3CMAF

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmaF00
5EWRA 4NUTA 3I56F 3CXCF 3E1YA 1S72F 5EO3A 3LWQC 3SIVA 3N4YA 1K9MH 5IT9M 3VMFB 3CPQA 2VGNA 2ALEA 4TZZA 1CN7A 1ZWZA 1IPAA 3CC7F 2KTVA 1Q81H 4BY9D 1W42A 3HAXD 3J7AR 1QVFF 1VQOF 3LWOC 1YI2F 3OBYA 1Q82H 3NMUC 3CCSF 3V7QA 1SDSA 1H7MA 1N8RH 2OTLF 5GANK 1E7KA 1VQ5F 1VQMF 1VQ6F 2WALA 3CC2F 2QA4F 1X7PA 3CPWF 3OW2F 1DT9A 5G4UC 3G6EF 3VI6A 3CCLF 5G4VC 1VQLF 1RA4A 1YIJF 3LFOA 3GYQA 1PXWA 1W40A 1VQKF 3CCQF 2BO1A 2QEXF 3RA6A 1KQSF 1VQ9F 3NVIB 1XBIA 3AGKA 2HVYD 3RA5A 3CMEF 5GINC 3ON1A 5GIPC 3JAMM 1YJWF 1KC8H 4LCKA 3OBWA 5FJ4C 3G71F 1W41A 3WXMB 3CD6F 3NK6A 1M90H 1GO1A 1VQ7F 2LBXA 3N4ZA 3CC4F 3O85A 1K8AH 3PAFA 3V7EA 1NMUB 2KG4A 1VQ4F 3CG6A 1YHQF 4X3LA 3LWRC 2OZBA 3FFMA 1X7OA 3I55F 1QVGF 5FLXM 3CCVF 1YITF 2OTJF 1GZ0A 3PLAC 1VQPF 3JCMM 2LBWA 3NK7A 1VQNF 3MCAB 5GAPK 1M1KH 3CCRF 3J81M 1YJNF 1CK2A 2AIFA 3E20B 4X3MA 4BW0B 1RLGA 3IR9A 2QI2A 3LWPC 1T0KB 5GIOC 2FC3A 2JNBA 3CCUF 5DCVA 5A2QM 3HJWC 1Q86H 4C4WC 2VGMA 3J80M 3CCEF 3SIUA 1GO0A 1W2BF 2CZWA 3CCJF 1JJ2F 3CMAF 3CCMF 1YJ9F 3G4SF 2KTUA 1NJIH 1K73H 2I6DA 1Q7YH 3NVKE 1X52A 3LWVC 1W3EX 2OHWA 1VQ8F 1KD1H
chains in the Genus database with same CATH superfamily
5J2UB 4C82A 3I56F 3CYQA 5EO3A 4BT4A 1OFUA 3IMPA 4EI9A 5JVDA 2ALEA 1IPAA 2KTVA 2HP3A 3R0PA 3WJRA 5EB0A 1W59A 1QD9A 3C9UA 3VYTC 3HAXD 4O2BA 2VAPA 3VYSC 5HY4A 5B8FA 3DC2A 4B5CA 1VHAA 3JARB 1Q82H 5LXTB 1OAPA 2Q1XA 2RB9A 3D00A 2CSLA 5C8YB 1VQMF 4EI7A 2WALA 3CC2F 3KJKA 3CPWF 2HS0A 4RHAA 1W57A 1U3LA 5JCOA 5LA6A 5G4VC 1RA4A 3D01A 1YIJF 2CHTA 4O2BB 3KHNA 5CA1A 3C9TA 3TD5A 3CCQF 2HS4A 3F6MA 2QEXF 1VQ9F 1UFYA 4O2AB 2UYNB 4O4JA 3D54A 1JN1A 3JAMM 3OBWA 1JY8A 3G71F 5EB1B 2K1SA 2BTOA 5J2TB 3RYHA 1IV4A 4X20A 3WGNA 4EB6A 2QTPA 4X1YA 3VTIC 3V7EA 1NMUB 1YHQF 1NQ3A 4X3LA 3LWRC 1Z5WA 3F0GA 5JQGB 4O4JB 5FLXM 4WBNA 1YITF 2GVIA 1TUBB 2ZAUA 5AVMA 2LBWA 3DDNA 4C8IA 5CA0B 1FNJA 2LCAA 3P10A 1M1KH 4U39A 3KE1A 2UYPA 1YJNF 3FD6A 4X20B 4YJ3B 3N2KB 3ERNA 4M8IA 4X3MA 3HKDA 3P0ZA 2FGYA 3JALA 4FFBA 4BW0B 5LP6B 4TUYB 2QI2A 4X1YB 3LWPC 3U0OA 5GIOC 4LNUA 3T80A 4ZK7A 5LYJA 5ITZA 3CCUF 2NMUA 5DCVA 1Q86H 3HKCB 4EI8A 3J80M 1U40A 2CZWA 4X1KB 4IIJA 3CCJF 3TD3A 1JJ2F 1IV1A 3N2GA 2Q1YA 3JASA 2KTUA 1X52A 3RE3A 1FFXB 3HKDB 1KD1H 3WGJA 5HP7A 5LP6C 4LNUB 1W581 3V4DA 3UT5A 1S72F 3C8LA 4TV8A 3SIVA 1CLIA 5J2UA 2VGNA 2HRYA 4C8GA 4IIJB 3CC7F 5EZYB 3RYFB 1VK3A 1Q81H 3J7AR 1W5FA 4G4ZA 3WJQA 4I50B 2EWCA 1IV3A 1KNKA 3ELCA 2Z1EA 3VYUC 2OTLF 4BT2A 1VQ5F 3JARA 5CB4A 5LXTA 1SA0B 1DBFA 3S06A 1TVKA 3IKEA 1DT9A 3B6NA 4BT6A 4C81A 3FBAA 5C8YA 3VOAA 2ZVZA 5FNVB 1H48A 5IYZB 3CCLF 1VQLF 4BVRA 4DXDA 1XRGA 1XBIA 1JFFB 3QHDA 2CVLA 1W55A 5LOVB 5CB4B 4O2AA 2UYNA 1TVKB 1YGYA 4ZOLA 3K14A 5FJ4C 5EAZA 2L26A 1R1MA 3CD6F 2UZHA 1GO1A 4O4HA 4B46A 3L7QA 3VOBA 3ZP4A 1GX1A 1ODEA 3CC4F 3O85A 5J2TA 3I3FA 4KWEA 2KG4A 4NQ3A 2VXYA 1RQ2A 3FFMA 3I55F 3HWUA 2OTJF 5MN6A 1SZQA 2HQSC 2H6LA 2HP0A 5GONB 4PWTA 3JCMM 1VQPF 5JQGA 4ZOLB 3K0TA 4G4XA 5KX5A 5GAPK 2RHOA 3CCRF 1TUBA 3J81M 3E22A 5CA0A 4O4HB 3KIZA 3LDTA 3E20B 1JD1A 3VO8A 1RLGA 3IR9A 1T0KB 2N48A 4YJ3A 3N2KA 5LP6A 2RHLA 3MDOA 2VAMA 4TUYA 2F9ZC 3SIUA 3IEWA 2G9IA 3C9SA 4E6EA 2HP0B 1PF5A 1KNJA 3JAKA 4F6RA 3LYBA 3HKCA 5KX5B 3LMEA 3JVHA 3OONA 3E22B 4X1KA 3CB2A 4C8EA 3NVKE 2V9YA 3LWVC 1W3EX 2YXZA 4TV9A 3Q8HA 3CXCF 3E1YA 1FFXA 5IT9M 3N4YA 1K9MH 2KGWA 3MCQA 3VMFB 4ZHYB 3ZOPA 2RHHA 3JAKB 1ZWZA 4F6RB 2IQQA 5IJ9A 1W42A 2AIZP 2H8EA 1QVFF 1VQOF 2R751 2UYJA 5EZYA 1YI2F 3RYFA 3OBYA 1RQ7A 4TV9B 2H8CA 3I7TA 4I4TB 3CCSF 1W5EA 4I50A 4BVTA 3V7QA 5HY1A 1N8RH 1VQ6F 1J7HA 3ZP7A 2ZODA 3KJJA 2Z1FA 2I6RA 3VI6A 5IJ9B 5EIBC 2IAFA 3ZO8A 1SA0A 4ZI7A 4ZHQB 4U3JB 1VQKF 2CHSA 4ZHWA 5FNVA 5IYZA 2BTUA 2CWJA 1U3PA 2HVYD 5HXZA 1T0AA 1YQNA 3ON1A 5GIPC 3WGKA 1Q8RA 1UI9A 3HKEB 1KC8H 3EORA 2BTQB 1JFFA 4YJ2B 4O4IA 4BT7A 2RHJA 1W41A 3WJPA 5LOVA 4DRXB 4HNAA 3JAWA 4R40B 3WGLA 2GZLA 4ZI7B 2LBXA 3N4ZA 1VQ7F 5IJ0A 3M1XA 3MQWA 5MN4A 1U43A 3PAFA 4B45A 1VQ4F 5HP8A 2OZBA 3WGMA 2IG8A 4BVSA 3ESJA 3F0EA 3CCVF 3FPIA 4G4VA 2HS3A 1X25A 3JATB 1VQNF 4O4IB 3MCAB 3MBMA 5GONA 5JH7B 4HNAB 2YYEA 3JAWB 1CK2A 3S02A 2AIFA 5IJ0B 3K12A 5BMVB 2ZVYA 3S0YA 1RLUA 4X1IB 1VH8A 2FC3A 2JNBA 3VCZA 5A2QM 3RYIB 1GO0A 1W2BF 3CYPB 3HKBB 2DT4A 1K73H 2I6DA 2W8BC 3IEQA 3QTYA 1COMA 5EWRA 4NUTA 5JVDB 2P6YA 1IV2A 3FD5A 5HY2A 1QAHA 2Z01A 3LWQC 3S03A 2ZOVA 3CPQA 1CN7A 3F0FA 4B62A 3P4EA 4TZZA 4G4WA 4G4YA 4I55A 2PMPA 3VIUA 4BY9D 1QU9A 3GTZA 3LWOC 3S0WA 3TD4A 5EIBD 1ONIA 3K2XA 3NMUC 5LA6B 1SDSA 1H7MA 1E7KA 5GANK 4ZHVA 2QA4F 4BT5A 1X7PA 4IHJA 4I4TA 3OW2F 4BT3A 5MN5A 5G4UC 3G6EF 5CA1B 4I55B 1W5BA 3LFOA 3GYQA 1PXWA 1W40A 4NWOB 2VAWA 3WPXA 2BO1A 3HTNA 3QUWA 2PHNA 3RA6A 1KQSF 3NVIB 2R6R1 3AGKA 4ZHQA 3RA5A 4U3JA 3RYCA 3F0DA 2Z1UA 3CMEF 5GINC 1YJWF 4O4LA 3RYHB 5JCOC 2LBTA 5HWEA 3WPWA 4IHJB 4LCKA 4EB6B 2UYKA 1VQVA 1Z5VA 3WXMB 3HKEA 4YJ2A 3NK6A 5KMGA 1M90H 2MQEA 3V3TA 3S0HA 2Z1TA 1W5AA 2DYYA 2CW4A 1K8AH 4WBNB 1FNKA 3GHZA 3CG6A 4DRXA 5HY0A 1X7OA 3BYQA 1QVGF 3RYCB 1GZ0A 3PLAC 4O4LB 1FSZA 2OTMA 3NK7A 3C9RA 3JALB 4FFBB 1XV2A 4ERHA 5EYPA 5KMGB 3JATA 3M4SA 5LYJB 5ITZB 2ZF8A 5HXUA 5JH7A 2AMTA 5BMVA 3N2GB 4RQOA 3HJWC 4C4WC 2VGMA 3CCEF 3JASB 4X1IA 2HX0A 4BVQA 3IKFA 3CMAF 1XHOA 2HRUA 3RYIA 2B33A 3CCMF 1YJ9F 3G4SF 1H47A 4G88A 4XCQA 3M84A 1NJIH 2GLZA 5EYPB 1Q7YH 3UT5B 2OHWA 3HKBA 1VQ8F 4TV8B
chains in the Genus database with same CATH topology
5EWRA 4NUTA 3I56F 3CXCF 3E1YA 5HY2A 5EO3A 1S72F 3LWQC 4EI9A 3SIVA 3N4YA 1K9MH 5IT9M 3VMFB 3CPQA 2VGNA 2ALEA 4TZZA 1CN7A 1ZWZA 1IPAA 3CC7F 2KTVA 1Q81H 4BY9D 1W42A 3HAXD 3J7AR 1QVFF 1VQOF 3LWOC 1YI2F 5HY4A 3OBYA 1Q82H 3NMUC 3CCSF 3D00A 4BVTA 3V7QA 1SDSA 1H7MA 5HY1A 1N8RH 5GANK 2OTLF 1VQ5F 1VQMF 4EI7A 1E7KA 2WALA 3CC2F 2QA4F 1X7PA 3CPWF 3OW2F 1DT9A 5G4UC 3G6EF 3VI6A 3CCLF 5G4VC 1VQLF 1RA4A 1YIJF 4BVRA 3LFOA 3GYQA 1PXWA 1W40A 1VQKF 3CCQF 2BO1A 2QEXF 3RA6A 1KQSF 1VQ9F 1VQ6F 3NVIB 1XBIA 3AGKA 2HVYD 3RA5A 5HXZA 3CMEF 5GINC 3ON1A 5GIPC 3JAMM 1YJWF 1KC8H 5HWEA 4LCKA 3OBWA 5FJ4C 3G71F 1W41A 3WXMB 3CD6F 3NK6A 1M90H 1GO1A 1VQ7F 3V3TA 2LBXA 3N4ZA 3CC4F 3O85A 1K8AH 3PAFA 3V7EA 1NMUB 2KG4A 1VQ4F 3CG6A 4NQ3A 1YHQF 4X3LA 3LWRC 2OZBA 3FFMA 1X7OA 5HY0A 3I55F 1QVGF 4BVSA 5FLXM 3CCVF 1YITF 2OTJF 1GZ0A 3PLAC 1VQPF 3JCMM 2LBWA 3NK7A 1VQNF 3MCAB 5GAPK 1M1KH 3CCRF 3J81M 1YJNF 1CK2A 2AIFA 3E20B 4X3MA 4BW0B 2FGYA 1RLGA 3IR9A 2QI2A 5HXUA 3LWPC 1T0KB 5GIOC 2FC3A 2JNBA 3CCUF 5DCVA 5A2QM 3HJWC 1Q86H 4C4WC 2F9ZC 2VGMA 4EI8A 3J80M 3CCEF 3SIUA 1GO0A 1W2BF 2CZWA 4BVQA 3CCJF 1JJ2F 3CMAF 3CCMF 1YJ9F 3G4SF 2KTUA 4XCQA 1NJIH 2GLZA 1K73H 2I6DA 1Q7YH 3NVKE 1X52A 3LWVC 1W3EX 2OHWA 1VQ8F 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWR A;  4NUT A;  3I56 F;  3CXC F;  3E1Y A;  1S72 F;  5EO3 A;  3LWQ C;  3SIV A;  3N4Y A;  1K9M H;  5IT9 M;  3VMF B;  3CPQ A;  2VGN A;  2ALE A;  4TZZ A;  1CN7 A;  1ZWZ A;  1IPA A;  3CC7 F;  2KTV A;  1Q81 H;  4BY9 D;  1W42 A;  3HAX D;  3J7A R;  1QVF F;  1VQO F;  3LWO C;  1YI2 F;  3OBY A;  1Q82 H;  3NMU C;  3CCS F;  3V7Q A;  1SDS A;  1H7M A;  1N8R H;  2OTL F;  5GAN K;  1E7K A;  1VQ5 F;  1VQM F;  1VQ6 F;  2WAL A;  3CC2 F;  2QA4 F;  1X7P A;  3CPW F;  3OW2 F;  1DT9 A;  5G4U C;  3G6E F;  3VI6 A;  3CCL F;  5G4V C;  1VQL F;  1RA4 A;  1YIJ F;  3LFO A;  3GYQ A;  1PXW A;  1W40 A;  1VQK F;  3CCQ F;  2BO1 A;  2QEX F;  3RA6 A;  1KQS F;  1VQ9 F;  3NVI B;  1XBI A;  3AGK A;  2HVY D;  3RA5 A;  3CME F;  5GIN C;  3ON1 A;  5GIP C;  3JAM M;  1YJW F;  1KC8 H;  4LCK A;  3OBW A;  5FJ4 C;  3G71 F;  1W41 A;  3WXM B;  3CD6 F;  3NK6 A;  1M90 H;  1GO1 A;  1VQ7 F;  2LBX A;  3N4Z A;  3CC4 F;  3O85 A;  1K8A H;  3PAF A;  3V7E A;  1NMU B;  2KG4 A;  1VQ4 F;  3CG6 A;  1YHQ F;  4X3L A;  3LWR C;  2OZB A;  3FFM A;  1X7O A;  3I55 F;  1QVG F;  5FLX M;  3CCV F;  1YIT F;  2OTJ F;  1GZ0 A;  3PLA C;  1VQP F;  3JCM M;  2LBW A;  3NK7 A;  1VQN F;  3MCA B;  5GAP K;  1M1K H;  3CCR F;  3J81 M;  1YJN F;  1CK2 A;  2AIF A;  3E20 B;  4X3M A;  4BW0 B;  1RLG A;  3IR9 A;  2QI2 A;  3LWP C;  1T0K B;  5GIO C;  2FC3 A;  2JNB A;  3CCU F;  5DCV A;  5A2Q M;  3HJW C;  1Q86 H;  4C4W C;  2VGM A;  3J80 M;  3CCE F;  3SIU A;  1GO0 A;  1W2B F;  2CZW A;  3CCJ F;  1JJ2 F;  3CMA F;  3CCM F;  1YJ9 F;  3G4S F;  2KTU A;  1NJI H;  1K73 H;  2I6D A;  1Q7Y H;  3NVK E;  1X52 A;  3LWV C;  1W3E X;  2OHW A;  1VQ8 F;  1KD1 H; 
#chains in the Genus database with same CATH topology
 5J2U B;  4C82 A;  3I56 F;  3CYQ A;  5EO3 A;  4BT4 A;  1OFU A;  3IMP A;  4EI9 A;  5JVD A;  2ALE A;  1IPA A;  2KTV A;  2HP3 A;  3R0P A;  3WJR A;  5EB0 A;  1W59 A;  1QD9 A;  3C9U A;  3VYT C;  3HAX D;  4O2B A;  2VAP A;  3VYS C;  5HY4 A;  5B8F A;  3DC2 A;  4B5C A;  1VHA A;  3JAR B;  1Q82 H;  5LXT B;  1OAP A;  2Q1X A;  2RB9 A;  3D00 A;  2CSL A;  5C8Y B;  1VQM F;  4EI7 A;  2WAL A;  3CC2 F;  3KJK A;  3CPW F;  2HS0 A;  4RHA A;  1W57 A;  1U3L A;  5JCO A;  5LA6 A;  5G4V C;  1RA4 A;  3D01 A;  1YIJ F;  2CHT A;  4O2B B;  3KHN A;  5CA1 A;  3C9T A;  3TD5 A;  3CCQ F;  2HS4 A;  3F6M A;  2QEX F;  1VQ9 F;  1UFY A;  4O2A B;  2UYN B;  4O4J A;  3D54 A;  1JN1 A;  3JAM M;  3OBW A;  1JY8 A;  3G71 F;  5EB1 B;  2K1S A;  2BTO A;  5J2T B;  3RYH A;  1IV4 A;  4X20 A;  3WGN A;  4EB6 A;  2QTP A;  4X1Y A;  3VTI C;  3V7E A;  1NMU B;  1YHQ F;  1NQ3 A;  4X3L A;  3LWR C;  1Z5W A;  3F0G A;  5JQG B;  4O4J B;  5FLX M;  4WBN A;  1YIT F;  2GVI A;  1TUB B;  2ZAU A;  5AVM A;  2LBW A;  3DDN A;  4C8I A;  5CA0 B;  1FNJ A;  2LCA A;  3P10 A;  1M1K H;  4U39 A;  3KE1 A;  2UYP A;  1YJN F;  3FD6 A;  4X20 B;  4YJ3 B;  3N2K B;  3ERN A;  4M8I A;  4X3M A;  3HKD A;  3P0Z A;  2FGY A;  3JAL A;  4FFB A;  4BW0 B;  5LP6 B;  4TUY B;  2QI2 A;  4X1Y B;  3LWP C;  3U0O A;  5GIO C;  4LNU A;  3T80 A;  4ZK7 A;  5LYJ A;  5ITZ A;  3CCU F;  2NMU A;  5DCV A;  1Q86 H;  3HKC B;  4EI8 A;  3J80 M;  1U40 A;  2CZW A;  4X1K B;  4IIJ A;  3CCJ F;  3TD3 A;  1JJ2 F;  1IV1 A;  3N2G A;  2Q1Y A;  3JAS A;  2KTU A;  1X52 A;  3RE3 A;  1FFX B;  3HKD B;  1KD1 H;  3WGJ A;  5HP7 A;  5LP6 C;  4LNU B;  1W58 1;  3V4D A;  3UT5 A;  1S72 F;  3C8L A;  4TV8 A;  3SIV A;  1CLI A;  5J2U A;  2VGN A;  2HRY A;  4C8G A;  4IIJ B;  3CC7 F;  5EZY B;  3RYF B;  1VK3 A;  1Q81 H;  3J7A R;  1W5F A;  4G4Z A;  3WJQ A;  4I50 B;  2EWC A;  1IV3 A;  1KNK A;  3ELC A;  2Z1E A;  3VYU C;  2OTL F;  4BT2 A;  1VQ5 F;  3JAR A;  5CB4 A;  5LXT A;  1SA0 B;  1DBF A;  3S06 A;  1TVK A;  3IKE A;  1DT9 A;  3B6N A;  4BT6 A;  4C81 A;  3FBA A;  5C8Y A;  3VOA A;  2ZVZ A;  5FNV B;  1H48 A;  5IYZ B;  3CCL F;  1VQL F;  4BVR A;  4DXD A;  1XRG A;  1XBI A;  1JFF B;  3QHD A;  2CVL A;  1W55 A;  5LOV B;  5CB4 B;  4O2A A;  2UYN A;  1TVK B;  1YGY A;  4ZOL A;  3K14 A;  5FJ4 C;  5EAZ A;  2L26 A;  1R1M A;  3CD6 F;  2UZH A;  1GO1 A;  4O4H A;  4B46 A;  3L7Q A;  3VOB A;  3ZP4 A;  1GX1 A;  1ODE A;  3CC4 F;  3O85 A;  5J2T A;  3I3F A;  4KWE A;  2KG4 A;  4NQ3 A;  2VXY A;  1RQ2 A;  3FFM A;  3I55 F;  3HWU A;  2OTJ F;  5MN6 A;  1SZQ A;  2HQS C;  2H6L A;  2HP0 A;  5GON B;  4PWT A;  3JCM M;  1VQP F;  5JQG A;  4ZOL B;  3K0T A;  4G4X A;  5KX5 A;  5GAP K;  2RHO A;  3CCR F;  1TUB A;  3J81 M;  3E22 A;  5CA0 A;  4O4H B;  3KIZ A;  3LDT A;  3E20 B;  1JD1 A;  3VO8 A;  1RLG A;  3IR9 A;  1T0K B;  2N48 A;  4YJ3 A;  3N2K A;  5LP6 A;  2RHL A;  3MDO A;  2VAM A;  4TUY A;  2F9Z C;  3SIU A;  3IEW A;  2G9I A;  3C9S A;  4E6E A;  2HP0 B;  1PF5 A;  1KNJ A;  3JAK A;  4F6R A;  3LYB A;  3HKC A;  5KX5 B;  3LME A;  3JVH A;  3OON A;  3E22 B;  4X1K A;  3CB2 A;  4C8E A;  3NVK E;  2V9Y A;  3LWV C;  1W3E X;  2YXZ A;  4TV9 A;  3Q8H A;  3CXC F;  3E1Y A;  1FFX A;  5IT9 M;  3N4Y A;  1K9M H;  2KGW A;  3MCQ A;  3VMF B;  4ZHY B;  3ZOP A;  2RHH A;  3JAK B;  1ZWZ A;  4F6R B;  2IQQ A;  5IJ9 A;  1W42 A;  2AIZ P;  2H8E A;  1QVF F;  1VQO F;  2R75 1;  2UYJ A;  5EZY A;  1YI2 F;  3RYF A;  3OBY A;  1RQ7 A;  4TV9 B;  2H8C A;  3I7T A;  4I4T B;  3CCS F;  1W5E A;  4I50 A;  4BVT A;  3V7Q A;  5HY1 A;  1N8R H;  1VQ6 F;  1J7H A;  3ZP7 A;  2ZOD A;  3KJJ A;  2Z1F A;  2I6R A;  3VI6 A;  5IJ9 B;  5EIB C;  2IAF A;  3ZO8 A;  1SA0 A;  4ZI7 A;  4ZHQ B;  4U3J B;  1VQK F;  2CHS A;  4ZHW A;  5FNV A;  5IYZ A;  2BTU A;  2CWJ A;  1U3P A;  2HVY D;  5HXZ A;  1T0A A;  1YQN A;  3ON1 A;  5GIP C;  3WGK A;  1Q8R A;  1UI9 A;  3HKE B;  1KC8 H;  3EOR A;  2BTQ B;  1JFF A;  4YJ2 B;  4O4I A;  4BT7 A;  2RHJ A;  1W41 A;  3WJP A;  5LOV A;  4DRX B;  4HNA A;  3JAW A;  4R40 B;  3WGL A;  2GZL A;  4ZI7 B;  2LBX A;  3N4Z A;  1VQ7 F;  5IJ0 A;  3M1X A;  3MQW A;  5MN4 A;  1U43 A;  3PAF A;  4B45 A;  1VQ4 F;  5HP8 A;  2OZB A;  3WGM A;  2IG8 A;  4BVS A;  3ESJ A;  3F0E A;  3CCV F;  3FPI A;  4G4V A;  2HS3 A;  1X25 A;  3JAT B;  1VQN F;  4O4I B;  3MCA B;  3MBM A;  5GON A;  5JH7 B;  4HNA B;  2YYE A;  3JAW B;  1CK2 A;  3S02 A;  2AIF A;  5IJ0 B;  3K12 A;  5BMV B;  2ZVY A;  3S0Y A;  1RLU A;  4X1I B;  1VH8 A;  2FC3 A;  2JNB A;  3VCZ A;  5A2Q M;  3RYI B;  1GO0 A;  1W2B F;  3CYP B;  3HKB B;  2DT4 A;  1K73 H;  2I6D A;  2W8B C;  3IEQ A;  3QTY A;  1COM A;  5EWR A;  4NUT A;  5JVD B;  2P6Y A;  1IV2 A;  3FD5 A;  5HY2 A;  1QAH A;  2Z01 A;  3LWQ C;  3S03 A;  2ZOV A;  3CPQ A;  1CN7 A;  3F0F A;  4B62 A;  3P4E A;  4TZZ A;  4G4W A;  4G4Y A;  4I55 A;  2PMP A;  3VIU A;  4BY9 D;  1QU9 A;  3GTZ A;  3LWO C;  3S0W A;  3TD4 A;  5EIB D;  1ONI A;  3K2X A;  3NMU C;  5LA6 B;  1SDS A;  1H7M A;  1E7K A;  5GAN K;  4ZHV A;  2QA4 F;  4BT5 A;  1X7P A;  4IHJ A;  4I4T A;  3OW2 F;  4BT3 A;  5MN5 A;  5G4U C;  3G6E F;  5CA1 B;  4I55 B;  1W5B A;  3LFO A;  3GYQ A;  1PXW A;  1W40 A;  4NWO B;  2VAW A;  3WPX A;  2BO1 A;  3HTN A;  3QUW A;  2PHN A;  3RA6 A;  1KQS F;  3NVI B;  2R6R 1;  3AGK A;  4ZHQ A;  3RA5 A;  4U3J A;  3RYC A;  3F0D A;  2Z1U A;  3CME F;  5GIN C;  1YJW F;  4O4L A;  3RYH B;  5JCO C;  2LBT A;  5HWE A;  3WPW A;  4IHJ B;  4LCK A;  4EB6 B;  2UYK A;  1VQV A;  1Z5V A;  3WXM B;  3HKE A;  4YJ2 A;  3NK6 A;  5KMG A;  1M90 H;  2MQE A;  3V3T A;  3S0H A;  2Z1T A;  1W5A A;  2DYY A;  2CW4 A;  1K8A H;  4WBN B;  1FNK A;  3GHZ A;  3CG6 A;  4DRX A;  5HY0 A;  1X7O A;  3BYQ A;  1QVG F;  3RYC B;  1GZ0 A;  3PLA C;  4O4L B;  1FSZ A;  2OTM A;  3NK7 A;  3C9R A;  3JAL B;  4FFB B;  1XV2 A;  4ERH A;  5EYP A;  5KMG B;  3JAT A;  3M4S A;  5LYJ B;  5ITZ B;  2ZF8 A;  5HXU A;  5JH7 A;  2AMT A;  5BMV A;  3N2G B;  4RQO A;  3HJW C;  4C4W C;  2VGM A;  3CCE F;  3JAS B;  4X1I A;  2HX0 A;  4BVQ A;  3IKF A;  3CMA F;  1XHO A;  2HRU A;  3RYI A;  2B33 A;  3CCM F;  1YJ9 F;  3G4S F;  1H47 A;  4G88 A;  4XCQ A;  3M84 A;  1NJI H;  2GLZ A;  5EYP B;  1Q7Y H;  3UT5 B;  2OHW A;  3HKB A;  1VQ8 F;  4TV8 B; 
#chains in the Genus database with same CATH homology
 5EWR A;  4NUT A;  3I56 F;  3CXC F;  3E1Y A;  5HY2 A;  5EO3 A;  1S72 F;  3LWQ C;  4EI9 A;  3SIV A;  3N4Y A;  1K9M H;  5IT9 M;  3VMF B;  3CPQ A;  2VGN A;  2ALE A;  4TZZ A;  1CN7 A;  1ZWZ A;  1IPA A;  3CC7 F;  2KTV A;  1Q81 H;  4BY9 D;  1W42 A;  3HAX D;  3J7A R;  1QVF F;  1VQO F;  3LWO C;  1YI2 F;  5HY4 A;  3OBY A;  1Q82 H;  3NMU C;  3CCS F;  3D00 A;  4BVT A;  3V7Q A;  1SDS A;  1H7M A;  5HY1 A;  1N8R H;  5GAN K;  2OTL F;  1VQ5 F;  1VQM F;  4EI7 A;  1E7K A;  2WAL A;  3CC2 F;  2QA4 F;  1X7P A;  3CPW F;  3OW2 F;  1DT9 A;  5G4U C;  3G6E F;  3VI6 A;  3CCL F;  5G4V C;  1VQL F;  1RA4 A;  1YIJ F;  4BVR A;  3LFO A;  3GYQ A;  1PXW A;  1W40 A;  1VQK F;  3CCQ F;  2BO1 A;  2QEX F;  3RA6 A;  1KQS F;  1VQ9 F;  1VQ6 F;  3NVI B;  1XBI A;  3AGK A;  2HVY D;  3RA5 A;  5HXZ A;  3CME F;  5GIN C;  3ON1 A;  5GIP C;  3JAM M;  1YJW F;  1KC8 H;  5HWE A;  4LCK A;  3OBW A;  5FJ4 C;  3G71 F;  1W41 A;  3WXM B;  3CD6 F;  3NK6 A;  1M90 H;  1GO1 A;  1VQ7 F;  3V3T A;  2LBX A;  3N4Z A;  3CC4 F;  3O85 A;  1K8A H;  3PAF A;  3V7E A;  1NMU B;  2KG4 A;  1VQ4 F;  3CG6 A;  4NQ3 A;  1YHQ F;  4X3L A;  3LWR C;  2OZB A;  3FFM A;  1X7O A;  5HY0 A;  3I55 F;  1QVG F;  4BVS A;  5FLX M;  3CCV F;  1YIT F;  2OTJ F;  1GZ0 A;  3PLA C;  1VQP F;  3JCM M;  2LBW A;  3NK7 A;  1VQN F;  3MCA B;  5GAP K;  1M1K H;  3CCR F;  3J81 M;  1YJN F;  1CK2 A;  2AIF A;  3E20 B;  4X3M A;  4BW0 B;  2FGY A;  1RLG A;  3IR9 A;  2QI2 A;  5HXU A;  3LWP C;  1T0K B;  5GIO C;  2FC3 A;  2JNB A;  3CCU F;  5DCV A;  5A2Q M;  3HJW C;  1Q86 H;  4C4W C;  2F9Z C;  2VGM A;  4EI8 A;  3J80 M;  3CCE F;  3SIU A;  1GO0 A;  1W2B F;  2CZW A;  4BVQ A;  3CCJ F;  1JJ2 F;  3CMA F;  3CCM F;  1YJ9 F;  3G4S F;  2KTU A;  4XCQ A;  1NJI H;  2GLZ A;  1K73 H;  2I6D A;  1Q7Y H;  3NVK E;  1X52 A;  3LWV C;  1W3E X;  2OHW A;  1VQ8 F;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...