3CMAF

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmaF00
3NK7A 3CXCF 1K8AH 5EWRA 2KTUA 5GINC 2VGNA 1X7OA 3LWQC 1KQSF 3CCMF 1W2BF 3LWVC 2QEXF 1VQNF 1T0KB 3N4ZA 3JCMM 2LBXA 2I6DA 3CCQF 5GANK 3CCRF 1QVFF 1VQLF 1W40A 1YITF 3CD6F 1KC8H 1NJIH 3AGKA 3MCAB 1W41A 2CZWA 3E1YA 3LWRC 2JNBA 1S72F 2OZBA 3JAMM 1M90H 3G6EF 3PLAC 1ZWZA 3HAXD 3NMUC 3CG6A 1SDSA 1YIJF 3IR9A 1IPAA 1YJWF 5EO3A 3LFOA 5IT9M 2FC3A 4BY9D 1RLGA 1CN7A 1M1KH 1W42A 3CC4F 1VQ9F 1YJNF 3J7AR 4LCKA 1VQPF 3CMEF 2QA4F 3OBWA 3CCVF 2HVYD 2OTJF 2OTLF 2OHWA 1DT9A 3OW2F 1VQ4F 3O85A 4BW0B 4NUTA 3CC7F 3NVIB 1VQ7F 3CCSF 3CCUF 1XBIA 3J81M 1GO0A 1PXWA 1Q82H 3CCLF 5GIOC 3RA5A 1YJ9F 1VQMF 5FLXM 1Q7YH 2LBWA 3FFMA 3CMAF 3CPQA 1QVGF 2QI2A 3N4YA 4X3LA 3WXMB 1RA4A 5G4VC 3PAFA 3CPWF 1Q81H 5DCVA 3V7EA 1W3EX 2AIFA 3HJWC 5GAPK 3VI6A 3E20B 1GZ0A 3OBYA 3LWOC 3CCEF 5A2QM 1VQ6F 1NMUB 5G4UC 3I55F 1YI2F 1JJ2F 3SIUA 4TZZA 1VQ8F 3J80M 1GO1A 1VQ5F 3NVKE 2VGMA 1K9MH 1E7KA 2BO1A 3LWPC 1H7MA 3G4SF 3CC2F 2WALA 1VQKF 3GYQA 1N8RH 5GIPC 1KD1H 1CK2A 3VMFB 2ALEA 1K73H 3SIVA 4X3MA 4C4WC 5FJ4C 2KG4A 1X7PA 1VQOF 2KTVA 3V7QA 3CCJF 1Q86H 1YHQF 3RA6A 3I56F 3NK6A 3G71F 1X52A 3ON1A
chains in the Genus database with same CATH superfamily
2Z01A 2CSLA 5KMGB 3CXCF 3S0YA 5IJ0A 4G4ZA 2UYPA 3UT5A 3HTNA 3LDTA 5GINC 1ONIA 3C9TA 1XHOA 3HKEB 1T0AA 2LBXA 3MQWA 2YXZA 5GANK 3CCRF 3S03A 1W40A 3QUWA 1QD9A 1ODEA 5CB4A 1VHAA 2GVIA 2HS4A 1TVKB 3ZP4A 1W5FA 2Z1TA 3E1YA 3HWUA 3HKCA 3P10A 3KIZA 2JNBA 3VYUC 1S72F 2OZBA 3JVHA 1QU9A 4RHAA 2QTPA 3CG6A 1QAHA 1SDSA 5CA1A 2BTOA 3WPWA 3HKBA 3FD6A 1W55A 1FFXB 2CHTA 2H6LA 2B33A 4O2AA 2F9ZC 1VQVA 3D54A 1VQPF 2N48A 2IG8A 3OBWA 3CCVF 5J2UB 1RLUA 5LYJB 3HKDA 4B45A 1RQ7A 5IJ9A 1YGYA 5IJ0B 1TUBB 4BVSA 5JH7B 3CC7F 1XBIA 5BMVA 1PXWA 4X1KA 3M4SA 1Q82H 4I55A 1SZQA 1Z5WA 3CCLF 3JARA 5GIOC 1VH8A 4O4HA 5FLXM 3N2GA 2YYEA 1H47A 4G4XA 1IV2A 5JQGA 2QI2A 4X3LA 1RA4A 4ZI7B 4TV8A 3L7QA 4YJ3B 3S0HA 4TUYA 1W57A 4U39A 2L26A 4O2BA 3KJJA 1FNJA 4HNAA 3OBYA 5EB1B 3LWOC 1VQ6F 3N2KA 5HY0A 2UYJA 5J2TB 5LP6B 1JJ2F 4TZZA 2ZF8A 3J80M 3WJPA 3HKBB 1VQ5F 1CLIA 4B46A 2BO1A 2IAFA 2CW4A 4PWTA 2HS0A 1KD1H 1CK2A 3EORA 3JAWA 4O2AB 2KG4A 3V7QA 4TV9B 3JALA 1Z5VA 3NK6A 1X52A 4G88A 5IJ9B 5HY4A 3KE1A 4LNUB 1K8AH 2KTUA 3ERNA 3I3FA 1X7OA 4I55B 3ELCA 1W2BF 4BVRA 4XCQA 3JARB 4FFBA 4O4HB 1T0KB 2GLZA 2RB9A 3ZO8A 5HP7A 4IIJA 4X1YA 1VQLF 1W581 3RE3A 1KC8H 1NJIH 1W5EA 4TV8B 3MCAB 3MCQA 2Q1YA 3RYIA 3T80A 4BT3A 2HS3A 2K1SA 4ZK7A 4KWEA 2UYNB 3HAXD 3NMUC 2KGWA 4O4LB 3IR9A 3RYFA 1JFFA 2R751 2AIZP 3IMPA 4BT2A 3JAKB 4G4WA 1VK3A 3F6MA 5CA0A 4ZOLB 1IV1A 2FC3A 4BY9D 3JAWB 3VYSC 3IEWA 1VQ9F 1YJNF 5B8FA 2RHHA 4LCKA 3P4EA 1SA0A 3CMEF 3JALB 1RQ2A 4O4IA 2HVYD 4I4TA 2OTLF 1DT9A 5EZYA 3OW2F 1VQ4F 3S02A 3O85A 1Q8RA 3S0WA 5KX5A 2HP0A 5EIBD 5EAZA 5FNVB 3WGJA 4DRXA 3K2XA 3RYHA 3RA5A 2W8BC 3K14A 4FFBB 1YJ9F 5JVDA 1Q7YH 3CMAF 4IIJB 5HXZA 3M84A 4C81A 4NQ3A 3K0TA 5DCVA 3V4DA 2HP3A 3RYCB 2I6RA 2Z1EA 5GAPK 3VI6A 4X1IB 5LA6A 4X20A 4I50A 3SIUA 3UT5B 2G9IA 3CB2A 3RYFB 1JFFB 2H8EA 3TD3A 4WBNA 4ZHYB 3CC2F 3GYQA 3M1XA 3JASA 1PF5A 1U3LA 4BT5A 2P6YA 1X7PA 5CB4B 1VQOF 1JD1A 4F6RA 1Q86H 2AMTA 4O4JA 3G71F 3HKCB 3ON1A 2DYYA 3NK7A 2IQQA 4IHJA 1DBFA 3GHZA 2HP0B 5HY1A 2VGNA 3LWQC 3RYHB 4EI9A 5CA1B 1YQNA 5MN4A 3CCMF 2QEXF 1VQNF 1U43A 1KNKA 5GONA 2DT4A 3N4ZA 5C8YA 3JCMM 2BTUA 2I6DA 3ZOPA 4ZHQA 1FNKA 1QVFF 2UZHA 1YITF 5EIBC 3CD6F 2HRUA 1W41A 3E22A 1FSZA 1OFUA 3TD5A 3BYQA 3ESJA 1W59A 5EYPA 4EB6A 2PHNA 5KMGA 3JAMM 1M90H 4X20B 3G6EF 3HKDB 3PLAC 2HX0A 2Z1UA 3QHDA 3V3TA 5HWEA 5MN5A 5BMVB 4X1KB 1U3PA 1YIJF 1JN1A 2VAMA 1IPAA 3HKEA 2H8CA 4WBNB 2HQSC 3K12A 3I7TA 3N2GB 3LFOA 2ZAUA 1RLGA 3F0EA 1UFYA 1CN7A 1W42A 5JQGB 3LMEA 1U40A 3J7AR 2CWJA 4F6RB 1TVKA 3S06A 1X25A 3ZP7A 4O4JB 4BT6A 4TUYB 2R6R1 4O2BB 5LXTA 4EI8A 4HNAB 4EI7A 2RHJA 3N2KB 3NVIB 1VQ7F 4ERHA 5ITZA 3B6NA 3WPXA 3MBMA 3TD4A 5GONB 1FFXA 2PMPA 1VQMF 3MDOA 5C8YB 4DXDA 2VAWA 2ZVYA 4BT4A 1QVGF 5JCOC 2ZODA 3DDNA 4G4YA 1XV2A 2RHOA 2MQEA 1Q81H 1GX1A 3E22B 4M8IA 3VIUA 5J2UA 3V7EA 3C9SA 1W3EX 5LYJA 1W5AA 5EYPB 1GZ0A 2LCAA 3E20B 3LYBA 4EB6B 1NMUB 1OAPA 1TUBA 3C9RA 2V9YA 5JH7A 1YI2F 2VXYA 1VQ8F 5JCOA 3WJRA 1GO1A 3CYQA 3WJQA 1K9MH 3LWPC 5LP6C 1VQKF 3VMFB 4X1YB 3SIVA 5FJ4C 4E6EA 3QTYA 2HRYA 2KTVA 4ZI7A 5HXUA 4YJ3A 2FGYA 1YHQF 2BTQB 3C8LA 3I56F 3RYIB 3WGNA 5LXTB 4BVTA 5J2TA 3CYPB 5LP6A 5EWRA 1KQSF 5ITZB 3LWVC 2UYKA 4U3JA 1NQ3A 4C8GA 4B62A 3WGKA 3KHNA 3CCQF 2Q1XA 5CA0B 3P0ZA 3JATA 5HY2A 1IV3A 3VCZA 3AGKA 4TV9A 1SA0B 4C82A 2CZWA 3LWRC 4O4IB 4C8IA 3DC2A 1R1MA 4I4TB 4BT7A 1W5BA 5EZYB 4LNUA 3KJKA 1ZWZA 2VAPA 5KX5B 1IV4A 3OONA 5LOVA 1JY8A 3VOBA 3VOAA 4DRXB 1UI9A 4YJ2A 1YJWF 4NWOB 5JVDB 2CHSA 5EO3A 5IT9M 3IKEA 1M1KH 3U0OA 3Q8HA 5AVMA 3CC4F 4R40B 5IYZA 2QA4F 4C8EA 3R0PA 2OTJF 2OHWA 2LBTA 3FD5A 3FBAA 2ZOVA 5LA6B 2UYNA 3C9UA 4BW0B 4NUTA 4I50B 3CCSF 3CCUF 3J81M 3F0FA 1GO0A 4O4LA 4B5CA 1COMA 5EB0A 3JAKA 4U3JB 2LBWA 3FFMA 4ZOLA 3CPQA 3JASB 5HP8A 3IEQA 3JATB 3N4YA 3WGMA 1H48A 3WXMB 3FPIA 5G4VC 3D01A 2OTMA 3PAFA 4G4VA 4RQOA 3CPWF 5MN6A 2AIFA 3VYTC 3GTZA 2EWCA 3HJWC 5G4UC 3CCEF 2CVLA 3VTIC 5A2QM 3I55F 4IHJB 5FNVA 5LOVB 3F0DA 4YJ2B 4BVQA 3NVKE 3D00A 2VGMA 1E7KA 1H7MA 2NMUA 2Z1FA 1KNJA 3VO8A 3G4SF 2WALA 1N8RH 5GIPC 2ZVZA 3WGLA 3IKFA 4ZHQB 2ALEA 2RHLA 1K73H 1XRGA 4X3MA 4C4WC 3CCJF 5IYZB 2GZLA 3RYCA 1J7HA 3RA6A 4ZHWA 4X1IA 3F0GA 4ZHVA
chains in the Genus database with same CATH topology
3NK7A 4BVTA 3CXCF 5HY4A 1K8AH 5EWRA 2KTUA 5GINC 5HY1A 2VGNA 1X7OA 3LWQC 1KQSF 4EI9A 3CCMF 1W2BF 4BVRA 4XCQA 3LWVC 2QEXF 1VQNF 1T0KB 3N4ZA 2GLZA 3JCMM 2LBXA 2I6DA 3CCQF 5GANK 3CCRF 1QVFF 1VQLF 1W40A 1YITF 3CD6F 5HY2A 1KC8H 1NJIH 3AGKA 3MCAB 1W41A 2CZWA 3E1YA 3LWRC 2JNBA 1S72F 2OZBA 3JAMM 1M90H 3G6EF 3PLAC 1ZWZA 3V3TA 5HWEA 3HAXD 3NMUC 3CG6A 1SDSA 1YIJF 3IR9A 1IPAA 1YJWF 5EO3A 3LFOA 5IT9M 2FC3A 4BY9D 1RLGA 1CN7A 1M1KH 1W42A 3CC4F 2F9ZC 1VQ9F 1YJNF 3J7AR 4LCKA 1VQPF 3CMEF 2QA4F 3OBWA 3CCVF 2HVYD 2OTJF 2OTLF 2OHWA 1DT9A 3OW2F 4EI8A 1VQ4F 4EI7A 3O85A 4BW0B 4NUTA 4BVSA 3CC7F 3NVIB 1VQ7F 3CCSF 3CCUF 1XBIA 3J81M 1GO0A 1PXWA 1Q82H 3CCLF 5GIOC 3RA5A 1YJ9F 1VQMF 5FLXM 1Q7YH 2LBWA 3FFMA 3CMAF 3CPQA 1QVGF 5HXZA 2QI2A 3N4YA 4X3LA 3WXMB 1RA4A 4NQ3A 3PAFA 5G4VC 3CPWF 1Q81H 5DCVA 3V7EA 1W3EX 2AIFA 3HJWC 5GAPK 3VI6A 3E20B 1GZ0A 3OBYA 3LWOC 3CCEF 5A2QM 1VQ6F 1NMUB 5HY0A 5G4UC 3I55F 1YI2F 1JJ2F 3SIUA 4TZZA 1VQ8F 3J80M 1GO1A 4BVQA 1VQ5F 3NVKE 3D00A 2VGMA 1K9MH 1E7KA 2BO1A 3LWPC 1H7MA 3G4SF 3CC2F 2WALA 1VQKF 3GYQA 1N8RH 5GIPC 1KD1H 1CK2A 3VMFB 2ALEA 1K73H 3SIVA 4X3MA 4C4WC 5FJ4C 2KG4A 1X7PA 5HXUA 2KTVA 3V7QA 3CCJF 1VQOF 1Q86H 2FGYA 1YHQF 3RA6A 3I56F 3NK6A 3G71F 1X52A 3ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK7 A;  3CXC F;  1K8A H;  5EWR A;  2KTU A;  5GIN C;  2VGN A;  1X7O A;  3LWQ C;  1KQS F;  3CCM F;  1W2B F;  3LWV C;  2QEX F;  1VQN F;  1T0K B;  3N4Z A;  3JCM M;  2LBX A;  2I6D A;  3CCQ F;  5GAN K;  3CCR F;  1QVF F;  1VQL F;  1W40 A;  1YIT F;  3CD6 F;  1KC8 H;  1NJI H;  3AGK A;  3MCA B;  1W41 A;  2CZW A;  3E1Y A;  3LWR C;  2JNB A;  1S72 F;  2OZB A;  3JAM M;  1M90 H;  3G6E F;  3PLA C;  1ZWZ A;  3HAX D;  3NMU C;  3CG6 A;  1SDS A;  1YIJ F;  3IR9 A;  1IPA A;  1YJW F;  5EO3 A;  3LFO A;  5IT9 M;  2FC3 A;  4BY9 D;  1RLG A;  1CN7 A;  1M1K H;  1W42 A;  3CC4 F;  1VQ9 F;  1YJN F;  3J7A R;  4LCK A;  1VQP F;  3CME F;  2QA4 F;  3OBW A;  3CCV F;  2HVY D;  2OTJ F;  2OTL F;  2OHW A;  1DT9 A;  3OW2 F;  1VQ4 F;  3O85 A;  4BW0 B;  4NUT A;  3CC7 F;  3NVI B;  1VQ7 F;  3CCS F;  3CCU F;  1XBI A;  3J81 M;  1GO0 A;  1PXW A;  1Q82 H;  3CCL F;  5GIO C;  3RA5 A;  1YJ9 F;  1VQM F;  5FLX M;  1Q7Y H;  2LBW A;  3FFM A;  3CMA F;  3CPQ A;  1QVG F;  2QI2 A;  3N4Y A;  4X3L A;  3WXM B;  1RA4 A;  5G4V C;  3PAF A;  3CPW F;  1Q81 H;  5DCV A;  3V7E A;  1W3E X;  2AIF A;  3HJW C;  5GAP K;  3VI6 A;  3E20 B;  1GZ0 A;  3OBY A;  3LWO C;  3CCE F;  5A2Q M;  1VQ6 F;  1NMU B;  5G4U C;  3I55 F;  1YI2 F;  1JJ2 F;  3SIU A;  4TZZ A;  1VQ8 F;  3J80 M;  1GO1 A;  1VQ5 F;  3NVK E;  2VGM A;  1K9M H;  1E7K A;  2BO1 A;  3LWP C;  1H7M A;  3G4S F;  3CC2 F;  2WAL A;  1VQK F;  3GYQ A;  1N8R H;  5GIP C;  1KD1 H;  1CK2 A;  3VMF B;  2ALE A;  1K73 H;  3SIV A;  4X3M A;  4C4W C;  5FJ4 C;  2KG4 A;  1X7P A;  1VQO F;  2KTV A;  3V7Q A;  3CCJ F;  1Q86 H;  1YHQ F;  3RA6 A;  3I56 F;  3NK6 A;  3G71 F;  1X52 A;  3ON1 A; 
#chains in the Genus database with same CATH topology
 2Z01 A;  2CSL A;  5KMG B;  3CXC F;  3S0Y A;  5IJ0 A;  4G4Z A;  2UYP A;  3UT5 A;  3HTN A;  3LDT A;  5GIN C;  1ONI A;  3C9T A;  1XHO A;  3HKE B;  1T0A A;  2LBX A;  3MQW A;  2YXZ A;  5GAN K;  3CCR F;  3S03 A;  1W40 A;  3QUW A;  1QD9 A;  1ODE A;  5CB4 A;  1VHA A;  2GVI A;  2HS4 A;  1TVK B;  3ZP4 A;  1W5F A;  2Z1T A;  3E1Y A;  3HWU A;  3HKC A;  3P10 A;  3KIZ A;  2JNB A;  3VYU C;  1S72 F;  2OZB A;  3JVH A;  1QU9 A;  4RHA A;  2QTP A;  3CG6 A;  1QAH A;  1SDS A;  5CA1 A;  2BTO A;  3WPW A;  3HKB A;  3FD6 A;  1W55 A;  1FFX B;  2CHT A;  2H6L A;  2B33 A;  4O2A A;  2F9Z C;  1VQV A;  3D54 A;  1VQP F;  2N48 A;  2IG8 A;  3OBW A;  3CCV F;  5J2U B;  1RLU A;  5LYJ B;  3HKD A;  4B45 A;  1RQ7 A;  5IJ9 A;  1YGY A;  5IJ0 B;  1TUB B;  4BVS A;  5JH7 B;  3CC7 F;  1XBI A;  5BMV A;  1PXW A;  4X1K A;  3M4S A;  1Q82 H;  4I55 A;  1SZQ A;  1Z5W A;  3CCL F;  3JAR A;  5GIO C;  1VH8 A;  4O4H A;  5FLX M;  3N2G A;  2YYE A;  1H47 A;  4G4X A;  1IV2 A;  5JQG A;  2QI2 A;  4X3L A;  1RA4 A;  4ZI7 B;  4TV8 A;  3L7Q A;  4YJ3 B;  3S0H A;  4TUY A;  1W57 A;  4U39 A;  2L26 A;  4O2B A;  3KJJ A;  1FNJ A;  4HNA A;  3OBY A;  5EB1 B;  3LWO C;  1VQ6 F;  3N2K A;  5HY0 A;  2UYJ A;  5J2T B;  5LP6 B;  1JJ2 F;  4TZZ A;  2ZF8 A;  3J80 M;  3WJP A;  3HKB B;  1VQ5 F;  1CLI A;  4B46 A;  2BO1 A;  2IAF A;  2CW4 A;  4PWT A;  2HS0 A;  1KD1 H;  1CK2 A;  3EOR A;  3JAW A;  4O2A B;  2KG4 A;  3V7Q A;  4TV9 B;  3JAL A;  1Z5V A;  3NK6 A;  1X52 A;  4G88 A;  5IJ9 B;  5HY4 A;  3KE1 A;  4LNU B;  1K8A H;  2KTU A;  3ERN A;  3I3F A;  1X7O A;  4I55 B;  3ELC A;  1W2B F;  4BVR A;  4XCQ A;  3JAR B;  4FFB A;  4O4H B;  1T0K B;  2GLZ A;  2RB9 A;  3ZO8 A;  5HP7 A;  4IIJ A;  4X1Y A;  1VQL F;  1W58 1;  3RE3 A;  1KC8 H;  1NJI H;  1W5E A;  4TV8 B;  3MCA B;  3MCQ A;  2Q1Y A;  3RYI A;  3T80 A;  4BT3 A;  2HS3 A;  2K1S A;  4ZK7 A;  4KWE A;  2UYN B;  3HAX D;  3NMU C;  2KGW A;  4O4L B;  3IR9 A;  3RYF A;  1JFF A;  2R75 1;  2AIZ P;  3IMP A;  4BT2 A;  3JAK B;  4G4W A;  1VK3 A;  3F6M A;  5CA0 A;  4ZOL B;  1IV1 A;  2FC3 A;  4BY9 D;  3JAW B;  3VYS C;  3IEW A;  1VQ9 F;  1YJN F;  5B8F A;  2RHH A;  4LCK A;  3P4E A;  1SA0 A;  3CME F;  3JAL B;  1RQ2 A;  4O4I A;  2HVY D;  4I4T A;  2OTL F;  1DT9 A;  5EZY A;  3OW2 F;  1VQ4 F;  3S02 A;  3O85 A;  1Q8R A;  3S0W A;  5KX5 A;  2HP0 A;  5EIB D;  5EAZ A;  5FNV B;  3WGJ A;  4DRX A;  3K2X A;  3RYH A;  3RA5 A;  2W8B C;  3K14 A;  4FFB B;  1YJ9 F;  5JVD A;  1Q7Y H;  3CMA F;  4IIJ B;  5HXZ A;  3M84 A;  4C81 A;  4NQ3 A;  3K0T A;  5DCV A;  3V4D A;  2HP3 A;  3RYC B;  2I6R A;  2Z1E A;  5GAP K;  3VI6 A;  4X1I B;  5LA6 A;  4X20 A;  4I50 A;  3SIU A;  3UT5 B;  2G9I A;  3CB2 A;  3RYF B;  1JFF B;  2H8E A;  3TD3 A;  4WBN A;  4ZHY B;  3CC2 F;  3GYQ A;  3M1X A;  3JAS A;  1PF5 A;  1U3L A;  4BT5 A;  2P6Y A;  1X7P A;  5CB4 B;  1VQO F;  1JD1 A;  4F6R A;  1Q86 H;  2AMT A;  4O4J A;  3G71 F;  3HKC B;  3ON1 A;  2DYY A;  3NK7 A;  2IQQ A;  4IHJ A;  1DBF A;  3GHZ A;  2HP0 B;  5HY1 A;  2VGN A;  3LWQ C;  3RYH B;  4EI9 A;  5CA1 B;  1YQN A;  5MN4 A;  3CCM F;  2QEX F;  1VQN F;  1U43 A;  1KNK A;  5GON A;  2DT4 A;  3N4Z A;  5C8Y A;  3JCM M;  2BTU A;  2I6D A;  3ZOP A;  4ZHQ A;  1FNK A;  1QVF F;  2UZH A;  1YIT F;  5EIB C;  3CD6 F;  2HRU A;  1W41 A;  3E22 A;  1FSZ A;  1OFU A;  3TD5 A;  3BYQ A;  3ESJ A;  1W59 A;  5EYP A;  4EB6 A;  2PHN A;  5KMG A;  3JAM M;  1M90 H;  4X20 B;  3G6E F;  3HKD B;  3PLA C;  2HX0 A;  2Z1U A;  3QHD A;  3V3T A;  5HWE A;  5MN5 A;  5BMV B;  4X1K B;  1U3P A;  1YIJ F;  1JN1 A;  2VAM A;  1IPA A;  3HKE A;  2H8C A;  4WBN B;  2HQS C;  3K12 A;  3I7T A;  3N2G B;  3LFO A;  2ZAU A;  1RLG A;  3F0E A;  1UFY A;  1CN7 A;  1W42 A;  5JQG B;  3LME A;  1U40 A;  3J7A R;  2CWJ A;  4F6R B;  1TVK A;  3S06 A;  1X25 A;  3ZP7 A;  4O4J B;  4BT6 A;  4TUY B;  2R6R 1;  4O2B B;  5LXT A;  4EI8 A;  4HNA B;  4EI7 A;  2RHJ A;  3N2K B;  3NVI B;  1VQ7 F;  4ERH A;  5ITZ A;  3B6N A;  3WPX A;  3MBM A;  3TD4 A;  5GON B;  1FFX A;  2PMP A;  1VQM F;  3MDO A;  5C8Y B;  4DXD A;  2VAW A;  2ZVY A;  4BT4 A;  1QVG F;  5JCO C;  2ZOD A;  3DDN A;  4G4Y A;  1XV2 A;  2RHO A;  2MQE A;  1Q81 H;  1GX1 A;  3E22 B;  4M8I A;  3VIU A;  5J2U A;  3V7E A;  3C9S A;  1W3E X;  5LYJ A;  1W5A A;  5EYP B;  1GZ0 A;  2LCA A;  3E20 B;  3LYB A;  4EB6 B;  1NMU B;  1OAP A;  1TUB A;  3C9R A;  2V9Y A;  5JH7 A;  1YI2 F;  2VXY A;  1VQ8 F;  5JCO A;  3WJR A;  1GO1 A;  3CYQ A;  3WJQ A;  1K9M H;  3LWP C;  5LP6 C;  1VQK F;  3VMF B;  4X1Y B;  3SIV A;  5FJ4 C;  4E6E A;  3QTY A;  2HRY A;  2KTV A;  4ZI7 A;  5HXU A;  4YJ3 A;  2FGY A;  1YHQ F;  2BTQ B;  3C8L A;  3I56 F;  3RYI B;  3WGN A;  5LXT B;  4BVT A;  5J2T A;  3CYP B;  5LP6 A;  5EWR A;  1KQS F;  5ITZ B;  3LWV C;  2UYK A;  4U3J A;  1NQ3 A;  4C8G A;  4B62 A;  3WGK A;  3KHN A;  3CCQ F;  2Q1X A;  5CA0 B;  3P0Z A;  3JAT A;  5HY2 A;  1IV3 A;  3VCZ A;  3AGK A;  4TV9 A;  1SA0 B;  4C82 A;  2CZW A;  3LWR C;  4O4I B;  4C8I A;  3DC2 A;  1R1M A;  4I4T B;  4BT7 A;  1W5B A;  5EZY B;  4LNU A;  3KJK A;  1ZWZ A;  2VAP A;  5KX5 B;  1IV4 A;  3OON A;  5LOV A;  1JY8 A;  3VOB A;  3VOA A;  4DRX B;  1UI9 A;  4YJ2 A;  1YJW F;  4NWO B;  5JVD B;  2CHS A;  5EO3 A;  5IT9 M;  3IKE A;  1M1K H;  3U0O A;  3Q8H A;  5AVM A;  3CC4 F;  4R40 B;  5IYZ A;  2QA4 F;  4C8E A;  3R0P A;  2OTJ F;  2OHW A;  2LBT A;  3FD5 A;  3FBA A;  2ZOV A;  5LA6 B;  2UYN A;  3C9U A;  4BW0 B;  4NUT A;  4I50 B;  3CCS F;  3CCU F;  3J81 M;  3F0F A;  1GO0 A;  4O4L A;  4B5C A;  1COM A;  5EB0 A;  3JAK A;  4U3J B;  2LBW A;  3FFM A;  4ZOL A;  3CPQ A;  3JAS B;  5HP8 A;  3IEQ A;  3JAT B;  3N4Y A;  3WGM A;  1H48 A;  3WXM B;  3FPI A;  5G4V C;  3D01 A;  2OTM A;  3PAF A;  4G4V A;  4RQO A;  3CPW F;  5MN6 A;  2AIF A;  3VYT C;  3GTZ A;  2EWC A;  3HJW C;  5G4U C;  3CCE F;  2CVL A;  3VTI C;  5A2Q M;  3I55 F;  4IHJ B;  5FNV A;  5LOV B;  3F0D A;  4YJ2 B;  4BVQ A;  3NVK E;  3D00 A;  2VGM A;  1E7K A;  1H7M A;  2NMU A;  2Z1F A;  1KNJ A;  3VO8 A;  3G4S F;  2WAL A;  1N8R H;  5GIP C;  2ZVZ A;  3WGL A;  3IKF A;  4ZHQ B;  2ALE A;  2RHL A;  1K73 H;  1XRG A;  4X3M A;  4C4W C;  3CCJ F;  5IYZ B;  2GZL A;  3RYC A;  1J7H A;  3RA6 A;  4ZHW A;  4X1I A;  3F0G A;  4ZHV A; 
#chains in the Genus database with same CATH homology
 3NK7 A;  4BVT A;  3CXC F;  5HY4 A;  1K8A H;  5EWR A;  2KTU A;  5GIN C;  5HY1 A;  2VGN A;  1X7O A;  3LWQ C;  1KQS F;  4EI9 A;  3CCM F;  1W2B F;  4BVR A;  4XCQ A;  3LWV C;  2QEX F;  1VQN F;  1T0K B;  3N4Z A;  2GLZ A;  3JCM M;  2LBX A;  2I6D A;  3CCQ F;  5GAN K;  3CCR F;  1QVF F;  1VQL F;  1W40 A;  1YIT F;  3CD6 F;  5HY2 A;  1KC8 H;  1NJI H;  3AGK A;  3MCA B;  1W41 A;  2CZW A;  3E1Y A;  3LWR C;  2JNB A;  1S72 F;  2OZB A;  3JAM M;  1M90 H;  3G6E F;  3PLA C;  1ZWZ A;  3V3T A;  5HWE A;  3HAX D;  3NMU C;  3CG6 A;  1SDS A;  1YIJ F;  3IR9 A;  1IPA A;  1YJW F;  5EO3 A;  3LFO A;  5IT9 M;  2FC3 A;  4BY9 D;  1RLG A;  1CN7 A;  1M1K H;  1W42 A;  3CC4 F;  2F9Z C;  1VQ9 F;  1YJN F;  3J7A R;  4LCK A;  1VQP F;  3CME F;  2QA4 F;  3OBW A;  3CCV F;  2HVY D;  2OTJ F;  2OTL F;  2OHW A;  1DT9 A;  3OW2 F;  4EI8 A;  1VQ4 F;  4EI7 A;  3O85 A;  4BW0 B;  4NUT A;  4BVS A;  3CC7 F;  3NVI B;  1VQ7 F;  3CCS F;  3CCU F;  1XBI A;  3J81 M;  1GO0 A;  1PXW A;  1Q82 H;  3CCL F;  5GIO C;  3RA5 A;  1YJ9 F;  1VQM F;  5FLX M;  1Q7Y H;  2LBW A;  3FFM A;  3CMA F;  3CPQ A;  1QVG F;  5HXZ A;  2QI2 A;  3N4Y A;  4X3L A;  3WXM B;  1RA4 A;  4NQ3 A;  3PAF A;  5G4V C;  3CPW F;  1Q81 H;  5DCV A;  3V7E A;  1W3E X;  2AIF A;  3HJW C;  5GAP K;  3VI6 A;  3E20 B;  1GZ0 A;  3OBY A;  3LWO C;  3CCE F;  5A2Q M;  1VQ6 F;  1NMU B;  5HY0 A;  5G4U C;  3I55 F;  1YI2 F;  1JJ2 F;  3SIU A;  4TZZ A;  1VQ8 F;  3J80 M;  1GO1 A;  4BVQ A;  1VQ5 F;  3NVK E;  3D00 A;  2VGM A;  1K9M H;  1E7K A;  2BO1 A;  3LWP C;  1H7M A;  3G4S F;  3CC2 F;  2WAL A;  1VQK F;  3GYQ A;  1N8R H;  5GIP C;  1KD1 H;  1CK2 A;  3VMF B;  2ALE A;  1K73 H;  3SIV A;  4X3M A;  4C4W C;  5FJ4 C;  2KG4 A;  1X7P A;  5HXU A;  2KTV A;  3V7Q A;  3CCJ F;  1VQO F;  1Q86 H;  2FGY A;  1YHQ F;  3RA6 A;  3I56 F;  3NK6 A;  3G71 F;  1X52 A;  3ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...