3CMAF

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmaF00
1K73H 1W41A 4X3LA 3WXMB 3FFMA 2CZWA 2KTVA 4LCKA 5GIPC 4BW0B 1W42A 3AGKA 1YIJF 3SIUA 3LWPC 1Q86H 1IPAA 3GYQA 5A2QM 3J80M 3CXCF 1SDSA 3CCRF 2LBWA 1VQ5F 3N4YA 2OZBA 1DT9A 3RA5A 3CCVF 1H7MA 5GAPK 2VGMA 2KTUA 3CC7F 1YJNF 5EWRA 2OTJF 3CG6A 1K8AH 3CD6F 3JCMM 1Q82H 3CCLF 2KG4A 3N4ZA 1T0KB 3MCAB 2OTLF 2WALA 3CCEF 3CCJF 1YHQF 3CCSF 5G4VC 1N8RH 3V7EA 3LWRC 1X52A 1VQMF 1K9MH 1E7KA 1VQKF 1Q81H 3CPQA 3G71F 2BO1A 1NJIH 1YITF 3G6EF 4C4WC 2HVYD 3LWQC 3CCQF 3CCMF 1KC8H 3NVKE 3I55F 1VQ9F 3CPWF 3CC4F 1X7PA 1GO0A 1JJ2F 3OW2F 5G4UC 5FJ4C 5FLXM 4TZZA 1YJWF 1VQPF 1XBIA 1QVFF 1QVGF 2OHWA 1W2BF 1VQ4F 1M1KH 1NMUB 4BY9D 2VGNA 3O85A 3PAFA 1RLGA 3HJWC 3G4SF 3OBWA 1YJ9F 2LBXA 3SIVA 3HAXD 1PXWA 2I6DA 3NVIB 3NMUC 5GINC 2FC3A 3LFOA 4NUTA 1VQOF 3RA6A 1Q7YH 5GIOC 1W40A 3LWOC 1KQSF 3E20B 3PLAC 5GANK 4X3MA 1GZ0A 2AIFA 5DCVA 3CMEF 2JNBA 3VMFB 1VQ8F 3LWVC 3J81M 3VI6A 3NK6A 3OBYA 3IR9A 1VQ7F 3V7QA 1M90H 1W3EX 5EO3A 5IT9M 1VQNF 1GO1A 1ZWZA 3CCUF 3E1YA 1KD1H 3J7AR 1X7OA 2ALEA 1CN7A 1S72F 3CC2F 2QA4F 1CK2A 3I56F 3CMAF 3ON1A 3NK7A 2QEXF 1YI2F 1VQ6F 1RA4A 2QI2A 1VQLF 3JAMM
chains in the Genus database with same CATH superfamily
4O4LB 1VQVA 3ELCA 4X20A 5EB0A 2KTVA 4DRXA 1ONIA 2RHOA 3K0TA 2CHTA 1UI9A 4I50B 1IPAA 5A2QM 3J80M 1CLIA 2LBWA 3N4YA 5ITZB 2HS3A 3IKEA 1RLUA 4ZHQA 1H7MA 4ZI7B 3B6NA 2KTUA 3CC7F 1FNKA 4HNAB 3R0PA 1Z5WA 1RQ2A 3CD6F 4BVTA 2H6LA 5LOVB 2MQEA 1Q82H 3F0DA 3N4ZA 3MCAB 1SZQA 5HY2A 3JAWA 3N2KB 1N8RH 4TV9B 3S03A 1ODEA 2H8CA 3UT5A 1VQMF 1OFUA 2Z1EA 1NJIH 1R1MA 3G6EF 2GVIA 4IHJA 3ERNA 4O4IA 2BTUA 5HXZA 3NVKE 3CPWF 2PHNA 3C9RA 3CC4F 4BT2A 1X7PA 4O4JB 3JARB 1JJ2F 4ZHVA 3E22A 4TUYA 5FJ4C 2K1SA 5FLXM 2HQSC 3U0OA 2DT4A 3MCQA 5GONA 4ZK7A 3RYCB 5EB1B 4BT4A 3KJKA 2OHWA 5FNVA 5IJ0B 2GZLA 5KX5B 4BY9D 5HP8A 3O85A 3HJWC 5BMVB 1IV2A 5HP7A 3I3FA 3HAXD 5MN4A 2I6DA 3NVIB 5IYZA 3WGKA 3S06A 3WGMA 4RHAA 3LFOA 1VQOF 4BVQA 2Z01A 3TD4A 1Q7YH 5GIOC 3LWOC 4ZOLB 3PLAC 5GANK 2RB9A 4RQOA 5JH7A 4X3MA 3P4EA 5J2TB 2DYYA 4TV8B 2JNBA 3FD6A 5IJ9A 3FBAA 5EYPA 1FFXB 3K12A 4G88A 4X1IA 3J81M 3VI6A 3D01A 3S0WA 5CA0B 2VAWA 2R751 5CA1B 4FFBB 4NQ3A 3M1XA 1W581 4YJ3B 2Z1TA 1U3LA 5JCOA 2V9YA 1XV2A 1ZWZA 3CCUF 1KD1H 5HXUA 4X20B 3C9SA 4DRXB 3KE1A 2CHSA 4BT6A 2QEXF 1YI2F 3KHNA 1RA4A 3GHZA 5LP6A 1IV4A 1VQNF 1JFFA 4EB6A 2UYJA 4C8GA 4X3LA 2CZWA 3WJPA 4ZHQB 2I6RA 4LCKA 4ERHA 3ZOPA 3V4DA 3QTYA 2UYPA 1JD1A 2UYNA 3D54A 5JCOC 3JAWB 1IV1A 3HKDA 5C8YA 3FPIA 4B46A 5EWRA 1KNJA 3OONA 4I4TA 4F6RA 2CWJA 3K14A 1K8AH 3WGJA 3C9TA 1VK3A 3ZP7A 3JCMM 3CCLF 2IQQA 2KG4A 2LCAA 3N2GA 5B8FA 5LP6C 2EWCA 4IHJB 4O4IB 2WALA 1YHQF 3V7EA 2CW4A 3F0GA 1E7KA 3E22B 4TUYB 1Q81H 2L26A 3WGNA 2BO1A 1J7HA 4U39A 1VHAA 4C4WC 5GONB 1W59A 3CCMF 3WPXA 3LYBA 3V3TA 2FGYA 1COMA 3OW2F 1W5EA 3JAKA 1UFYA 1YJWF 1TVKA 1XBIA 5IYZB 1VQ4F 1T0AA 3F0FA 3PAFA 1U43A 3RYHA 3VYUC 3D00A 4ZHWA 5JH7B 1YJ9F 4B62A 5GINC 3VOAA 1W5BA 4NUTA 4G4WA 4X1IB 2RHLA 2ZVYA 1KQSF 1U3PA 2HS0A 3JALA 3E20B 4C81A 3C9UA 3VIUA 5KMGA 3S0YA 5LYJB 2AIFA 5DCVA 2YXZA 4X1YA 3ZO8A 3LWVC 4NWOB 5J2UA 2UYKA 1GX1A 2VXYA 4DXDA 4U3JA 3HKEA 1QD9A 1TUBB 4WBNA 5LP6B 5EO3A 1SA0A 3QUWA 1JFFB 4EB6B 3E1YA 2ALEA 1CN7A 3RYFA 3CC2F 2QA4F 4O4HB 3CMAF 3ON1A 1VH8A 4I50A 5EZYA 1FSZA 5MN6A 4XCQA 3S02A 5ITZA 2KGWA 3CB2A 1K73H 1W41A 4ZI7A 3WXMB 3FFMA 4G4YA 4G4XA 1KNKA 2HP3A 3JATA 4C8EA 3HKDB 5GIPC 4BW0B 4I4TB 3AGKA 1YIJF 3SIUA 5LOVA 3LWPC 4IIJA 3K2XA 3CXCF 4PWTA 1VQ5F 3MDOA 3N2GB 4C82A 1H47A 1DT9A 3HKBA 2OZBA 4EI9A 4TV9A 1PF5A 5CB4A 2VGMA 5GAPK 2G9IA 1YJNF 1XRGA 1JY8A 4LNUA 3TD3A 1H48A 1OAPA 1T0KB 3JASA 1YQNA 3F6MA 4EI8A 3RYIA 3EORA 5G4VC 3CCSF 4O2AA 1W5FA 4R40B 3T80A 3CPQA 3G71F 3JAKB 2ZODA 1YITF 2F9ZC 1KC8H 3I55F 5HWEA 1VQ9F 2N48A 3HTNA 2AMTA 3IMPA 2R6R1 5G4UC 5HY4A 3UT5B 3IEQA 4BVSA 2UZHA 4B45A 3WGLA 2P6YA 3I7TA 5JQGA 1QVFF 3WPWA 1QVGF 1W2BF 5LXTA 2IG8A 1M1KH 3HKCA 3JALB 1RLGA 4KWEA 1XHOA 1QAHA 4BT3A 4X1KA 4X1YB 1PXWA 3DC2A 1FFXA 3NMUC 3KJJA 2FC3A 3CYPB 5CA0A 5CA1A 3L7QA 4FFBA 5FNVB 4U3JB 3HKEB 3MQWA 1GZ0A 4WBNB 1X25A 1SA0B 3CMEF 3CYQA 5JVDA 3VCZA 4E6EA 3OBYA 3IR9A 2CVLA 2OTMA 3RYFB 2ZVZA 5EZYB 3VTIC 4B5CA 1M90H 2ZAUA 3TD5A 1GO1A 3ESJA 3IEWA 5IJ9B 5EYPB 1S72F 1CK2A 3JATB 3IKFA 1VQ6F 2HRUA 5EIBC 2QI2A 3QHDA 4IIJB 4YJ2A 5LA6A 3JAMM 5HY0A 4I55A 3HKBB 2NMUA 3F0EA 5CB4B 2ZF8A 3GTZA 2GLZA 1W42A 2HP0A 1W57A 1Q86H 4O2BA 3GYQA 3Q8HA 4EI7A 4LNUB 5EIBD 1SDSA 3CCRF 3WJRA 4G4ZA 3MBMA 4O4LA 1FNJA 2Z1UA 1JN1A 3RA5A 3CCVF 3JASB 2HRYA 1NQ3A 3RYIB 2OTJF 4O2AB 3CG6A 2BTQB 5HY1A 2OTLF 4C8IA 3CCEF 3CCJF 2UYNB 4HNAA 5AVMA 2AIZP 3LDTA 5C8YB 2CSLA 1X52A 3LWRC 1K9MH 4F6RB 3S0HA 4BVRA 1VQKF 2LBTA 2VAPA 1IV3A 2Z1FA 2BTOA 2HVYD 5JQGB 5MN5A 1Q8RA 3LWQC 1W5AA 3N2KA 3M4SA 3CCQF 3C8LA 2Q1XA 3P10A 5LXTB 3RE3A 1GO0A 4ZHYB 1YGYA 3HKCB 1Z5VA 3LMEA 2IAFA 2QTPA 3WJQA 4TZZA 4X1KB 1VQPF 2RHHA 2ZOVA 2RHJA 3VYTC 3JVHA 1RQ7A 4BT7A 1NMUB 3JARA 1QU9A 4O4JA 2PMPA 2VGNA 5LYJA 3BYQA 3VYSC 3G4SF 3OBWA 2LBXA 3HWUA 3SIVA 3RYCA 3FD5A 5JVDB 1TVKB 5IJ0A 5KX5A 1DBFA 3RA6A 1W40A 1TUBA 5BMVA 3M84A 2B33A 2W8BC 3RYHB 3VMFB 1VQ8F 4O4HA 3NK6A 3VO8A 1VQ7F 4ZOLA 2H8EA 3V7QA 3P0ZA 1W3EX 2YYEA 5J2TA 2HX0A 3KIZA 5EAZA 5KMGB 4G4VA 5IT9M 4M8IA 4TV8A 4YJ2B 5LA6B 4I55B 3J7AR 1X7OA 2VAMA 3ZP4A 2HS4A 4BT5A 3I56F 5J2UB 3NK7A 3VOBA 2HP0B 3DDNA 1W55A 1U40A 4YJ3A 1VQLF 4O2BB 2Q1YA
chains in the Genus database with same CATH topology
1K73H 5HY0A 1W41A 4X3LA 3WXMB 3FFMA 2CZWA 2KTVA 4LCKA 5GIPC 2GLZA 1W42A 3AGKA 4BW0B 1YIJF 3SIUA 3LWPC 1Q86H 1IPAA 3GYQA 4EI7A 5A2QM 3J80M 3CXCF 1SDSA 3CCRF 2LBWA 1VQ5F 3N4YA 2OZBA 1DT9A 3RA5A 3CCVF 4EI9A 1H7MA 5GAPK 2VGMA 2KTUA 3CC7F 1YJNF 5EWRA 2OTJF 3CG6A 1K8AH 3CD6F 5HY1A 4BVTA 3JCMM 1Q82H 3CCLF 2KG4A 3N4ZA 1T0KB 3MCAB 2OTLF 5HY2A 2WALA 3CCEF 4EI8A 3CCJF 1YHQF 3CCSF 5G4VC 1N8RH 3V7EA 3LWRC 1X52A 1VQMF 1K9MH 1E7KA 4BVRA 1VQKF 1Q81H 3CPQA 3G71F 2BO1A 1NJIH 1YITF 3G6EF 4C4WC 2F9ZC 2HVYD 3LWQC 3CCQF 3CCMF 1KC8H 5HXZA 3I55F 5HWEA 1VQ9F 3NVKE 3CPWF 3V3TA 3CC4F 1X7PA 1GO0A 2FGYA 1JJ2F 3OW2F 5G4UC 5FJ4C 5HY4A 5FLXM 4TZZA 1YJWF 1VQPF 1XBIA 1QVFF 1QVGF 2OHWA 1W2BF 1VQ4F 1M1KH 1NMUB 4BY9D 2VGNA 3O85A 3PAFA 1RLGA 3HJWC 3D00A 3G4SF 3OBWA 1YJ9F 2LBXA 3SIVA 3HAXD 1PXWA 2I6DA 3NVIB 3NMUC 5GINC 2FC3A 3LFOA 4NUTA 1VQOF 4BVQA 3RA6A 1Q7YH 5GIOC 1W40A 3LWOC 1KQSF 3E20B 3PLAC 5GANK 4X3MA 1GZ0A 2AIFA 5DCVA 3CMEF 2JNBA 3VMFB 1VQ8F 3LWVC 3J81M 3VI6A 3NK6A 3OBYA 3IR9A 1VQ7F 3V7QA 1M90H 4NQ3A 1W3EX 5EO3A 5IT9M 1VQNF 1GO1A 1ZWZA 3CCUF 3E1YA 1KD1H 5HXUA 3J7AR 1X7OA 2ALEA 1CN7A 1S72F 3CC2F 2QA4F 1CK2A 3I56F 3CMAF 3ON1A 3NK7A 2QEXF 1YI2F 1VQ6F 1RA4A 2QI2A 4XCQA 1VQLF 3JAMM 4BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 H;  1W41 A;  4X3L A;  3WXM B;  3FFM A;  2CZW A;  2KTV A;  4LCK A;  5GIP C;  4BW0 B;  1W42 A;  3AGK A;  1YIJ F;  3SIU A;  3LWP C;  1Q86 H;  1IPA A;  3GYQ A;  5A2Q M;  3J80 M;  3CXC F;  1SDS A;  3CCR F;  2LBW A;  1VQ5 F;  3N4Y A;  2OZB A;  1DT9 A;  3RA5 A;  3CCV F;  1H7M A;  5GAP K;  2VGM A;  2KTU A;  3CC7 F;  1YJN F;  5EWR A;  2OTJ F;  3CG6 A;  1K8A H;  3CD6 F;  3JCM M;  1Q82 H;  3CCL F;  2KG4 A;  3N4Z A;  1T0K B;  3MCA B;  2OTL F;  2WAL A;  3CCE F;  3CCJ F;  1YHQ F;  3CCS F;  5G4V C;  1N8R H;  3V7E A;  3LWR C;  1X52 A;  1VQM F;  1K9M H;  1E7K A;  1VQK F;  1Q81 H;  3CPQ A;  3G71 F;  2BO1 A;  1NJI H;  1YIT F;  3G6E F;  4C4W C;  2HVY D;  3LWQ C;  3CCQ F;  3CCM F;  1KC8 H;  3NVK E;  3I55 F;  1VQ9 F;  3CPW F;  3CC4 F;  1X7P A;  1GO0 A;  1JJ2 F;  3OW2 F;  5G4U C;  5FJ4 C;  5FLX M;  4TZZ A;  1YJW F;  1VQP F;  1XBI A;  1QVF F;  1QVG F;  2OHW A;  1W2B F;  1VQ4 F;  1M1K H;  1NMU B;  4BY9 D;  2VGN A;  3O85 A;  3PAF A;  1RLG A;  3HJW C;  3G4S F;  3OBW A;  1YJ9 F;  2LBX A;  3SIV A;  3HAX D;  1PXW A;  2I6D A;  3NVI B;  3NMU C;  5GIN C;  2FC3 A;  3LFO A;  4NUT A;  1VQO F;  3RA6 A;  1Q7Y H;  5GIO C;  1W40 A;  3LWO C;  1KQS F;  3E20 B;  3PLA C;  5GAN K;  4X3M A;  1GZ0 A;  2AIF A;  5DCV A;  3CME F;  2JNB A;  3VMF B;  1VQ8 F;  3LWV C;  3J81 M;  3VI6 A;  3NK6 A;  3OBY A;  3IR9 A;  1VQ7 F;  3V7Q A;  1M90 H;  1W3E X;  5EO3 A;  5IT9 M;  1VQN F;  1GO1 A;  1ZWZ A;  3CCU F;  3E1Y A;  1KD1 H;  3J7A R;  1X7O A;  2ALE A;  1CN7 A;  1S72 F;  3CC2 F;  2QA4 F;  1CK2 A;  3I56 F;  3CMA F;  3ON1 A;  3NK7 A;  2QEX F;  1YI2 F;  1VQ6 F;  1RA4 A;  2QI2 A;  1VQL F;  3JAM M; 
#chains in the Genus database with same CATH topology
 4O4L B;  1VQV A;  3ELC A;  4X20 A;  5EB0 A;  2KTV A;  4DRX A;  1ONI A;  2RHO A;  3K0T A;  2CHT A;  1UI9 A;  4I50 B;  1IPA A;  5A2Q M;  3J80 M;  1CLI A;  2LBW A;  3N4Y A;  5ITZ B;  2HS3 A;  3IKE A;  1RLU A;  4ZHQ A;  1H7M A;  4ZI7 B;  3B6N A;  2KTU A;  3CC7 F;  1FNK A;  4HNA B;  3R0P A;  1Z5W A;  1RQ2 A;  3CD6 F;  4BVT A;  2H6L A;  5LOV B;  2MQE A;  1Q82 H;  3F0D A;  3N4Z A;  3MCA B;  1SZQ A;  5HY2 A;  3JAW A;  3N2K B;  1N8R H;  4TV9 B;  3S03 A;  1ODE A;  2H8C A;  3UT5 A;  1VQM F;  1OFU A;  2Z1E A;  1NJI H;  1R1M A;  3G6E F;  2GVI A;  4IHJ A;  3ERN A;  4O4I A;  2BTU A;  5HXZ A;  3NVK E;  3CPW F;  2PHN A;  3C9R A;  3CC4 F;  4BT2 A;  1X7P A;  4O4J B;  3JAR B;  1JJ2 F;  4ZHV A;  3E22 A;  4TUY A;  5FJ4 C;  2K1S A;  5FLX M;  2HQS C;  3U0O A;  2DT4 A;  3MCQ A;  5GON A;  4ZK7 A;  3RYC B;  5EB1 B;  4BT4 A;  3KJK A;  2OHW A;  5FNV A;  5IJ0 B;  2GZL A;  5KX5 B;  4BY9 D;  5HP8 A;  3O85 A;  3HJW C;  5BMV B;  1IV2 A;  5HP7 A;  3I3F A;  3HAX D;  5MN4 A;  2I6D A;  3NVI B;  5IYZ A;  3WGK A;  3S06 A;  3WGM A;  4RHA A;  3LFO A;  1VQO F;  4BVQ A;  2Z01 A;  3TD4 A;  1Q7Y H;  5GIO C;  3LWO C;  4ZOL B;  3PLA C;  5GAN K;  2RB9 A;  4RQO A;  5JH7 A;  4X3M A;  3P4E A;  5J2T B;  2DYY A;  4TV8 B;  2JNB A;  3FD6 A;  5IJ9 A;  3FBA A;  5EYP A;  1FFX B;  3K12 A;  4G88 A;  4X1I A;  3J81 M;  3VI6 A;  3D01 A;  3S0W A;  5CA0 B;  2VAW A;  2R75 1;  5CA1 B;  4FFB B;  4NQ3 A;  3M1X A;  1W58 1;  4YJ3 B;  2Z1T A;  1U3L A;  5JCO A;  2V9Y A;  1XV2 A;  1ZWZ A;  3CCU F;  1KD1 H;  5HXU A;  4X20 B;  3C9S A;  4DRX B;  3KE1 A;  2CHS A;  4BT6 A;  2QEX F;  1YI2 F;  3KHN A;  1RA4 A;  3GHZ A;  5LP6 A;  1IV4 A;  1VQN F;  1JFF A;  4EB6 A;  2UYJ A;  4C8G A;  4X3L A;  2CZW A;  3WJP A;  4ZHQ B;  2I6R A;  4LCK A;  4ERH A;  3ZOP A;  3V4D A;  3QTY A;  2UYP A;  1JD1 A;  2UYN A;  3D54 A;  5JCO C;  3JAW B;  1IV1 A;  3HKD A;  5C8Y A;  3FPI A;  4B46 A;  5EWR A;  1KNJ A;  3OON A;  4I4T A;  4F6R A;  2CWJ A;  3K14 A;  1K8A H;  3WGJ A;  3C9T A;  1VK3 A;  3ZP7 A;  3JCM M;  3CCL F;  2IQQ A;  2KG4 A;  2LCA A;  3N2G A;  5B8F A;  5LP6 C;  2EWC A;  4IHJ B;  4O4I B;  2WAL A;  1YHQ F;  3V7E A;  2CW4 A;  3F0G A;  1E7K A;  3E22 B;  4TUY B;  1Q81 H;  2L26 A;  3WGN A;  2BO1 A;  1J7H A;  4U39 A;  1VHA A;  4C4W C;  5GON B;  1W59 A;  3CCM F;  3WPX A;  3LYB A;  3V3T A;  2FGY A;  1COM A;  3OW2 F;  1W5E A;  3JAK A;  1UFY A;  1YJW F;  1TVK A;  1XBI A;  5IYZ B;  1VQ4 F;  1T0A A;  3F0F A;  3PAF A;  1U43 A;  3RYH A;  3VYU C;  3D00 A;  4ZHW A;  5JH7 B;  1YJ9 F;  4B62 A;  5GIN C;  3VOA A;  1W5B A;  4NUT A;  4G4W A;  4X1I B;  2RHL A;  2ZVY A;  1KQS F;  1U3P A;  2HS0 A;  3JAL A;  3E20 B;  4C81 A;  3C9U A;  3VIU A;  5KMG A;  3S0Y A;  5LYJ B;  2AIF A;  5DCV A;  2YXZ A;  4X1Y A;  3ZO8 A;  3LWV C;  4NWO B;  5J2U A;  2UYK A;  1GX1 A;  2VXY A;  4DXD A;  4U3J A;  3HKE A;  1QD9 A;  1TUB B;  4WBN A;  5LP6 B;  5EO3 A;  1SA0 A;  3QUW A;  1JFF B;  4EB6 B;  3E1Y A;  2ALE A;  1CN7 A;  3RYF A;  3CC2 F;  2QA4 F;  4O4H B;  3CMA F;  3ON1 A;  1VH8 A;  4I50 A;  5EZY A;  1FSZ A;  5MN6 A;  4XCQ A;  3S02 A;  5ITZ A;  2KGW A;  3CB2 A;  1K73 H;  1W41 A;  4ZI7 A;  3WXM B;  3FFM A;  4G4Y A;  4G4X A;  1KNK A;  2HP3 A;  3JAT A;  4C8E A;  3HKD B;  5GIP C;  4BW0 B;  4I4T B;  3AGK A;  1YIJ F;  3SIU A;  5LOV A;  3LWP C;  4IIJ A;  3K2X A;  3CXC F;  4PWT A;  1VQ5 F;  3MDO A;  3N2G B;  4C82 A;  1H47 A;  1DT9 A;  3HKB A;  2OZB A;  4EI9 A;  4TV9 A;  1PF5 A;  5CB4 A;  2VGM A;  5GAP K;  2G9I A;  1YJN F;  1XRG A;  1JY8 A;  4LNU A;  3TD3 A;  1H48 A;  1OAP A;  1T0K B;  3JAS A;  1YQN A;  3F6M A;  4EI8 A;  3RYI A;  3EOR A;  5G4V C;  3CCS F;  4O2A A;  1W5F A;  4R40 B;  3T80 A;  3CPQ A;  3G71 F;  3JAK B;  2ZOD A;  1YIT F;  2F9Z C;  1KC8 H;  3I55 F;  5HWE A;  1VQ9 F;  2N48 A;  3HTN A;  2AMT A;  3IMP A;  2R6R 1;  5G4U C;  5HY4 A;  3UT5 B;  3IEQ A;  4BVS A;  2UZH A;  4B45 A;  3WGL A;  2P6Y A;  3I7T A;  5JQG A;  1QVF F;  3WPW A;  1QVG F;  1W2B F;  5LXT A;  2IG8 A;  1M1K H;  3HKC A;  3JAL B;  1RLG A;  4KWE A;  1XHO A;  1QAH A;  4BT3 A;  4X1K A;  4X1Y B;  1PXW A;  3DC2 A;  1FFX A;  3NMU C;  3KJJ A;  2FC3 A;  3CYP B;  5CA0 A;  5CA1 A;  3L7Q A;  4FFB A;  5FNV B;  4U3J B;  3HKE B;  3MQW A;  1GZ0 A;  4WBN B;  1X25 A;  1SA0 B;  3CME F;  3CYQ A;  5JVD A;  3VCZ A;  4E6E A;  3OBY A;  3IR9 A;  2CVL A;  2OTM A;  3RYF B;  2ZVZ A;  5EZY B;  3VTI C;  4B5C A;  1M90 H;  2ZAU A;  3TD5 A;  1GO1 A;  3ESJ A;  3IEW A;  5IJ9 B;  5EYP B;  1S72 F;  1CK2 A;  3JAT B;  3IKF A;  1VQ6 F;  2HRU A;  5EIB C;  2QI2 A;  3QHD A;  4IIJ B;  4YJ2 A;  5LA6 A;  3JAM M;  5HY0 A;  4I55 A;  3HKB B;  2NMU A;  3F0E A;  5CB4 B;  2ZF8 A;  3GTZ A;  2GLZ A;  1W42 A;  2HP0 A;  1W57 A;  1Q86 H;  4O2B A;  3GYQ A;  3Q8H A;  4EI7 A;  4LNU B;  5EIB D;  1SDS A;  3CCR F;  3WJR A;  4G4Z A;  3MBM A;  4O4L A;  1FNJ A;  2Z1U A;  1JN1 A;  3RA5 A;  3CCV F;  3JAS B;  2HRY A;  1NQ3 A;  3RYI B;  2OTJ F;  4O2A B;  3CG6 A;  2BTQ B;  5HY1 A;  2OTL F;  4C8I A;  3CCE F;  3CCJ F;  2UYN B;  4HNA A;  5AVM A;  2AIZ P;  3LDT A;  5C8Y B;  2CSL A;  1X52 A;  3LWR C;  1K9M H;  4F6R B;  3S0H A;  4BVR A;  1VQK F;  2LBT A;  2VAP A;  1IV3 A;  2Z1F A;  2BTO A;  2HVY D;  5JQG B;  5MN5 A;  1Q8R A;  3LWQ C;  1W5A A;  3N2K A;  3M4S A;  3CCQ F;  3C8L A;  2Q1X A;  3P10 A;  5LXT B;  3RE3 A;  1GO0 A;  4ZHY B;  1YGY A;  3HKC B;  1Z5V A;  3LME A;  2IAF A;  2QTP A;  3WJQ A;  4TZZ A;  4X1K B;  1VQP F;  2RHH A;  2ZOV A;  2RHJ A;  3VYT C;  3JVH A;  1RQ7 A;  4BT7 A;  1NMU B;  3JAR A;  1QU9 A;  4O4J A;  2PMP A;  2VGN A;  5LYJ A;  3BYQ A;  3VYS C;  3G4S F;  3OBW A;  2LBX A;  3HWU A;  3SIV A;  3RYC A;  3FD5 A;  5JVD B;  1TVK B;  5IJ0 A;  5KX5 A;  1DBF A;  3RA6 A;  1W40 A;  1TUB A;  5BMV A;  3M84 A;  2B33 A;  2W8B C;  3RYH B;  3VMF B;  1VQ8 F;  4O4H A;  3NK6 A;  3VO8 A;  1VQ7 F;  4ZOL A;  2H8E A;  3V7Q A;  3P0Z A;  1W3E X;  2YYE A;  5J2T A;  2HX0 A;  3KIZ A;  5EAZ A;  5KMG B;  4G4V A;  5IT9 M;  4M8I A;  4TV8 A;  4YJ2 B;  5LA6 B;  4I55 B;  3J7A R;  1X7O A;  2VAM A;  3ZP4 A;  2HS4 A;  4BT5 A;  3I56 F;  5J2U B;  3NK7 A;  3VOB A;  2HP0 B;  3DDN A;  1W55 A;  1U40 A;  4YJ3 A;  1VQL F;  4O2B B;  2Q1Y A; 
#chains in the Genus database with same CATH homology
 1K73 H;  5HY0 A;  1W41 A;  4X3L A;  3WXM B;  3FFM A;  2CZW A;  2KTV A;  4LCK A;  5GIP C;  2GLZ A;  1W42 A;  3AGK A;  4BW0 B;  1YIJ F;  3SIU A;  3LWP C;  1Q86 H;  1IPA A;  3GYQ A;  4EI7 A;  5A2Q M;  3J80 M;  3CXC F;  1SDS A;  3CCR F;  2LBW A;  1VQ5 F;  3N4Y A;  2OZB A;  1DT9 A;  3RA5 A;  3CCV F;  4EI9 A;  1H7M A;  5GAP K;  2VGM A;  2KTU A;  3CC7 F;  1YJN F;  5EWR A;  2OTJ F;  3CG6 A;  1K8A H;  3CD6 F;  5HY1 A;  4BVT A;  3JCM M;  1Q82 H;  3CCL F;  2KG4 A;  3N4Z A;  1T0K B;  3MCA B;  2OTL F;  5HY2 A;  2WAL A;  3CCE F;  4EI8 A;  3CCJ F;  1YHQ F;  3CCS F;  5G4V C;  1N8R H;  3V7E A;  3LWR C;  1X52 A;  1VQM F;  1K9M H;  1E7K A;  4BVR A;  1VQK F;  1Q81 H;  3CPQ A;  3G71 F;  2BO1 A;  1NJI H;  1YIT F;  3G6E F;  4C4W C;  2F9Z C;  2HVY D;  3LWQ C;  3CCQ F;  3CCM F;  1KC8 H;  5HXZ A;  3I55 F;  5HWE A;  1VQ9 F;  3NVK E;  3CPW F;  3V3T A;  3CC4 F;  1X7P A;  1GO0 A;  2FGY A;  1JJ2 F;  3OW2 F;  5G4U C;  5FJ4 C;  5HY4 A;  5FLX M;  4TZZ A;  1YJW F;  1VQP F;  1XBI A;  1QVF F;  1QVG F;  2OHW A;  1W2B F;  1VQ4 F;  1M1K H;  1NMU B;  4BY9 D;  2VGN A;  3O85 A;  3PAF A;  1RLG A;  3HJW C;  3D00 A;  3G4S F;  3OBW A;  1YJ9 F;  2LBX A;  3SIV A;  3HAX D;  1PXW A;  2I6D A;  3NVI B;  3NMU C;  5GIN C;  2FC3 A;  3LFO A;  4NUT A;  1VQO F;  4BVQ A;  3RA6 A;  1Q7Y H;  5GIO C;  1W40 A;  3LWO C;  1KQS F;  3E20 B;  3PLA C;  5GAN K;  4X3M A;  1GZ0 A;  2AIF A;  5DCV A;  3CME F;  2JNB A;  3VMF B;  1VQ8 F;  3LWV C;  3J81 M;  3VI6 A;  3NK6 A;  3OBY A;  3IR9 A;  1VQ7 F;  3V7Q A;  1M90 H;  4NQ3 A;  1W3E X;  5EO3 A;  5IT9 M;  1VQN F;  1GO1 A;  1ZWZ A;  3CCU F;  3E1Y A;  1KD1 H;  5HXU A;  3J7A R;  1X7O A;  2ALE A;  1CN7 A;  1S72 F;  3CC2 F;  2QA4 F;  1CK2 A;  3I56 F;  3CMA F;  3ON1 A;  3NK7 A;  2QEX F;  1YI2 F;  1VQ6 F;  1RA4 A;  2QI2 A;  4XCQ A;  1VQL F;  3JAM M;  4BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...