3HKCB 2UZHA 1GO0A 5FJ4C 3CD6F 2VAMA 4IHJA 3QTYA 4U39A 4O2BA 5EZYA 1RQ2A 3CPQA 5C8YB 4WBNB 4X1YA 1E7KA 4LNUA 3GTZA 4NUTA 1S72F 5GINC 1IV2A 5KMGB 3UT5A 4EI8A 3HKBB 5J2TA 1RLUA 1W40A 5J2UA 3KE1A 1UFYA 3NK6A 4IIJB 1FSZA 1TUBB 1NMUB 5KMGA 3F0EA 4NQ3A 1YQNA 2WALA 5DCVA 3J81M 2GLZA 3OBYA 4BT7A 1TUBA 2P6YA 1X25A 1KD1H 4I50B 3LWVC 3GYQA 3E1YA 1W42A 2HP3A 4TZZA 4C8GA 3HWUA 2AIFA 3K2XA 1Q7YH 4BVSA 3HKEB 2UYNA 5LXTA 1DBFA 4I50A 4I4TA 5LA6B 2RB9A 3V4DA 5KX5B 3HKEA 5CA0A 2RHJA 2OTLF 2HS3A 1YJNF 2HP0B 3WPWA 5ITZB 2AIZP 5IJ9A 1XBIA 4ZHQA 4ERHA 4EB6A 1T0KB 3I56F 2UYJA 2KTUA 4TUYB 5GANK 2KTVA 4O4LA 3CCQF 3FFMA 2CVLA 1VQ9F 2HP0A 3RYFA 2ALEA 1CN7A 1VQ5F 3CCLF 2LCAA 3NK7A 4F6RA 3P4EA 3LWQC 2AMTA 2ZVYA 3JATB 1UI9A 2ZF8A 2VGNA 5BMVB 5MN6A 3RYHA 4X3LA 4DRXA 2NMUA 2YYEA 3JAKB 3PLAC 3JASA 4TV8B 5IT9M 1Q82H 3NMUC 2BTUA 1VQVA 1W55A 2RHLA 5G4VC 1YHQF 3CMEF 1U43A 4YJ3B 1YGYA 1VQMF 3IR9A 1IPAA 2Q1YA 1ONIA 2DYYA 4HNAB 3LWRC 2BTQB 3OBWA 4ZK7A 2IAFA 2B33A 2CHSA 4TV8A 2OTMA 5LYJA 4DXDA 3C9TA 3N2GA 1J7HA 1W59A 2Z1EA 3F0DA 3ESJA 3I3FA 4FFBA 4HNAA 1RQ7A 2HRUA 3KIZA 2CHTA 3LDTA 3V7EA 3HKDB 5GAPK 3S06A 1U40A 3VI6A 3VYSC 3VIUA 2H8CA 4BY9D 5AVMA 3S03A 5G4UC 1YJWF 3HKDA 1SA0B 3CYQA 1YIJF 4BT5A 1Q81H 3RYIB 3ZO8A 3J80M 3CMAF 1H47A 3D01A 3CCVF 3GHZA 1ZWZA 3WXMB 1QVFF 4IHJB 5HXUA 1U3PA 1K9MH 1K73H 3CCJF 1SA0A 5EZYB 3RYIA 4X1YB 3B6NA 5GIOC 2OTJF 2QA4F 5GIPC 4PWTA 2HRYA 4ZOLA 3UT5B 3HAXD 3IEQA 3N2KB 3IEWA 4O4IA 5J2TB 3NVKE 3ZOPA 2HVYD 3C8LA 2EWCA 1YITF 2UYKA 5J2UB 3SIUA 1VQLF 1T0AA 1KQSF 5IJ0A 3FPIA 1JFFB 1Q8RA 3N2KA 5JCOA 3I7TA 3ELCA 3RA5A 4RQOA 3CG6A 2N48A 4EI9A 3T80A 3TD5A 1JFFA 1NQ3A 1FNKA 1VHAA 3WJPA 4RHAA 5LOVA 2JNBA 5EB1B 4C82A 2UYNB 2F9ZC 2DT4A 2RHHA 5LXTB 3P10A 3E20B 5EIBC 4I4TB 5IYZA 4BVQA 3U0OA 2LBXA 3ERNA 1XHOA 5CA0B 5EYPA 4G4XA 1W5AA 4B5CA 4C4WC 2RHOA 3HTNA 4YJ2A 3FD6A 2UYPA 3DC2A 5IJ9B 4ZI7A 4ZHQB 3CCEF 1YJ9F 1KNKA 4NWOB 4B62A 4EB6B 2VXYA 5MN5A 4X1IB 2R6R1 4O4LB 2ZOVA 3RYFB 3ZP4A 3IMPA 1QVGF 4F6RB 1GZ0A 4X1IA 3FD5A 1DT9A 1CLIA 4XCQA 3S02A 3MCQA 1VQ4F 5HXZA 3RYHB 1QAHA 4DRXB 1PXWA 2G9IA 3QUWA 3CC4F 4G4YA 1ODEA 1Z5WA 3TD3A 4ZHYB 3D54A 3KHNA 3JASB 1IV4A 4E6EA 2QTPA 3IKFA 3ZP7A 2W8BC 4X3MA 3CCUF 2HX0A 4BVRA 3C9RA 3KJJA 3PAFA 5HY0A 2R751 1VH8A 3OW2F 1X52A 1W581 1W5FA 3C9UA 3K0TA 4BT6A 3J7AR 1XRGA 5LYJB 5JCOC 2ZAUA 3N2GB 2Q1XA 4FFBB 2Z1FA 2LBWA 2BO1A 1JN1A 2V9YA 2Z1TA 1H48A 3RE3A 1VK3A 2H6LA 3F6MA 1TVKA 1X7OA 3BYQA 3R0PA 1YI2F 4X1KA 1VQPF 5JVDA 2VAPA 5EAZA 1NJIH 3FBAA 2HQSC 3JAWA 3WGNA 3JVHA 1W2BF 3E22A 2I6DA 3IKEA 3WPXA 4R40B 3OONA 3VMFB 3JCMM 2GZLA 3M4SA 3P0ZA 4G88A 1VQ7F 1RLGA 5HWEA 2CW4A 4C8EA 3S0HA 4ZHVA 1R1MA 3HJWC 3O85A 4X20A 4ZOLB 3JARA 4O4IB 5JH7A 3G4SF 3WGMA 3CC7F 4BVTA 2IG8A 3WJQA 2Z1UA 3VTIC 1W3EX 1COMA 4O4JB 1IV1A 5IJ0B 1VQ8F 3WGKA 5EWRA 4TV9A 1W41A 1OFUA 5CA1A 1GO1A 5HP7A 2ZVZA 4O4JA 4ZHWA 1Q86H 1X7PA 2H8EA 5A2QM 3EORA 1W57A 4B46A 5LOVB 2CWJA 2GVIA 5LP6C 3CB2A 5GONB 4C81A 1FFXA 3VOAA 2QI2A 3NVIB 1FNJA 1W5BA 5IYZB 2CZWA 5MN4A 3CCSF 3QHDA 1JD1A 3WJRA 3SIVA 3RA6A 3WGLA 5EB0A 4O4HA 5HY4A 3RYCA 3DDNA 5GONA 3HKCA 5EYPB 3N4YA 3LYBA 2K1SA 4YJ2B 5HP8A 1SDSA 2CSLA 3M84A 4O2AB 4ZI7B 3CC2F 5C8YA 4WBNA 3M1XA 4EI7A 3MDOA 1KC8H 3VCZA 3CYPB 3HKBA 4LCKA 4O2AA 3VYUC 4BT4A 1GX1A 3JAMM 4IIJA 4BT3A 2YXZA 1VQNF 1SZQA 5FLXM 2KGWA 4M8IA 3K12A 2VAWA 2BTOA 5HY2A 4I55B 5HY1A 1QD9A 5LP6B 1W5EA 2PHNA 3CCMF 4G4VA 3S0WA 2I6RA 3G6EF 4I55A 2QEXF 3N4ZA 4KWEA 1JJ2F 4G4WA 3S0YA 2HS0A 3Q8HA 5LP6A 5LA6A 1KNJA 5KX5A 1U3LA 3MCAB 4U3JB 1M90H 3F0FA 1TVKB 1JY8A 5EO3A 3JALB 5ITZA 1QU9A 1PF5A 4X1KB 5JVDB 4TUYA 1H7MA 4U3JA 3JAWB 3LWOC 5FNVB 2PMPA 3E22B 2KG4A 5B8FA 3JALA 3VO8A 2Z01A 1VQ6F 2LBTA 3V7QA 1Z5VA 4BW0B 3WGJA 2OHWA 1IV3A 3G71F 4BT2A 3JATA 5CB4B 2VGMA 1M1KH 5FNVA 5BMVA 2ZODA 1VQKF 4X20B 3D00A 3JARB 3MBMA 3VYTC
chains in the Genus database with same CATH topology
2CVLA 5HP8A 3ZO8A 1ONIA 2DYYA 3M4SA 2CSLA 5HP7A 4ZK7A 2UYNA 1QU9A 1XHOA 1PF5A 2B33A 2CHSA 2OTMA 1QD9A 3D01A 3I7TA 2CW4A 1QAHA 3M1XA 3MQWA 1J7HA 1DBFA 3QUWA 1UFYA 3LMEA 3VCZA 1ODEA 2CWJA 2UYPA 1UI9A 3R0PA 3I3FA 3V4DA 2IG8A 3ZP7A 2CHTA 4NWOB 1NQ3A 3L7QA 1FNJA 3KJJA 1FNKA 1JD1A 1COMA 3ZP4A 2UYNB 3K0TA 3ZOPA 1XRGA 1X25A 2EWCA 3GTZA 2UYKA 3LYBA 2UYJA 3K12A 3KJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVL A;  5HP8 A;  3ZO8 A;  1ONI A;  2DYY A;  3M4S A;  2CSL A;  5HP7 A;  4ZK7 A;  2UYN A;  1QU9 A;  1XHO A;  1PF5 A;  2B33 A;  2CHS A;  2OTM A;  1QD9 A;  3D01 A;  3I7T A;  2CW4 A;  1QAH A;  3M1X A;  3MQW A;  1J7H A;  1DBF A;  3QUW A;  1UFY A;  3LME A;  3VCZ A;  1ODE A;  2CWJ A;  2UYP A;  1UI9 A;  3R0P A;  3I3F A;  3V4D A;  2IG8 A;  3ZP7 A;  2CHT A;  4NWO B;  1NQ3 A;  3L7Q A;  1FNJ A;  3KJJ A;  1FNK A;  1JD1 A;  1COM A;  3ZP4 A;  2UYN B;  3K0T A;  3ZOP A;  1XRG A;  1X25 A;  2EWC A;  3GTZ A;  2UYK A;  3LYB A;  2UYJ A;  3K12 A;  3KJK A; 
#chains in the Genus database with same CATH topology
 3JAK A;  5EIB D;  5JH7 B;  4B45 A;  3ON1 A;  3LWP C;  5CB4 A;  3CCR F;  4YJ3 A;  3LME A;  4G4Z A;  2MQE A;  3LFO A;  1OAP A;  2IQQ A;  3L7Q A;  2L26 A;  1RA4 A;  4TV9 B;  3V3T A;  5CA1 B;  2FC3 A;  2HS4 A;  3CXC F;  3KJK A;  3I55 F;  5JQG B;  1FFX B;  3F0G A;  3AGK A;  1K8A H;  1XV2 A;  3MQW A;  4C8I A;  2FGY A;  3C9S A;  3K14 A;  4O2B B;  1CK2 A;  1VQO F;  1N8R H;  2OZB A;  4O4H B;  3VOB A;  3CPW F;  3RYC B;  4LNU B;  3TD4 A;  5JQG A;  3HKC B;  2UZH A;  1GO0 A;  5FJ4 C;  3CD6 F;  2VAM A;  4IHJ A;  3QTY A;  4U39 A;  4O2B A;  5EZY A;  1RQ2 A;  3CPQ A;  5C8Y B;  4WBN B;  4X1Y A;  1E7K A;  4LNU A;  3GTZ A;  4NUT A;  1S72 F;  5GIN C;  1IV2 A;  5KMG B;  3UT5 A;  4EI8 A;  3HKB B;  5J2T A;  1RLU A;  1W40 A;  5J2U A;  3KE1 A;  1UFY A;  3NK6 A;  4IIJ B;  1FSZ A;  1TUB B;  1NMU B;  5KMG A;  3F0E A;  4NQ3 A;  1YQN A;  2WAL A;  5DCV A;  3J81 M;  2GLZ A;  3OBY A;  4BT7 A;  1TUB A;  2P6Y A;  1X25 A;  1KD1 H;  4I50 B;  3LWV C;  3GYQ A;  3E1Y A;  1W42 A;  2HP3 A;  4TZZ A;  4C8G A;  3HWU A;  2AIF A;  3K2X A;  1Q7Y H;  4BVS A;  3HKE B;  2UYN A;  5LXT A;  1DBF A;  4I50 A;  4I4T A;  5LA6 B;  2RB9 A;  3V4D A;  5KX5 B;  3HKE A;  5CA0 A;  2RHJ A;  2OTL F;  2HS3 A;  1YJN F;  2HP0 B;  3WPW A;  5ITZ B;  2AIZ P;  5IJ9 A;  1XBI A;  4ZHQ A;  4ERH A;  4EB6 A;  1T0K B;  3I56 F;  2UYJ A;  2KTU A;  4TUY B;  5GAN K;  2KTV A;  4O4L A;  3CCQ F;  3FFM A;  2CVL A;  1VQ9 F;  2HP0 A;  3RYF A;  2ALE A;  1CN7 A;  1VQ5 F;  3CCL F;  2LCA A;  3NK7 A;  4F6R A;  3P4E A;  3LWQ C;  2AMT A;  2ZVY A;  3JAT B;  1UI9 A;  2ZF8 A;  2VGN A;  5BMV B;  5MN6 A;  3RYH A;  4X3L A;  4DRX A;  2NMU A;  2YYE A;  3JAK B;  3PLA C;  3JAS A;  4TV8 B;  5IT9 M;  1Q82 H;  3NMU C;  2BTU A;  1VQV A;  1W55 A;  2RHL A;  5G4V C;  1YHQ F;  3CME F;  1U43 A;  4YJ3 B;  1YGY A;  1VQM F;  3IR9 A;  1IPA A;  2Q1Y A;  1ONI A;  2DYY A;  4HNA B;  3LWR C;  2BTQ B;  3OBW A;  4ZK7 A;  2IAF A;  2B33 A;  2CHS A;  4TV8 A;  2OTM A;  5LYJ A;  4DXD A;  3C9T A;  3N2G A;  1J7H A;  1W59 A;  2Z1E A;  3F0D A;  3ESJ A;  3I3F A;  4FFB A;  4HNA A;  1RQ7 A;  2HRU A;  3KIZ A;  2CHT A;  3LDT A;  3V7E A;  3HKD B;  5GAP K;  3S06 A;  1U40 A;  3VI6 A;  3VYS C;  3VIU A;  2H8C A;  4BY9 D;  5AVM A;  3S03 A;  5G4U C;  1YJW F;  3HKD A;  1SA0 B;  3CYQ A;  1YIJ F;  4BT5 A;  1Q81 H;  3RYI B;  3ZO8 A;  3J80 M;  3CMA F;  1H47 A;  3D01 A;  3CCV F;  3GHZ A;  1ZWZ A;  3WXM B;  1QVF F;  4IHJ B;  5HXU A;  1U3P A;  1K9M H;  1K73 H;  3CCJ F;  1SA0 A;  5EZY B;  3RYI A;  4X1Y B;  3B6N A;  5GIO C;  2OTJ F;  2QA4 F;  5GIP C;  4PWT A;  2HRY A;  4ZOL A;  3UT5 B;  3HAX D;  3IEQ A;  3N2K B;  3IEW A;  4O4I A;  5J2T B;  3NVK E;  3ZOP A;  2HVY D;  3C8L A;  2EWC A;  1YIT F;  2UYK A;  5J2U B;  3SIU A;  1VQL F;  1T0A A;  1KQS F;  5IJ0 A;  3FPI A;  1JFF B;  1Q8R A;  3N2K A;  5JCO A;  3I7T A;  3ELC A;  3RA5 A;  4RQO A;  3CG6 A;  2N48 A;  4EI9 A;  3T80 A;  3TD5 A;  1JFF A;  1NQ3 A;  1FNK A;  1VHA A;  3WJP A;  4RHA A;  5LOV A;  2JNB A;  5EB1 B;  4C82 A;  2UYN B;  2F9Z C;  2DT4 A;  2RHH A;  5LXT B;  3P10 A;  3E20 B;  5EIB C;  4I4T B;  5IYZ A;  4BVQ A;  3U0O A;  2LBX A;  3ERN A;  1XHO A;  5CA0 B;  5EYP A;  4G4X A;  1W5A A;  4B5C A;  4C4W C;  2RHO A;  3HTN A;  4YJ2 A;  3FD6 A;  2UYP A;  3DC2 A;  5IJ9 B;  4ZI7 A;  4ZHQ B;  3CCE F;  1YJ9 F;  1KNK A;  4NWO B;  4B62 A;  4EB6 B;  2VXY A;  5MN5 A;  4X1I B;  2R6R 1;  4O4L B;  2ZOV A;  3RYF B;  3ZP4 A;  3IMP A;  1QVG F;  4F6R B;  1GZ0 A;  4X1I A;  3FD5 A;  1DT9 A;  1CLI A;  4XCQ A;  3S02 A;  3MCQ A;  1VQ4 F;  5HXZ A;  3RYH B;  1QAH A;  4DRX B;  1PXW A;  2G9I A;  3QUW A;  3CC4 F;  4G4Y A;  1ODE A;  1Z5W A;  3TD3 A;  4ZHY B;  3D54 A;  3KHN A;  3JAS B;  1IV4 A;  4E6E A;  2QTP A;  3IKF A;  3ZP7 A;  2W8B C;  4X3M A;  3CCU F;  2HX0 A;  4BVR A;  3C9R A;  3KJJ A;  3PAF A;  5HY0 A;  2R75 1;  1VH8 A;  3OW2 F;  1X52 A;  1W58 1;  1W5F A;  3C9U A;  3K0T A;  4BT6 A;  3J7A R;  1XRG A;  5LYJ B;  5JCO C;  2ZAU A;  3N2G B;  2Q1X A;  4FFB B;  2Z1F A;  2LBW A;  2BO1 A;  1JN1 A;  2V9Y A;  2Z1T A;  1H48 A;  3RE3 A;  1VK3 A;  2H6L A;  3F6M A;  1TVK A;  1X7O A;  3BYQ A;  3R0P A;  1YI2 F;  4X1K A;  1VQP F;  5JVD A;  2VAP A;  5EAZ A;  1NJI H;  3FBA A;  2HQS C;  3JAW A;  3WGN A;  3JVH A;  1W2B F;  3E22 A;  2I6D A;  3IKE A;  3WPX A;  4R40 B;  3OON A;  3VMF B;  3JCM M;  2GZL A;  3M4S A;  3P0Z A;  4G88 A;  1VQ7 F;  1RLG A;  5HWE A;  2CW4 A;  4C8E A;  3S0H A;  4ZHV A;  1R1M A;  3HJW C;  3O85 A;  4X20 A;  4ZOL B;  3JAR A;  4O4I B;  5JH7 A;  3G4S F;  3WGM A;  3CC7 F;  4BVT A;  2IG8 A;  3WJQ A;  2Z1U A;  3VTI C;  1W3E X;  1COM A;  4O4J B;  1IV1 A;  5IJ0 B;  1VQ8 F;  3WGK A;  5EWR A;  4TV9 A;  1W41 A;  1OFU A;  5CA1 A;  1GO1 A;  5HP7 A;  2ZVZ A;  4O4J A;  4ZHW A;  1Q86 H;  1X7P A;  2H8E A;  5A2Q M;  3EOR A;  1W57 A;  4B46 A;  5LOV B;  2CWJ A;  2GVI A;  5LP6 C;  3CB2 A;  5GON B;  4C81 A;  1FFX A;  3VOA A;  2QI2 A;  3NVI B;  1FNJ A;  1W5B A;  5IYZ B;  2CZW A;  5MN4 A;  3CCS F;  3QHD A;  1JD1 A;  3WJR A;  3SIV A;  3RA6 A;  3WGL A;  5EB0 A;  4O4H A;  5HY4 A;  3RYC A;  3DDN A;  5GON A;  3HKC A;  5EYP B;  3N4Y A;  3LYB A;  2K1S A;  4YJ2 B;  5HP8 A;  1SDS A;  2CSL A;  3M84 A;  4O2A B;  4ZI7 B;  3CC2 F;  5C8Y A;  4WBN A;  3M1X A;  4EI7 A;  3MDO A;  1KC8 H;  3VCZ A;  3CYP B;  3HKB A;  4LCK A;  4O2A A;  3VYU C;  4BT4 A;  1GX1 A;  3JAM M;  4IIJ A;  4BT3 A;  2YXZ A;  1VQN F;  1SZQ A;  5FLX M;  2KGW A;  4M8I A;  3K12 A;  2VAW A;  2BTO A;  5HY2 A;  4I55 B;  5HY1 A;  1QD9 A;  5LP6 B;  1W5E A;  2PHN A;  3CCM F;  4G4V A;  3S0W A;  2I6R A;  3G6E F;  4I55 A;  2QEX F;  3N4Z A;  4KWE A;  1JJ2 F;  4G4W A;  3S0Y A;  2HS0 A;  3Q8H A;  5LP6 A;  5LA6 A;  1KNJ A;  5KX5 A;  1U3L A;  3MCA B;  4U3J B;  1M90 H;  3F0F A;  1TVK B;  1JY8 A;  5EO3 A;  3JAL B;  5ITZ A;  1QU9 A;  1PF5 A;  4X1K B;  5JVD B;  4TUY A;  1H7M A;  4U3J A;  3JAW B;  3LWO C;  5FNV B;  2PMP A;  3E22 B;  2KG4 A;  5B8F A;  3JAL A;  3VO8 A;  2Z01 A;  1VQ6 F;  2LBT A;  3V7Q A;  1Z5V A;  4BW0 B;  3WGJ A;  2OHW A;  1IV3 A;  3G71 F;  4BT2 A;  3JAT A;  5CB4 B;  2VGM A;  1M1K H;  5FNV A;  5BMV A;  2ZOD A;  1VQK F;  4X20 B;  3D00 A;  3JAR B;  3MBM A;  3VYT C; 
#chains in the Genus database with same CATH homology
 2CVL A;  5HP8 A;  3ZO8 A;  1ONI A;  2DYY A;  3M4S A;  2CSL A;  5HP7 A;  4ZK7 A;  2UYN A;  1QU9 A;  1XHO A;  1PF5 A;  2B33 A;  2CHS A;  2OTM A;  1QD9 A;  3D01 A;  3I7T A;  2CW4 A;  1QAH A;  3M1X A;  3MQW A;  1J7H A;  1DBF A;  3QUW A;  1UFY A;  3LME A;  3VCZ A;  1ODE A;  2CWJ A;  2UYP A;  1UI9 A;  3R0P A;  3I3F A;  3V4D A;  2IG8 A;  3ZP7 A;  2CHT A;  4NWO B;  1NQ3 A;  3L7Q A;  1FNJ A;  3KJJ A;  1FNK A;  1JD1 A;  1COM A;  3ZP4 A;  2UYN B;  3K0T A;  3ZOP A;  1XRG A;  1X25 A;  2EWC A;  3GTZ A;  2UYK A;  3LYB A;  2UYJ A;  3K12 A;  3KJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...