1K8AH

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k8aH00
2HVYD 5GIOC 3WXMB 2ALEA 1GZ0A 3MCAB 1VQ4F 3J7AR 1KQSF 3SIUA 1W2BF 3JCMM 1VQKF 5GAPK 1YHQF 5G4VC 1QVGF 3CCLF 3V7QA 4TZZA 1CK2A 3VI6A 1Q7YH 2VGNA 3CG6A 3LWPC 1VQ5F 5DCVA 5EWRA 1CN7A 1IPAA 3RA6A 2OTLF 1W40A 1M1KH 1VQ7F 3PLAC 1K73H 1YJ9F 1VQLF 3I56F 3HAXD 5FLXM 1VQ9F 1KD1H 3E1YA 1SDSA 1W41A 4BY9D 1VQOF 2FC3A 3CMAF 1N8RH 1RA4A 3CCJF 1M90H 1Q86H 2BO1A 4X3MA 3G4SF 3J80M 5GINC 2LBWA 1K9MH 1X7OA 2KTUA 1YI2F 3OBYA 3ON1A 3I55F 1Q81H 3CC2F 1VQMF 3GYQA 2JNBA 2VGMA 3NVIB 3CC7F 3NVKE 2LBXA 3NMUC 1NMUB 1KC8H 3V7EA 4NUTA 3CCEF 4LCKA 1RLGA 1E7KA 5EO3A 1ZWZA 1PXWA 2KG4A 3N4YA 3LWVC 3LWRC 2CZWA 3G6EF 1JJ2F 3NK7A 3J81M 4X3LA 1X52A 2AIFA 3NK6A 5A2QM 3RA5A 2KTVA 1T0KB 3CPQA 3OW2F 1DT9A 3G71F 1S72F 3FFMA 1YIJF 3CD6F 3E20B 5GANK 2OZBA 3CCVF 3CCSF 1H7MA 2QEXF 3CXCF 3LWQC 1XBIA 1NJIH 3CCUF 1YJNF 1VQNF 3CC4F 4C4WC 2QI2A 5IT9M 3AGKA 5G4UC 1QVFF 3HJWC 3CCRF 3CCQF 1VQPF 1YJWF 3SIVA 2OHWA 5GIPC 1GO0A 3IR9A 3LWOC 1X7PA 3CPWF 3LFOA 1W3EX 3N4ZA 1Q82H 2OTJF 5FJ4C 1GO1A 4BW0B 2QA4F 3PAFA 1YITF 3CMEF 3O85A 1K8AH 3CCMF 2WALA 1VQ8F 3VMFB 3JAMM 3OBWA 2I6DA 1W42A 1VQ6F
chains in the Genus database with same CATH superfamily
5GIOC 3HKDA 1OAPA 5ITZA 1FSZA 3V4DA 5CB4A 2H8EA 4I4TA 4PWTA 3JCMM 2RHOA 2RB9A 3WGJA 3ERNA 3RYCA 3R0PA 4ZHWA 5J2UB 1VHAA 3C9SA 1FFXB 3CG6A 5HP7A 3LWPC 5EB1B 3MQWA 1IPAA 4FFBB 2OTLF 1XRGA 1RQ7A 3S06A 3I56F 5LOVA 2B33A 5FLXM 3LYBA 4TUYA 1VQVA 3RYHA 4O4JB 3E1YA 2VAMA 3VO8A 3WPWA 3WJPA 2DT4A 4G4XA 3BYQA 3VTIC 1M90H 2BO1A 3JAKB 5JH7B 3RYFB 1YGYA 2YXZA 2AIZP 5J2UA 1FFXA 3GYQA 2JNBA 2VGMA 3CYQA 2BTOA 3U0OA 4FFBA 4X1IB 5MN5A 1VQ6F 3ELCA 4NUTA 4ZHQB 4BT4A 3JASB 4BT5A 3NK7A 4O4JA 2CHTA 3MDOA 4X3LA 1UI9A 5KMGB 5LYJB 3NK6A 4NQ3A 3D54A 2KTVA 3WGLA 3CPQA 5B8FA 3G71F 2LCAA 5AVMA 1YIJF 2HRUA 3D00A 2BTQB 3VYSC 1W581 3JAWA 3ZOPA 5CA0B 4LNUA 4X1IA 3D01A 1YJNF 4R40B 2VXYA 3JASA 3FD5A 2Q1XA 1U43A 1JN1A 5LYJA 1W5BA 3SIVA 1VK3A 2OHWA 1GO0A 4HNAA 3VOAA 3IR9A 2Q1YA 3F0GA 3ZP7A 4C8IA 1YITF 3PAFA 5EZYA 1K8AH 1RQ2A 2WALA 5EYPA 4I55B 5CA0A 5GONB 2Z1FA 4BT3A 3HKCA 5EIBD 3WXMB 4WBNB 2R751 3J7AR 2EWCA 2HP0A 3F0DA 1KQSF 4X20A 2K1SA 5HY1A 1W2BF 2IG8A 1VQKF 5GAPK 3IKEA 1X25A 2KGWA 3CCLF 4O2AB 1TVKB 2GVIA 4O2BA 3KIZA 3K2XA 4ZI7B 2RHHA 3HKEB 3VIUA 2UYNB 4YJ2B 5EWRA 3ZO8A 1H48A 4I55A 4E6EA 1YJ9F 5GONA 3UT5B 1NQ3A 4WBNA 5LP6B 1SA0B 4G88A 4BY9D 3VOBA 5HY4A 1VQOF 3P0ZA 1QD9A 5C8YA 2PHNA 3J80M 1ONIA 1X7OA 4RQOA 4X1KA 2GLZA 4U3JB 5KX5B 3CC2F 4YJ3A 4ZI7A 1OFUA 4XCQA 2G9IA 5EB0A 3HKEA 3L7QA 2I6RA 2LBXA 3S0HA 4BVRA 3S0WA 3TD5A 3V7EA 3ZP4A 2KG4A 4BT2A 3N4YA 3UT5A 3J81M 4F6RB 1X52A 4RHAA 2UYKA 1W42A 3WGKA 5LXTB 5MN6A 1T0KB 3S03A 2VAWA 1DT9A 5IJ0B 3CD6F 3E20B 3WGNA 5GANK 4ZHVA 5HWEA 4U39A 1JD1A 4BT7A 1NJIH 3K0TA 3CCUF 1VQNF 3QHDA 3CC4F 2H6LA 3M4SA 5IT9M 3AGKA 4B62A 1IV4A 1IV2A 3KHNA 3FBAA 3C9RA 5GIPC 5LXTA 3CPWF 3F0FA 1W3EX 1Q82H 1W5EA 2OTJF 1H47A 2ZF8A 2ZVYA 5FJ4C 5JH7A 3JAKA 1CLIA 3RYFA 1GO1A 5HXUA 5IJ0A 4M8IA 3CMEF 3O85A 1JFFB 5JVDB 3JAMM 5EAZA 3DC2A 1E7KA 2HX0A 3K12A 1Z5WA 4O4IB 4ZHQA 3E22B 3ESJA 5CA1B 5JQGB 2F9ZC 1VQ4F 3P4EA 3QTYA 5KMGA 2IAFA 1YHQF 1GX1A 1DBFA 4G4YA 4TZZA 1W5AA 3VI6A 1TUBB 1Q7YH 2VGNA 3S0YA 2H8CA 1VQ5F 3IMPA 1KNKA 5DCVA 4G4VA 1VH8A 5JVDA 4O4HB 1W40A 1VQ7F 4KWEA 3C9TA 2L26A 3PLAC 4TUYB 2CWJA 1W59A 4C81A 1VQ9F 4C8GA 4O4IA 1KD1H 3CB2A 4BT6A 4EB6B 2HS3A 1Z5VA 3E22A 5CA1A 5JQGA 2FC3A 3CMAF 1IV1A 1YQNA 1RA4A 3CCJF 1ODEA 1Q86H 3T80A 3G4SF 2CW4A 5J2TB 2AMTA 5GINC 2LBWA 1YI2F 3OBYA 3ON1A 4DXDA 1Q81H 1VQMF 1TUBA 2HRYA 4ZHYB 3B6NA 3JALB 3RYIB 2UYJA 4IHJB 3NVIB 2RHLA 4O4HA 1NMUB 4LCKA 1RLGA 5EO3A 1ZWZA 3VYTC 3LWVC 3V3TA 3LWRC 3G6EF 2CZWA 5CB4B 1JJ2F 2OZBA 4I4TB 4X1YB 2Z1EA 4ZK7A 3MCQA 1JY8A 3RE3A 3RA5A 1W57A 3S02A 5FNVB 4TV8B 1Q8RA 1U3PA 4O4LB 3LMEA 3OW2F 3JATB 4O2AA 1TVKA 5JCOA 4DRXB 3IKFA 4EI7A 2LBTA 1H7MA 2QEXF 3M1XA 3WGMA 1XBIA 2UYNA 4IHJA 4YJ2A 3LWQC 3WPXA 3RYHB 2IQQA 1U3LA 1U40A 5HY0A 1T0AA 2UZHA 4EI8A 4C4WC 2Z01A 2HS0A 1QVFF 5G4UC 1COMA 5IYZB 1XHOA 4X1YA 5LP6A 3CYPB 1SA0A 3N2KB 3CCQF 1VQPF 1YJWF 2YYEA 3VYUC 3LWOC 1X7PA 5FNVA 4G4ZA 4TV8A 3KJKA 3M84A 4I50B 4O4LA 3TD4A 2BTUA 4BW0B 2QA4F 3JATA 4U3JA 5KX5A 3WJRA 2Z1UA 3CCMF 3JVHA 4DRXA 3IEQA 1PF5A 4ERHA 4IIJB 3OBWA 4C8EA 2ZODA 5JCOC 2HVYD 3GHZA 2ALEA 2P6YA 1GZ0A 4NWOB 3GTZA 3MCAB 3HWUA 2HP3A 3SIUA 5IYZA 1QAHA 4F6RA 4BVQA 3FD6A 3N2KA 4C82A 5G4VC 1QVGF 5IJ9B 3HKBB 5LP6C 3V7QA 1CK2A 5HXZA 2ZAUA 4I50A 1J7HA 1W55A 3C8LA 3JAWB 4B45A 4TV9B 3I7TA 1CN7A 4LNUB 2DYYA 3RA6A 1M1KH 2Z1TA 1K73H 4IIJA 1VQLF 4B5CA 1UFYA 3HAXD 1KNJA 1R1MA 4B46A 1SDSA 1W41A 2CHSA 1W5FA 4BVSA 5MN4A 4HNAB 3OONA 1N8RH 3TD3A 2W8BC 4ZOLB 4G4WA 4X3MA 3C9UA 2MQEA 1K9MH 5IJ9A 5EZYB 2KTUA 3HKBA 3I55F 3N2GB 3IEWA 2FGYA 5EYPB 3Q8HA 3KJJA 2RHJA 4TV9A 1JFFA 3HKCB 3CC7F 1FNKA 3NVKE 1SZQA 4BVTA 3NMUC 1KC8H 3CCEF 1PXWA 2HP0B 5BMVB 4X20B 5EIBC 3FPIA 3P10A 2AIFA 5A2QM 2PMPA 3LDTA 3VCZA 2NMUA 5LA6B 2QTPA 2OTMA 4O2BB 4ZOLA 3JARB 1S72F 3FFMA 3DDNA 3KE1A 3N2GA 1QU9A 3WJQA 2N48A 1FNJA 3CCVF 3CCSF 3CXCF 5HY2A 2CSLA 2ZVZA 3HKDB 3QUWA 5HP8A 5ITZB 2QI2A 5BMVA 2VAPA 3I3FA 4EB6A 3HJWC 5C8YB 3CCRF 1RLUA 3RYCB 1IV3A 2ZOVA 4X1KB 3MBMA 5LA6A 3EORA 3N4ZA 3LFOA 2CVLA 4YJ3B 5J2TA 2UYPA 3F6MA 3JARA 2GZLA 4EI9A 3HTNA 2V9YA 1VQ8F 2HQSC 2HS4A 3K14A 3VMFB 2I6DA 3F0EA 5LOVB 3JALA 3RYIA 2R6R1 1XV2A
chains in the Genus database with same CATH topology
2HVYD 5GIOC 3WXMB 2ALEA 1GZ0A 3MCAB 1VQ4F 2F9ZC 3J7AR 1KQSF 3SIUA 5HY1A 1W2BF 3JCMM 4BVQA 1VQKF 5GAPK 1YHQF 5G4VC 1QVGF 3CCLF 3V7QA 4TZZA 1CK2A 3VI6A 5HXZA 1Q7YH 2VGNA 3CG6A 3LWPC 1VQ5F 5DCVA 5EWRA 1CN7A 1IPAA 3RA6A 2OTLF 1W40A 1M1KH 1VQ7F 3PLAC 1K73H 1YJ9F 1VQLF 3I56F 3HAXD 5FLXM 1VQ9F 1KD1H 3E1YA 1SDSA 1W41A 4BVSA 4BY9D 5HY4A 1VQOF 2FC3A 3CMAF 1N8RH 1RA4A 3CCJF 1M90H 1Q86H 2BO1A 4X3MA 3G4SF 3J80M 5GINC 2LBWA 1K9MH 1X7OA 2KTUA 2GLZA 1YI2F 3OBYA 3ON1A 3I55F 1Q81H 3CC2F 1VQMF 2FGYA 3GYQA 4XCQA 2JNBA 2VGMA 3NVIB 3CC7F 3NVKE 2LBXA 4BVRA 4BVTA 1NMUB 1KC8H 3NMUC 3V7EA 4NUTA 3CCEF 4LCKA 1RLGA 1E7KA 5EO3A 1ZWZA 1PXWA 2KG4A 3N4YA 3V3TA 3LWVC 2CZWA 3LWRC 3G6EF 3NK7A 1JJ2F 3J81M 4X3LA 1X52A 2AIFA 3NK6A 5A2QM 4NQ3A 3RA5A 2KTVA 1T0KB 3CPQA 3OW2F 1DT9A 3G71F 1S72F 3FFMA 1YIJF 3CD6F 3E20B 5GANK 3D00A 2OZBA 5HWEA 4EI7A 3CCVF 3CCSF 1H7MA 2QEXF 3CXCF 3LWQC 1XBIA 5HY2A 1NJIH 5HY0A 3CCUF 1YJNF 1VQNF 3CC4F 4EI8A 4C4WC 2QI2A 5IT9M 3AGKA 5G4UC 1QVFF 3HJWC 3CCRF 3CCQF 1VQPF 1YJWF 3SIVA 2OHWA 5GIPC 1GO0A 3IR9A 3LWOC 1X7PA 3CPWF 3LFOA 1W3EX 3N4ZA 1Q82H 2OTJF 5FJ4C 1GO1A 4BW0B 5HXUA 4EI9A 2QA4F 3PAFA 1YITF 3CMEF 3O85A 1K8AH 3CCMF 2WALA 1VQ8F 3VMFB 3JAMM 3OBWA 2I6DA 1W42A 1VQ6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY D;  5GIO C;  3WXM B;  2ALE A;  1GZ0 A;  3MCA B;  1VQ4 F;  3J7A R;  1KQS F;  3SIU A;  1W2B F;  3JCM M;  1VQK F;  5GAP K;  1YHQ F;  5G4V C;  1QVG F;  3CCL F;  3V7Q A;  4TZZ A;  1CK2 A;  3VI6 A;  1Q7Y H;  2VGN A;  3CG6 A;  3LWP C;  1VQ5 F;  5DCV A;  5EWR A;  1CN7 A;  1IPA A;  3RA6 A;  2OTL F;  1W40 A;  1M1K H;  1VQ7 F;  3PLA C;  1K73 H;  1YJ9 F;  1VQL F;  3I56 F;  3HAX D;  5FLX M;  1VQ9 F;  1KD1 H;  3E1Y A;  1SDS A;  1W41 A;  4BY9 D;  1VQO F;  2FC3 A;  3CMA F;  1N8R H;  1RA4 A;  3CCJ F;  1M90 H;  1Q86 H;  2BO1 A;  4X3M A;  3G4S F;  3J80 M;  5GIN C;  2LBW A;  1K9M H;  1X7O A;  2KTU A;  1YI2 F;  3OBY A;  3ON1 A;  3I55 F;  1Q81 H;  3CC2 F;  1VQM F;  3GYQ A;  2JNB A;  2VGM A;  3NVI B;  3CC7 F;  3NVK E;  2LBX A;  3NMU C;  1NMU B;  1KC8 H;  3V7E A;  4NUT A;  3CCE F;  4LCK A;  1RLG A;  1E7K A;  5EO3 A;  1ZWZ A;  1PXW A;  2KG4 A;  3N4Y A;  3LWV C;  3LWR C;  2CZW A;  3G6E F;  1JJ2 F;  3NK7 A;  3J81 M;  4X3L A;  1X52 A;  2AIF A;  3NK6 A;  5A2Q M;  3RA5 A;  2KTV A;  1T0K B;  3CPQ A;  3OW2 F;  1DT9 A;  3G71 F;  1S72 F;  3FFM A;  1YIJ F;  3CD6 F;  3E20 B;  5GAN K;  2OZB A;  3CCV F;  3CCS F;  1H7M A;  2QEX F;  3CXC F;  3LWQ C;  1XBI A;  1NJI H;  3CCU F;  1YJN F;  1VQN F;  3CC4 F;  4C4W C;  2QI2 A;  5IT9 M;  3AGK A;  5G4U C;  1QVF F;  3HJW C;  3CCR F;  3CCQ F;  1VQP F;  1YJW F;  3SIV A;  2OHW A;  5GIP C;  1GO0 A;  3IR9 A;  3LWO C;  1X7P A;  3CPW F;  3LFO A;  1W3E X;  3N4Z A;  1Q82 H;  2OTJ F;  5FJ4 C;  1GO1 A;  4BW0 B;  2QA4 F;  3PAF A;  1YIT F;  3CME F;  3O85 A;  1K8A H;  3CCM F;  2WAL A;  1VQ8 F;  3VMF B;  3JAM M;  3OBW A;  2I6D A;  1W42 A;  1VQ6 F; 
#chains in the Genus database with same CATH topology
 5GIO C;  3HKD A;  1OAP A;  5ITZ A;  1FSZ A;  3V4D A;  5CB4 A;  2H8E A;  4I4T A;  4PWT A;  3JCM M;  2RHO A;  2RB9 A;  3WGJ A;  3ERN A;  3RYC A;  3R0P A;  4ZHW A;  5J2U B;  1VHA A;  3C9S A;  1FFX B;  3CG6 A;  5HP7 A;  3LWP C;  5EB1 B;  3MQW A;  1IPA A;  4FFB B;  2OTL F;  1XRG A;  1RQ7 A;  3S06 A;  3I56 F;  5LOV A;  2B33 A;  5FLX M;  3LYB A;  4TUY A;  1VQV A;  3RYH A;  4O4J B;  3E1Y A;  2VAM A;  3VO8 A;  3WPW A;  3WJP A;  2DT4 A;  4G4X A;  3BYQ A;  3VTI C;  1M90 H;  2BO1 A;  3JAK B;  5JH7 B;  3RYF B;  1YGY A;  2YXZ A;  2AIZ P;  5J2U A;  1FFX A;  3GYQ A;  2JNB A;  2VGM A;  3CYQ A;  2BTO A;  3U0O A;  4FFB A;  4X1I B;  5MN5 A;  1VQ6 F;  3ELC A;  4NUT A;  4ZHQ B;  4BT4 A;  3JAS B;  4BT5 A;  3NK7 A;  4O4J A;  2CHT A;  3MDO A;  4X3L A;  1UI9 A;  5KMG B;  5LYJ B;  3NK6 A;  4NQ3 A;  3D54 A;  2KTV A;  3WGL A;  3CPQ A;  5B8F A;  3G71 F;  2LCA A;  5AVM A;  1YIJ F;  2HRU A;  3D00 A;  2BTQ B;  3VYS C;  1W58 1;  3JAW A;  3ZOP A;  5CA0 B;  4LNU A;  4X1I A;  3D01 A;  1YJN F;  4R40 B;  2VXY A;  3JAS A;  3FD5 A;  2Q1X A;  1U43 A;  1JN1 A;  5LYJ A;  1W5B A;  3SIV A;  1VK3 A;  2OHW A;  1GO0 A;  4HNA A;  3VOA A;  3IR9 A;  2Q1Y A;  3F0G A;  3ZP7 A;  4C8I A;  1YIT F;  3PAF A;  5EZY A;  1K8A H;  1RQ2 A;  2WAL A;  5EYP A;  4I55 B;  5CA0 A;  5GON B;  2Z1F A;  4BT3 A;  3HKC A;  5EIB D;  3WXM B;  4WBN B;  2R75 1;  3J7A R;  2EWC A;  2HP0 A;  3F0D A;  1KQS F;  4X20 A;  2K1S A;  5HY1 A;  1W2B F;  2IG8 A;  1VQK F;  5GAP K;  3IKE A;  1X25 A;  2KGW A;  3CCL F;  4O2A B;  1TVK B;  2GVI A;  4O2B A;  3KIZ A;  3K2X A;  4ZI7 B;  2RHH A;  3HKE B;  3VIU A;  2UYN B;  4YJ2 B;  5EWR A;  3ZO8 A;  1H48 A;  4I55 A;  4E6E A;  1YJ9 F;  5GON A;  3UT5 B;  1NQ3 A;  4WBN A;  5LP6 B;  1SA0 B;  4G88 A;  4BY9 D;  3VOB A;  5HY4 A;  1VQO F;  3P0Z A;  1QD9 A;  5C8Y A;  2PHN A;  3J80 M;  1ONI A;  1X7O A;  4RQO A;  4X1K A;  2GLZ A;  4U3J B;  5KX5 B;  3CC2 F;  4YJ3 A;  4ZI7 A;  1OFU A;  4XCQ A;  2G9I A;  5EB0 A;  3HKE A;  3L7Q A;  2I6R A;  2LBX A;  3S0H A;  4BVR A;  3S0W A;  3TD5 A;  3V7E A;  3ZP4 A;  2KG4 A;  4BT2 A;  3N4Y A;  3UT5 A;  3J81 M;  4F6R B;  1X52 A;  4RHA A;  2UYK A;  1W42 A;  3WGK A;  5LXT B;  5MN6 A;  1T0K B;  3S03 A;  2VAW A;  1DT9 A;  5IJ0 B;  3CD6 F;  3E20 B;  3WGN A;  5GAN K;  4ZHV A;  5HWE A;  4U39 A;  1JD1 A;  4BT7 A;  1NJI H;  3K0T A;  3CCU F;  1VQN F;  3QHD A;  3CC4 F;  2H6L A;  3M4S A;  5IT9 M;  3AGK A;  4B62 A;  1IV4 A;  1IV2 A;  3KHN A;  3FBA A;  3C9R A;  5GIP C;  5LXT A;  3CPW F;  3F0F A;  1W3E X;  1Q82 H;  1W5E A;  2OTJ F;  1H47 A;  2ZF8 A;  2ZVY A;  5FJ4 C;  5JH7 A;  3JAK A;  1CLI A;  3RYF A;  1GO1 A;  5HXU A;  5IJ0 A;  4M8I A;  3CME F;  3O85 A;  1JFF B;  5JVD B;  3JAM M;  5EAZ A;  3DC2 A;  1E7K A;  2HX0 A;  3K12 A;  1Z5W A;  4O4I B;  4ZHQ A;  3E22 B;  3ESJ A;  5CA1 B;  5JQG B;  2F9Z C;  1VQ4 F;  3P4E A;  3QTY A;  5KMG A;  2IAF A;  1YHQ F;  1GX1 A;  1DBF A;  4G4Y A;  4TZZ A;  1W5A A;  3VI6 A;  1TUB B;  1Q7Y H;  2VGN A;  3S0Y A;  2H8C A;  1VQ5 F;  3IMP A;  1KNK A;  5DCV A;  4G4V A;  1VH8 A;  5JVD A;  4O4H B;  1W40 A;  1VQ7 F;  4KWE A;  3C9T A;  2L26 A;  3PLA C;  4TUY B;  2CWJ A;  1W59 A;  4C81 A;  1VQ9 F;  4C8G A;  4O4I A;  1KD1 H;  3CB2 A;  4BT6 A;  4EB6 B;  2HS3 A;  1Z5V A;  3E22 A;  5CA1 A;  5JQG A;  2FC3 A;  3CMA F;  1IV1 A;  1YQN A;  1RA4 A;  3CCJ F;  1ODE A;  1Q86 H;  3T80 A;  3G4S F;  2CW4 A;  5J2T B;  2AMT A;  5GIN C;  2LBW A;  1YI2 F;  3OBY A;  3ON1 A;  4DXD A;  1Q81 H;  1VQM F;  1TUB A;  2HRY A;  4ZHY B;  3B6N A;  3JAL B;  3RYI B;  2UYJ A;  4IHJ B;  3NVI B;  2RHL A;  4O4H A;  1NMU B;  4LCK A;  1RLG A;  5EO3 A;  1ZWZ A;  3VYT C;  3LWV C;  3V3T A;  3LWR C;  3G6E F;  2CZW A;  5CB4 B;  1JJ2 F;  2OZB A;  4I4T B;  4X1Y B;  2Z1E A;  4ZK7 A;  3MCQ A;  1JY8 A;  3RE3 A;  3RA5 A;  1W57 A;  3S02 A;  5FNV B;  4TV8 B;  1Q8R A;  1U3P A;  4O4L B;  3LME A;  3OW2 F;  3JAT B;  4O2A A;  1TVK A;  5JCO A;  4DRX B;  3IKF A;  4EI7 A;  2LBT A;  1H7M A;  2QEX F;  3M1X A;  3WGM A;  1XBI A;  2UYN A;  4IHJ A;  4YJ2 A;  3LWQ C;  3WPX A;  3RYH B;  2IQQ A;  1U3L A;  1U40 A;  5HY0 A;  1T0A A;  2UZH A;  4EI8 A;  4C4W C;  2Z01 A;  2HS0 A;  1QVF F;  5G4U C;  1COM A;  5IYZ B;  1XHO A;  4X1Y A;  5LP6 A;  3CYP B;  1SA0 A;  3N2K B;  3CCQ F;  1VQP F;  1YJW F;  2YYE A;  3VYU C;  3LWO C;  1X7P A;  5FNV A;  4G4Z A;  4TV8 A;  3KJK A;  3M84 A;  4I50 B;  4O4L A;  3TD4 A;  2BTU A;  4BW0 B;  2QA4 F;  3JAT A;  4U3J A;  5KX5 A;  3WJR A;  2Z1U A;  3CCM F;  3JVH A;  4DRX A;  3IEQ A;  1PF5 A;  4ERH A;  4IIJ B;  3OBW A;  4C8E A;  2ZOD A;  5JCO C;  2HVY D;  3GHZ A;  2ALE A;  2P6Y A;  1GZ0 A;  4NWO B;  3GTZ A;  3MCA B;  3HWU A;  2HP3 A;  3SIU A;  5IYZ A;  1QAH A;  4F6R A;  4BVQ A;  3FD6 A;  3N2K A;  4C82 A;  5G4V C;  1QVG F;  5IJ9 B;  3HKB B;  5LP6 C;  3V7Q A;  1CK2 A;  5HXZ A;  2ZAU A;  4I50 A;  1J7H A;  1W55 A;  3C8L A;  3JAW B;  4B45 A;  4TV9 B;  3I7T A;  1CN7 A;  4LNU B;  2DYY A;  3RA6 A;  1M1K H;  2Z1T A;  1K73 H;  4IIJ A;  1VQL F;  4B5C A;  1UFY A;  3HAX D;  1KNJ A;  1R1M A;  4B46 A;  1SDS A;  1W41 A;  2CHS A;  1W5F A;  4BVS A;  5MN4 A;  4HNA B;  3OON A;  1N8R H;  3TD3 A;  2W8B C;  4ZOL B;  4G4W A;  4X3M A;  3C9U A;  2MQE A;  1K9M H;  5IJ9 A;  5EZY B;  2KTU A;  3HKB A;  3I55 F;  3N2G B;  3IEW A;  2FGY A;  5EYP B;  3Q8H A;  3KJJ A;  2RHJ A;  4TV9 A;  1JFF A;  3HKC B;  3CC7 F;  1FNK A;  3NVK E;  1SZQ A;  4BVT A;  3NMU C;  1KC8 H;  3CCE F;  1PXW A;  2HP0 B;  5BMV B;  4X20 B;  5EIB C;  3FPI A;  3P10 A;  2AIF A;  5A2Q M;  2PMP A;  3LDT A;  3VCZ A;  2NMU A;  5LA6 B;  2QTP A;  2OTM A;  4O2B B;  4ZOL A;  3JAR B;  1S72 F;  3FFM A;  3DDN A;  3KE1 A;  3N2G A;  1QU9 A;  3WJQ A;  2N48 A;  1FNJ A;  3CCV F;  3CCS F;  3CXC F;  5HY2 A;  2CSL A;  2ZVZ A;  3HKD B;  3QUW A;  5HP8 A;  5ITZ B;  2QI2 A;  5BMV A;  2VAP A;  3I3F A;  4EB6 A;  3HJW C;  5C8Y B;  3CCR F;  1RLU A;  3RYC B;  1IV3 A;  2ZOV A;  4X1K B;  3MBM A;  5LA6 A;  3EOR A;  3N4Z A;  3LFO A;  2CVL A;  4YJ3 B;  5J2T A;  2UYP A;  3F6M A;  3JAR A;  2GZL A;  4EI9 A;  3HTN A;  2V9Y A;  1VQ8 F;  2HQS C;  2HS4 A;  3K14 A;  3VMF B;  2I6D A;  3F0E A;  5LOV B;  3JAL A;  3RYI A;  2R6R 1;  1XV2 A; 
#chains in the Genus database with same CATH homology
 2HVY D;  5GIO C;  3WXM B;  2ALE A;  1GZ0 A;  3MCA B;  1VQ4 F;  2F9Z C;  3J7A R;  1KQS F;  3SIU A;  5HY1 A;  1W2B F;  3JCM M;  4BVQ A;  1VQK F;  5GAP K;  1YHQ F;  5G4V C;  1QVG F;  3CCL F;  3V7Q A;  4TZZ A;  1CK2 A;  3VI6 A;  5HXZ A;  1Q7Y H;  2VGN A;  3CG6 A;  3LWP C;  1VQ5 F;  5DCV A;  5EWR A;  1CN7 A;  1IPA A;  3RA6 A;  2OTL F;  1W40 A;  1M1K H;  1VQ7 F;  3PLA C;  1K73 H;  1YJ9 F;  1VQL F;  3I56 F;  3HAX D;  5FLX M;  1VQ9 F;  1KD1 H;  3E1Y A;  1SDS A;  1W41 A;  4BVS A;  4BY9 D;  5HY4 A;  1VQO F;  2FC3 A;  3CMA F;  1N8R H;  1RA4 A;  3CCJ F;  1M90 H;  1Q86 H;  2BO1 A;  4X3M A;  3G4S F;  3J80 M;  5GIN C;  2LBW A;  1K9M H;  1X7O A;  2KTU A;  2GLZ A;  1YI2 F;  3OBY A;  3ON1 A;  3I55 F;  1Q81 H;  3CC2 F;  1VQM F;  2FGY A;  3GYQ A;  4XCQ A;  2JNB A;  2VGM A;  3NVI B;  3CC7 F;  3NVK E;  2LBX A;  4BVR A;  4BVT A;  1NMU B;  1KC8 H;  3NMU C;  3V7E A;  4NUT A;  3CCE F;  4LCK A;  1RLG A;  1E7K A;  5EO3 A;  1ZWZ A;  1PXW A;  2KG4 A;  3N4Y A;  3V3T A;  3LWV C;  2CZW A;  3LWR C;  3G6E F;  3NK7 A;  1JJ2 F;  3J81 M;  4X3L A;  1X52 A;  2AIF A;  3NK6 A;  5A2Q M;  4NQ3 A;  3RA5 A;  2KTV A;  1T0K B;  3CPQ A;  3OW2 F;  1DT9 A;  3G71 F;  1S72 F;  3FFM A;  1YIJ F;  3CD6 F;  3E20 B;  5GAN K;  3D00 A;  2OZB A;  5HWE A;  4EI7 A;  3CCV F;  3CCS F;  1H7M A;  2QEX F;  3CXC F;  3LWQ C;  1XBI A;  5HY2 A;  1NJI H;  5HY0 A;  3CCU F;  1YJN F;  1VQN F;  3CC4 F;  4EI8 A;  4C4W C;  2QI2 A;  5IT9 M;  3AGK A;  5G4U C;  1QVF F;  3HJW C;  3CCR F;  3CCQ F;  1VQP F;  1YJW F;  3SIV A;  2OHW A;  5GIP C;  1GO0 A;  3IR9 A;  3LWO C;  1X7P A;  3CPW F;  3LFO A;  1W3E X;  3N4Z A;  1Q82 H;  2OTJ F;  5FJ4 C;  1GO1 A;  4BW0 B;  5HXU A;  4EI9 A;  2QA4 F;  3PAF A;  1YIT F;  3CME F;  3O85 A;  1K8A H;  3CCM F;  2WAL A;  1VQ8 F;  3VMF B;  3JAM M;  3OBW A;  2I6D A;  1W42 A;  1VQ6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...