3ZP4A

Arg90cit chorismate mutase of bacillus subtilis in complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 29
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zp4A00
2OTMA 3ZP7A 2EWCA 3QUWA 5HP7A 1QU9A 2CW4A 2CHTA 3M4SA 3VCZA 2CVLA 3K12A 3KJKA 3ZP4A 1J7HA 1FNJA 3I3FA 2IG8A 2B33A 3R0PA 1XHOA 3M1XA 2CSLA 1FNKA 3LYBA 5HP8A 1QAHA 3LMEA 3ZO8A 2UYJA 1ODEA 3I7TA 3KJJA 3GTZA 2UYNA 1COMA 3MQWA 2UYPA 3V4DA 2CWJA 1QD9A 1UI9A 1JD1A 2CHSA 1NQ3A 3ZOPA 1X25A 1UFYA 1XRGA 1PF5A 3K0TA 2DYYA 1ONIA 3L7QA 4ZK7A 2UYNB 4NWOB 2UYKA 1DBFA 3D01A
chains in the Genus database with same CATH superfamily
3E1YA 5EIBC 5EB1B 4IIJA 2PHNA 3KJKA 2RHHA 3F6MA 3FD5A 3D00A 2QEXF 4TUYA 3C9UA 3VIUA 3JCMM 2HS4A 1JY8A 4F6RA 1VQMF 5LXTB 1JN1A 3WPXA 4O4HB 4ZI7A 3HKDA 1QD9A 5LP6A 3HKEB 1W2BF 3AGKA 4ZOLA 3K0TA 3QHDA 4X1KA 1ZWZA 4LNUB 4BVTA 2LBWA 5HY0A 5C8YB 1VQ4F 4XCQA 1GO0A 3M4SA 4O2AA 3K12A 1TUBA 3MDOA 4X20B 2Z1TA 4R40B 5J2TB 5FNVA 2H8CA 3SIVA 2HQSC 1NJIH 4HNAA 3RYHB 3S0YA 3J80M 3VO8A 1QAHA 2GLZA 1W5FA 3F0DA 3JAMM 3G4SF 3CC7F 4G4XA 3IKEA 4G4VA 3ZOPA 2BTOA 3WPWA 5AVMA 3L7QA 3EORA 3Q8HA 1E7KA 1K9MH 3JALA 2HRYA 4C8GA 4X1YA 3S03A 3FD6A 1XBIA 4ZHQA 3LYBA 4IHJA 2Z01A 4RHAA 3LFOA 5GIPC 3MCAB 4B5CA 5GONB 3ESJA 3J81M 1COMA 5KX5A 3S0HA 3CCSF 1SA0A 3RA5A 3VI6A 3WGNA 4BT5A 1XV2A 3OBWA 5HXUA 2VAWA 5ITZA 3CG6A 1OFUA 2HP3A 4FFBA 1DBFA 1KNKA 2CZWA 3QTYA 2HP0B 1R1MA 3CYPB 3FPIA 1KNJA 2R6R1 5BMVA 5EO3A 5EYPA 5B8FA 1JJ2F 3I7TA 4I50B 3GYQA 4DXDA 2CWJA 1KQSF 3IR9A 1UI9A 4O4JB 2Q1YA 2Z1FA 4YJ2A 3JAKA 4EB6B 3S06A 3HKBB 1SDSA 2WALA 4C82A 1TVKB 3P4EA 3MBMA 4WBNA 1X7PA 2NMUA 1W55A 2QA4F 5EZYA 3LDTA 3CXCF 1FFXB 3B6NA 1YITF 3SIUA 1VQNF 4IIJB 3E20B 2UYNA 4BT6A 1JD1A 3CB2A 1NQ3A 4TUYB 3P10A 1H7MA 3CCLF 4G88A 4ZK7A 3WJQA 4F6RB 1VQPF 4G4ZA 2OHWA 2V9YA 4ZI7B 3HKDB 5LP6B 5HY2A 2EWCA 2FC3A 1VK3A 2VGNA 3HTNA 2QI2A 4ZOLB 4X1KB 1W40A 3CC4F 3RYCA 3LWPC 3IKFA 4O2AB 1TUBB 3GHZA 5FNVB 2VGMA 1H47A 5JVDA 3U0OA 5JCOA 3BYQA 2Z1UA 5LOVA 4X1IA 5HY4A 1UFYA 3JARA 2YYEA 2F9ZC 1K8AH 2KGWA 1JFFA 2HS3A 2CVLA 2ZF8A 1NMUB 2BTUA 5JQGA 1VQ8F 1XHOA 2BTQB 3M1XA 4O4IA 3NK7A 5HP8A 3WJRA 3V7QA 2KTUA 2OTLF 2KTVA 3JALB 4I4TA 5LP6C 1Q82H 4X1YB 2L26A 2UYPA 5LYJA 3VYSC 4O2BA 4RQOA 2RHOA 4ZHQB 1IV2A 4IHJB 3PLAC 1N8RH 5GINC 5IJ0A 3TD5A 4B45A 2HS0A 1CLIA 3QUWA 4G4YA 3WXMB 5KX5B 3ELCA 5MN4A 4B62A 3CPQA 4TV8B 3I56F 4DRXA 4B46A 1X7OA 2IG8A 1QVGF 4FFBB 2LBTA 5GANK 3HKCA 1FNKA 4C81A 3M84A 3CPWF 5FJ4C 3NK6A 5HXZA 5BMVB 1IV1A 3HAXD 5KMGA 3JASA 1W42A 3V7EA 1RQ7A 1YHQF 5EYPB 3TD3A 3UT5A 5DCVA 3N2GA 1Q81H 5G4UC 3CCQF 1U3PA 1RQ2A 2UYKA 3D01A 2OTMA 3ZP7A 1GZ0A 4YJ2B 3JAKB 1J7HA 1CN7A 3R0PA 3JAWA 2AIFA 3V3TA 4U39A 2AIZP 2AMTA 3K2XA 3P0ZA 1VH8A 2FGYA 3VOBA 4WBNB 4I55A 1GO1A 5EZYB 4EI9A 3D54A 5IJ9A 3WGLA 5FLXM 5IYZA 2CHSA 1Z5VA 1VQOF 1X25A 2R751 4ZHYB 5GIOC 5CB4A 1T0KB 2OZBA 4BVQA 3FBAA 2UYNB 3GTZA 2VAPA 3RYIA 4BW0B 4C8EA 4BT7A 2ZVZA 3F0GA 1M1KH 5CA0A 1RA4A 1IV3A 4C8IA 5G4VC 3HJWC 3ZO8A 2HVYD 5MN6A 4X3LA 1YI2F 5IT9M 1YJNF 1X52A 3VTIC 3RYCB 1VQKF 4YJ3A 2BO1A 4G4WA 4O4LA 3WGKA 5JVDB 4NWOB 2PMPA 1PXWA 2LBXA 3HWUA 2CW4A 5LOVB 4X1IB 3JARB 4BT2A 1YJWF 3CCJF 2B33A 1JFFB 5CA1A 4U3JA 1CK2A 3C9SA 3OONA 3LWVC 1Q86H 1OAPA 3I55F 3JATA 3N2KA 5JQGB 3MQWA 1Q7YH 3NVKE 4O4IB 4HNAB 1U43A 3F0FA 1T0AA 4I4TB 2JNBA 3TD4A 3CMEF 3WGJA 4BY9D 3MCQA 1W59A 2RHJA 1W57A 4O2BB 5LA6A 5LYJB 3T80A 4PWTA 1KC8H 3O85A 5IJ0B 1W5BA 1VHAA 1QVFF 2MQEA 3E22A 3IEWA 2CSLA 3IEQA 5J2UA 3J7AR 4TV9A 3NMUC 5JH7A 4DRXB 3RYFA 3LWQC 5JCOC 1FSZA 2N48A 1SZQA 3HKCB 2ZAUA 3G71F 1S72F 3OBYA 1ONIA 4ERHA 4M8IA 3WGMA 1W3EX 1W581 5EWRA 3CCVF 4ZHVA 2ZVYA 3JASB 5KMGB 2LCAA 5EAZA 5HP7A 1SA0B 4E6EA 2CHTA 3VCZA 2P6YA 3UT5B 4C4WC 5HWEA 3I3FA 3N2GB 5ITZB 5LXTA 2ZOVA 2VAMA 3JVHA 4O4HA 3CCUF 3HKEA 3K14A 2Q1XA 1Q8RA 4LNUA 1VQLF 1DT9A 3F0EA 3JAWB 5C8YA 2RB9A 2GZLA 3KIZA 3CD6F 5J2TA 4X20A 4I55B 2H8EA 3CCEF 2UZHA 4EI7A 1YJ9F 3VYUC 5IJ9B 3CCRF 3RYHA 1IV4A 1RLUA 3G6EF 1K73H 5EB0A 5IYZB 3C9TA 3OW2F 5CB4B 1FNJA 5A2QM 3KE1A 3CYQA 2I6RA 4BT4A 3NVIB 3RYIB 4NUTA 3CMAF 1YGYA 3LMEA 3KJJA 2OTJF 3ERNA 3VYTC 3PAFA 2IAFA 5MN5A 2RHLA 1VQ6F 1Z5WA 2HX0A 4TV8A 3DC2A 2ZODA 1M90H 5CA0B 1VQ9F 1U40A 1GX1A 1PF5A 4TZZA 4X3MA 2IQQA 1YIJF 1VQ5F 3C9RA 4ZHWA 2QTPA 2Z1EA 2K1SA 4YJ3B 5GONA 2W8BC 4O4LB 1RLGA 1H48A 5GAPK 3CCMF 3S02A 2ALEA 3N4YA 2H6LA 4BVSA 1YQNA 2UYJA 1ODEA 3N4ZA 3IMPA 3CC2F 3V4DA 2G9IA 2KG4A 2HP0A 3VOAA 4EI8A 5CA1B 4U3JB 4KWEA 2I6DA 3JATB 3N2KB 1VQVA 1W41A 2HRUA 1W5AA 3LWRC 1QU9A 1W5EA 3FFMA 1VQ7F 4I50A 3ZP4A 2GVIA 3S0WA 3VMFB 3WJPA 3C8LA 5LA6B 2DT4A 4O4JA 3RA6A 1IPAA 2VXYA 3KHNA 4EB6A 3DDNA 3HKBA 5EIBD 3ON1A 4NQ3A 5HY1A 1U3LA 1TVKA 3E22B 3LWOC 3RE3A 1KD1H 5J2UB 4BT3A 1XRGA 4TV9B 5JH7B 2DYYA 4BVRA 4LCKA 3RYFB 1FFXA 2YXZA
chains in the Genus database with same CATH topology
2OTMA 3ZP7A 2EWCA 3QUWA 5HP7A 1QU9A 2CW4A 2CHTA 3M4SA 3VCZA 2CVLA 3K12A 3KJKA 3ZP4A 1J7HA 1FNJA 3I3FA 2IG8A 2B33A 3R0PA 1XHOA 3M1XA 2CSLA 1FNKA 3LYBA 5HP8A 1QAHA 3LMEA 3ZO8A 2UYJA 1ODEA 3I7TA 3KJJA 3GTZA 2UYNA 1COMA 3MQWA 2UYPA 3V4DA 2CWJA 1QD9A 1UI9A 1JD1A 2CHSA 1NQ3A 3ZOPA 1X25A 1UFYA 1XRGA 1PF5A 3K0TA 2DYYA 1ONIA 3L7QA 4ZK7A 2UYNB 4NWOB 2UYKA 1DBFA 3D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTM A;  3ZP7 A;  2EWC A;  3QUW A;  5HP7 A;  1QU9 A;  2CW4 A;  2CHT A;  3M4S A;  3VCZ A;  2CVL A;  3K12 A;  3KJK A;  3ZP4 A;  1J7H A;  1FNJ A;  3I3F A;  2IG8 A;  2B33 A;  3R0P A;  1XHO A;  3M1X A;  2CSL A;  1FNK A;  3LYB A;  5HP8 A;  1QAH A;  3LME A;  3ZO8 A;  2UYJ A;  1ODE A;  3I7T A;  3KJJ A;  3GTZ A;  2UYN A;  1COM A;  3MQW A;  2UYP A;  3V4D A;  2CWJ A;  1QD9 A;  1UI9 A;  1JD1 A;  2CHS A;  1NQ3 A;  3ZOP A;  1X25 A;  1UFY A;  1XRG A;  1PF5 A;  3K0T A;  2DYY A;  1ONI A;  3L7Q A;  4ZK7 A;  2UYN B;  4NWO B;  2UYK A;  1DBF A;  3D01 A; 
#chains in the Genus database with same CATH topology
 3E1Y A;  5EIB C;  5EB1 B;  4IIJ A;  2PHN A;  3KJK A;  2RHH A;  3F6M A;  3FD5 A;  3D00 A;  2QEX F;  4TUY A;  3C9U A;  3VIU A;  3JCM M;  2HS4 A;  1JY8 A;  4F6R A;  1VQM F;  5LXT B;  1JN1 A;  3WPX A;  4O4H B;  4ZI7 A;  3HKD A;  1QD9 A;  5LP6 A;  3HKE B;  1W2B F;  3AGK A;  4ZOL A;  3K0T A;  3QHD A;  4X1K A;  1ZWZ A;  4LNU B;  4BVT A;  2LBW A;  5HY0 A;  5C8Y B;  1VQ4 F;  4XCQ A;  1GO0 A;  3M4S A;  4O2A A;  3K12 A;  1TUB A;  3MDO A;  4X20 B;  2Z1T A;  4R40 B;  5J2T B;  5FNV A;  2H8C A;  3SIV A;  2HQS C;  1NJI H;  4HNA A;  3RYH B;  3S0Y A;  3J80 M;  3VO8 A;  1QAH A;  2GLZ A;  1W5F A;  3F0D A;  3JAM M;  3G4S F;  3CC7 F;  4G4X A;  3IKE A;  4G4V A;  3ZOP A;  2BTO A;  3WPW A;  5AVM A;  3L7Q A;  3EOR A;  3Q8H A;  1E7K A;  1K9M H;  3JAL A;  2HRY A;  4C8G A;  4X1Y A;  3S03 A;  3FD6 A;  1XBI A;  4ZHQ A;  3LYB A;  4IHJ A;  2Z01 A;  4RHA A;  3LFO A;  5GIP C;  3MCA B;  4B5C A;  5GON B;  3ESJ A;  3J81 M;  1COM A;  5KX5 A;  3S0H A;  3CCS F;  1SA0 A;  3RA5 A;  3VI6 A;  3WGN A;  4BT5 A;  1XV2 A;  3OBW A;  5HXU A;  2VAW A;  5ITZ A;  3CG6 A;  1OFU A;  2HP3 A;  4FFB A;  1DBF A;  1KNK A;  2CZW A;  3QTY A;  2HP0 B;  1R1M A;  3CYP B;  3FPI A;  1KNJ A;  2R6R 1;  5BMV A;  5EO3 A;  5EYP A;  5B8F A;  1JJ2 F;  3I7T A;  4I50 B;  3GYQ A;  4DXD A;  2CWJ A;  1KQS F;  3IR9 A;  1UI9 A;  4O4J B;  2Q1Y A;  2Z1F A;  4YJ2 A;  3JAK A;  4EB6 B;  3S06 A;  3HKB B;  1SDS A;  2WAL A;  4C82 A;  1TVK B;  3P4E A;  3MBM A;  4WBN A;  1X7P A;  2NMU A;  1W55 A;  2QA4 F;  5EZY A;  3LDT A;  3CXC F;  1FFX B;  3B6N A;  1YIT F;  3SIU A;  1VQN F;  4IIJ B;  3E20 B;  2UYN A;  4BT6 A;  1JD1 A;  3CB2 A;  1NQ3 A;  4TUY B;  3P10 A;  1H7M A;  3CCL F;  4G88 A;  4ZK7 A;  3WJQ A;  4F6R B;  1VQP F;  4G4Z A;  2OHW A;  2V9Y A;  4ZI7 B;  3HKD B;  5LP6 B;  5HY2 A;  2EWC A;  2FC3 A;  1VK3 A;  2VGN A;  3HTN A;  2QI2 A;  4ZOL B;  4X1K B;  1W40 A;  3CC4 F;  3RYC A;  3LWP C;  3IKF A;  4O2A B;  1TUB B;  3GHZ A;  5FNV B;  2VGM A;  1H47 A;  5JVD A;  3U0O A;  5JCO A;  3BYQ A;  2Z1U A;  5LOV A;  4X1I A;  5HY4 A;  1UFY A;  3JAR A;  2YYE A;  2F9Z C;  1K8A H;  2KGW A;  1JFF A;  2HS3 A;  2CVL A;  2ZF8 A;  1NMU B;  2BTU A;  5JQG A;  1VQ8 F;  1XHO A;  2BTQ B;  3M1X A;  4O4I A;  3NK7 A;  5HP8 A;  3WJR A;  3V7Q A;  2KTU A;  2OTL F;  2KTV A;  3JAL B;  4I4T A;  5LP6 C;  1Q82 H;  4X1Y B;  2L26 A;  2UYP A;  5LYJ A;  3VYS C;  4O2B A;  4RQO A;  2RHO A;  4ZHQ B;  1IV2 A;  4IHJ B;  3PLA C;  1N8R H;  5GIN C;  5IJ0 A;  3TD5 A;  4B45 A;  2HS0 A;  1CLI A;  3QUW A;  4G4Y A;  3WXM B;  5KX5 B;  3ELC A;  5MN4 A;  4B62 A;  3CPQ A;  4TV8 B;  3I56 F;  4DRX A;  4B46 A;  1X7O A;  2IG8 A;  1QVG F;  4FFB B;  2LBT A;  5GAN K;  3HKC A;  1FNK A;  4C81 A;  3M84 A;  3CPW F;  5FJ4 C;  3NK6 A;  5HXZ A;  5BMV B;  1IV1 A;  3HAX D;  5KMG A;  3JAS A;  1W42 A;  3V7E A;  1RQ7 A;  1YHQ F;  5EYP B;  3TD3 A;  3UT5 A;  5DCV A;  3N2G A;  1Q81 H;  5G4U C;  3CCQ F;  1U3P A;  1RQ2 A;  2UYK A;  3D01 A;  2OTM A;  3ZP7 A;  1GZ0 A;  4YJ2 B;  3JAK B;  1J7H A;  1CN7 A;  3R0P A;  3JAW A;  2AIF A;  3V3T A;  4U39 A;  2AIZ P;  2AMT A;  3K2X A;  3P0Z A;  1VH8 A;  2FGY A;  3VOB A;  4WBN B;  4I55 A;  1GO1 A;  5EZY B;  4EI9 A;  3D54 A;  5IJ9 A;  3WGL A;  5FLX M;  5IYZ A;  2CHS A;  1Z5V A;  1VQO F;  1X25 A;  2R75 1;  4ZHY B;  5GIO C;  5CB4 A;  1T0K B;  2OZB A;  4BVQ A;  3FBA A;  2UYN B;  3GTZ A;  2VAP A;  3RYI A;  4BW0 B;  4C8E A;  4BT7 A;  2ZVZ A;  3F0G A;  1M1K H;  5CA0 A;  1RA4 A;  1IV3 A;  4C8I A;  5G4V C;  3HJW C;  3ZO8 A;  2HVY D;  5MN6 A;  4X3L A;  1YI2 F;  5IT9 M;  1YJN F;  1X52 A;  3VTI C;  3RYC B;  1VQK F;  4YJ3 A;  2BO1 A;  4G4W A;  4O4L A;  3WGK A;  5JVD B;  4NWO B;  2PMP A;  1PXW A;  2LBX A;  3HWU A;  2CW4 A;  5LOV B;  4X1I B;  3JAR B;  4BT2 A;  1YJW F;  3CCJ F;  2B33 A;  1JFF B;  5CA1 A;  4U3J A;  1CK2 A;  3C9S A;  3OON A;  3LWV C;  1Q86 H;  1OAP A;  3I55 F;  3JAT A;  3N2K A;  5JQG B;  3MQW A;  1Q7Y H;  3NVK E;  4O4I B;  4HNA B;  1U43 A;  3F0F A;  1T0A A;  4I4T B;  2JNB A;  3TD4 A;  3CME F;  3WGJ A;  4BY9 D;  3MCQ A;  1W59 A;  2RHJ A;  1W57 A;  4O2B B;  5LA6 A;  5LYJ B;  3T80 A;  4PWT A;  1KC8 H;  3O85 A;  5IJ0 B;  1W5B A;  1VHA A;  1QVF F;  2MQE A;  3E22 A;  3IEW A;  2CSL A;  3IEQ A;  5J2U A;  3J7A R;  4TV9 A;  3NMU C;  5JH7 A;  4DRX B;  3RYF A;  3LWQ C;  5JCO C;  1FSZ A;  2N48 A;  1SZQ A;  3HKC B;  2ZAU A;  3G71 F;  1S72 F;  3OBY A;  1ONI A;  4ERH A;  4M8I A;  3WGM A;  1W3E X;  1W58 1;  5EWR A;  3CCV F;  4ZHV A;  2ZVY A;  3JAS B;  5KMG B;  2LCA A;  5EAZ A;  5HP7 A;  1SA0 B;  4E6E A;  2CHT A;  3VCZ A;  2P6Y A;  3UT5 B;  4C4W C;  5HWE A;  3I3F A;  3N2G B;  5ITZ B;  5LXT A;  2ZOV A;  2VAM A;  3JVH A;  4O4H A;  3CCU F;  3HKE A;  3K14 A;  2Q1X A;  1Q8R A;  4LNU A;  1VQL F;  1DT9 A;  3F0E A;  3JAW B;  5C8Y A;  2RB9 A;  2GZL A;  3KIZ A;  3CD6 F;  5J2T A;  4X20 A;  4I55 B;  2H8E A;  3CCE F;  2UZH A;  4EI7 A;  1YJ9 F;  3VYU C;  5IJ9 B;  3CCR F;  3RYH A;  1IV4 A;  1RLU A;  3G6E F;  1K73 H;  5EB0 A;  5IYZ B;  3C9T A;  3OW2 F;  5CB4 B;  1FNJ A;  5A2Q M;  3KE1 A;  3CYQ A;  2I6R A;  4BT4 A;  3NVI B;  3RYI B;  4NUT A;  3CMA F;  1YGY A;  3LME A;  3KJJ A;  2OTJ F;  3ERN A;  3VYT C;  3PAF A;  2IAF A;  5MN5 A;  2RHL A;  1VQ6 F;  1Z5W A;  2HX0 A;  4TV8 A;  3DC2 A;  2ZOD A;  1M90 H;  5CA0 B;  1VQ9 F;  1U40 A;  1GX1 A;  1PF5 A;  4TZZ A;  4X3M A;  2IQQ A;  1YIJ F;  1VQ5 F;  3C9R A;  4ZHW A;  2QTP A;  2Z1E A;  2K1S A;  4YJ3 B;  5GON A;  2W8B C;  4O4L B;  1RLG A;  1H48 A;  5GAP K;  3CCM F;  3S02 A;  2ALE A;  3N4Y A;  2H6L A;  4BVS A;  1YQN A;  2UYJ A;  1ODE A;  3N4Z A;  3IMP A;  3CC2 F;  3V4D A;  2G9I A;  2KG4 A;  2HP0 A;  3VOA A;  4EI8 A;  5CA1 B;  4U3J B;  4KWE A;  2I6D A;  3JAT B;  3N2K B;  1VQV A;  1W41 A;  2HRU A;  1W5A A;  3LWR C;  1QU9 A;  1W5E A;  3FFM A;  1VQ7 F;  4I50 A;  3ZP4 A;  2GVI A;  3S0W A;  3VMF B;  3WJP A;  3C8L A;  5LA6 B;  2DT4 A;  4O4J A;  3RA6 A;  1IPA A;  2VXY A;  3KHN A;  4EB6 A;  3DDN A;  3HKB A;  5EIB D;  3ON1 A;  4NQ3 A;  5HY1 A;  1U3L A;  1TVK A;  3E22 B;  3LWO C;  3RE3 A;  1KD1 H;  5J2U B;  4BT3 A;  1XRG A;  4TV9 B;  5JH7 B;  2DYY A;  4BVR A;  4LCK A;  3RYF B;  1FFX A;  2YXZ A; 
#chains in the Genus database with same CATH homology
 2OTM A;  3ZP7 A;  2EWC A;  3QUW A;  5HP7 A;  1QU9 A;  2CW4 A;  2CHT A;  3M4S A;  3VCZ A;  2CVL A;  3K12 A;  3KJK A;  3ZP4 A;  1J7H A;  1FNJ A;  3I3F A;  2IG8 A;  2B33 A;  3R0P A;  1XHO A;  3M1X A;  2CSL A;  1FNK A;  3LYB A;  5HP8 A;  1QAH A;  3LME A;  3ZO8 A;  2UYJ A;  1ODE A;  3I7T A;  3KJJ A;  3GTZ A;  2UYN A;  1COM A;  3MQW A;  2UYP A;  3V4D A;  2CWJ A;  1QD9 A;  1UI9 A;  1JD1 A;  2CHS A;  1NQ3 A;  3ZOP A;  1X25 A;  1UFY A;  1XRG A;  1PF5 A;  3K0T A;  2DYY A;  1ONI A;  3L7Q A;  4ZK7 A;  2UYN B;  4NWO B;  2UYK A;  1DBF A;  3D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...