1K8AH

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k8aH00
3G71F 1YITF 5A2QM 3CPWF 3CPQA 1W41A 1VQ4F 4TZZA 1Q86H 1VQNF 3NK7A 3LWQC 3CCRF 5GIOC 1NJIH 1T0KB 1VQ6F 3NMUC 2KTUA 1CK2A 3NVIB 1RA4A 2KG4A 3MCAB 5G4UC 1VQ8F 1KQSF 3CCLF 5FLXM 2QEXF 3VI6A 1KC8H 3SIVA 2VGNA 3N4YA 3PAFA 2LBWA 3LWOC 3LWRC 1ZWZA 3CMEF 3CCEF 1M90H 4BW0B 1K8AH 3NVKE 3N4ZA 1RLGA 3HJWC 3OW2F 2OZBA 1GZ0A 1E7KA 1Q7YH 1M1KH 3CD6F 2OTJF 2FC3A 3SIUA 2KTVA 2QI2A 3WXMB 2AIFA 3RA6A 5IT9M 5EO3A 4NUTA 1X7PA 1KD1H 3I55F 1X7OA 1PXWA 3RA5A 1VQPF 1GO1A 2I6DA 3OBWA 3CXCF 5EWRA 3AGKA 3LFOA 3E1YA 1S72F 1K9MH 1DT9A 2BO1A 5G4VC 1W40A 3CC2F 3IR9A 1X52A 1Q82H 1NMUB 1Q81H 3E20B 3LWVC 3G4SF 3J81M 1SDSA 3J7AR 3CCSF 1VQLF 3NK6A 2VGMA 1VQOF 2WALA 2CZWA 1YJ9F 3PLAC 2ALEA 1VQKF 3GYQA 1YIJF 1CN7A 1VQ7F 1YJNF 3CC4F 3CG6A 2OTLF 2HVYD 1JJ2F 5DCVA 3G6EF 5GIPC 4C4WC 2OHWA 1VQ9F 1W2BF 3JCMM 1N8RH 5GANK 3HAXD 3I56F 5GINC 3OBYA 1YHQF 4X3MA 3LWPC 3CC7F 3ON1A 2QA4F 1QVFF 1XBIA 5FJ4C 3CCQF 3CCMF 1YJWF 2JNBA 3JAMM 3V7EA 4X3LA 1W3EX 3J80M 1K73H 3FFMA 1YI2F 1VQMF 1IPAA 3VMFB 1VQ5F 3CMAF 3V7QA 4LCKA 1QVGF 4BY9D 3O85A 3CCJF 1GO0A 5GAPK 3CCVF 2LBXA 1W42A 3CCUF 1H7MA
chains in the Genus database with same CATH superfamily
5JH7A 3CPWF 1W55A 1W41A 4TZZA 1VQVA 2BTOA 3NK7A 3QTYA 3LWQC 5GIOC 2GZLA 5MN6A 1VQ6F 4FFBB 2KTUA 3NVIB 3S06A 1RA4A 2KG4A 5GONB 1TUBB 2AMTA 5G4UC 1JN1A 3KE1A 4RHAA 5JH7B 2P6YA 5FLXM 3VI6A 3ZO8A 1KC8H 2LBWA 3LWRC 2RHHA 3N4ZA 3VYTC 1E7KA 2CW4A 2RHOA 2Z01A 2UYNA 3IKEA 5JCOA 2OTJF 3IMPA 3ELCA 2DT4A 3WXMB 4BT7A 3RA6A 1Z5VA 4NUTA 2CHTA 1X7OA 3LYBA 5EZYA 1X25A 3RA5A 4ZHQA 1VQPF 4EI8A 5J2UA 4M8IA 5EAZA 4B62A 5HY2A 5EWRA 5LA6A 4X1IA 5FNVA 4BT5A 4C8EA 1K9MH 1DT9A 1W5BA 5CB4A 3G4SF 4O4IA 2CWJA 3J81M 5EZYB 4F6RA 2IQQA 3CCSF 3IEWA 2Q1YA 4ZHQB 1XRGA 1VQLF 5J2UB 1FFXA 3FD5A 3M84A 1XV2A 4I55A 3PLAC 1VQKF 4RQOA 2HP3A 1YIJF 1VQ7F 5LA6B 4X1IB 1SZQA 5FNVB 5HY4A 3R0PA 1QD9A 3WJRA 3WJQA 3D54A 1JJ2F 5CB4B 3M1XA 4O4IB 2VAWA 4F6RB 5GANK 2HQSC 3D01A 1FFXB 2RHJA 3DDNA 4I55B 2HRUA 2HP0A 3VYSC 5KX5A 2N48A 1XBIA 2UZHA 4X3LA 5LP6A 5JCOC 3FD6A 4G4XA 3KHNA 4BVSA 3CYPB 2HS4A 3CMAF 2AIZP 1GX1A 5LXTA 3L7QA 2HP0B 4LCKA 1Q8RA 1UI9A 5KX5B 3F0DA 3E22A 5LP6B 4B46A 5KMGA 3Q8HA 3G71F 1RQ7A 1YITF 1JD1A 1KNJA 1Q86H 4B45A 5LXTB 1DBFA 1VQNF 1NJIH 2RB9A 3HKEA 3CYQA 3RYIA 3E22B 3MCAB 4EI7A 2Z1FA 4TUYA 5KMGB 2ZAUA 1KQSF 3CCLF 4ZI7A 2VGNA 3MQWA 3LWOC 3CMEF 1ZWZA 2B33A 3U0OA 1RQ2A 2ZVYA 4YJ3A 3HJWC 3HKEB 5EB1B 5B8FA 3KJJA 3RYIB 1M1KH 2Z1EA 4TUYB 3MDOA 2UYPA 2QI2A 4ZI7B 5IT9M 5EO3A 1X7PA 4U3JA 5IYZA 3CB2A 3I55F 1PXWA 4YJ3B 4NWOB 3ZP7A 3KJKA 2I6DA 3JVHA 1OFUA 5EB0A 5LYJA 3WGMA 2IAFA 5CA0A 1ONIA 1JFFA 1W57A 3C9RA 5G4VC 1U3LA 3IR9A 2HRYA 2VAPA 4U3JB 3E20B 3WGKA 1Q81H 5IYZB 3K2XA 3HKCA 5J2TA 3K12A 1VQOF 1H47A 2WALA 4I50A 1YJ9F 3HTNA 4BT4A 5LYJB 3K0TA 3GYQA 2G9IA 3VO8A 5EIBC 3K14A 1YJNF 5CA0B 1JFFB 4I4TA 1CLIA 2EWCA 2OHWA 3UT5A 3V3TA 1W2BF 3HKCB 3JCMM 5J2TB 1N8RH 3FBAA 2Z1UA 4I50B 3OBYA 3KIZA 3TD3A 1YHQF 1J7HA 1FSZA 4YJ2A 4G88A 2MQEA 2QTPA 3ON1A 2QA4F 1QVFF 2OTMA 1TVKA 3F0FA 3LMEA 3HKBA 5FJ4C 3CCMF 2ZVZA 4I4TB 3S03A 3WGJA 3UT5B 3FFMA 1VK3A 3C9SA 4YJ2B 4BT2A 2GVIA 3VOBA 4BT6A 5MN4A 1QVGF 4BY9D 1GO0A 1TVKB 3HKBB 4ZOLA 3CCVF 3C9UA 2PMPA 3TD4A 5A2QM 3QHDA 5ITZA 2K1SA 5HXZA 1XHOA 2W8BC 3NMUC 1CK2A 1R1MA 4ZOLB 2VXYA 3S0WA 2BTUA 3S02A 5HY1A 1VHAA 1VQ8F 4X20A 2H6LA 2QEXF 3SIVA 5ITZB 2UYJA 3EORA 5JQGA 3CCEF 2Q1XA 4ZHVA 3JAWA 1K8AH 1RLGA 4ERHA 2OZBA 3WGNA 2I6RA 4O2AA 1Q7YH 4O4JA 5CA1A 3N2KA 3M4SA 2F9ZC 2FC3A 3SIUA 3WJPA 5LOVA 2KTVA 4X20B 4ZHWA 4BVRA 3D00A 5JQGB 1KD1H 2R6R1 2KGWA 3JAWB 3V4DA 4O2AB 2LCAA 4O4JB 5CA1B 3CXCF 1COMA 3N2KB 2FGYA 5LOVB 3BYQA 1ODEA 1W40A 5IJ0A 3ZOPA 1Z5WA 1SDSA 4XCQA 4EI9A 5HY0A 1U40A 4G4YA 5HWEA 4TV8A 5MN5A 2VGMA 1UFYA 2CZWA 3C9TA 2ALEA 2PHNA 5C8YA 1U43A 1CN7A 4BT3A 2CVLA 3WGLA 3CC4F 5HP8A 2OTLF 2HVYD 3F0EA 3VCZA 2CHSA 5LP6C 3VOAA 3P4EA 3WPXA 5IJ0B 3WPWA 1VH8A 1W581 2CSLA 3HAXD 4EB6A 3ZP4A 3I56F 4TV8B 3I7TA 3B6NA 5C8YB 2IG8A 4C8GA 3CC7F 1QU9A 4C8IA 4BVQA 2GLZA 3CCQF 3P10A 1YJWF 2JNBA 3V7EA 1W5AA 3J80M 1K73H 5HXUA 2H8CA 3JARA 4EB6B 1YI2F 2HS3A 1VQMF 2V9YA 1IV1A 2HS0A 3JAKA 1FNJA 3JATA 5HP7A 1VQ5F 2ZODA 3MCQA 4LNUA 3DC2A 4ZHYB 3JALA 1IV4A 3ESJA 3CCJF 1T0AA 4U39A 1PF5A 5GAPK 1W5EA 2HX0A 4B5CA 4X1YA 1W42A 1H7MA 3LDTA 4TV9A 2LBTA 4DXDA 3JARB 1NQ3A 3JAKB 3CPQA 1VQ4F 3JATB 3QUWA 4KWEA 4E6EA 3I3FA 3CCRF 4G4VA 4LNUB 4X1KA 3JALB 1T0KB 4PWTA 3GTZA 4HNAA 4X1YB 3T80A 4TV9B 1YQNA 5EYPA 1KNKA 1JY8A 2UYNB 5BMVA 3N4YA 3PAFA 3TD5A 2UYKA 1M90H 4C82A 4BW0B 4X1KB 3NVKE 4C81A 3OW2F 1GZ0A 3F0GA 3JASA 4HNAB 4IIJA 3CD6F 1W5FA 1IV3A 2YYEA 5EYPB 2AIFA 3P0ZA 3RYCA 4O4LA 5BMVB 4DRXA 1OAPA 3IEQA 1IV2A 1GO1A 3OBWA 2ZOVA 3JASB 3IKFA 1W59A 2BTQB 3OONA 4IIJB 3AGKA 3LFOA 3E1YA 1S72F 3RYFA 2BO1A 3S0YA 3GHZA 3VIUA 4O4LB 3RYCB 3ERNA 3MBMA 1X52A 3CC2F 1Q82H 1NMUB 2RHLA 3N2GA 4DRXB 3LWVC 2YXZA 2H8EA 5IJ9A 3VTIC 2VAMA 3HKDA 3J7AR 5JVDA 3NK6A 4BVTA 4NQ3A 3CG6A 3RYFB 1SA0A 3S0HA 2NMUA 5DCVA 3G6EF 3N2GB 4IHJA 5IJ9B 5GIPC 1YGYA 4C4WC 5EIBD 1VQ9F 3C8LA 3HKDB 3RYHA 5JVDB 2ZF8A 5GINC 4X3MA 4WBNA 3HWUA 1H48A 3FPIA 4O2BA 3LWPC 1SA0B 4R40B 1QAHA 5AVMA 3JAMM 4IHJB 4O4HA 2R751 1W3EX 3VYUC 4ZK7A 3RYHB 1U3PA 2Z1TA 4G4WA 1IPAA 3VMFB 4WBNB 1RLUA 1FNKA 4O2BB 3V7QA 3F6MA 3O85A 4FFBA 4G4ZA 3RE3A 2LBXA 4O4HB 5GONA 1TUBA 3CCUF 2DYYA 2L26A
chains in the Genus database with same CATH topology
3G71F 1YITF 5A2QM 3CPWF 3CPQA 1W41A 1VQ4F 4TZZA 1Q86H 1VQNF 3NK7A 3LWQC 5HXZA 3CCRF 5GIOC 1NJIH 1T0KB 1VQ6F 3NMUC 2KTUA 1CK2A 3NVIB 1RA4A 2KG4A 3MCAB 4EI7A 5HY1A 5G4UC 1VQ8F 1KQSF 3CCLF 5FLXM 2QEXF 3VI6A 1KC8H 3SIVA 2VGNA 3N4YA 3PAFA 2LBWA 3LWOC 3LWRC 1ZWZA 3CMEF 3CCEF 1M90H 4BW0B 1K8AH 3NVKE 3N4ZA 1RLGA 3HJWC 3OW2F 2OZBA 1GZ0A 1E7KA 1Q7YH 1M1KH 3CD6F 2F9ZC 2OTJF 2FC3A 3SIUA 2KTVA 2QI2A 3WXMB 2AIFA 3RA6A 4BVRA 5IT9M 5EO3A 3D00A 4NUTA 1X7PA 1KD1H 3I55F 1X7OA 1PXWA 3RA5A 1VQPF 4EI8A 1GO1A 2I6DA 3OBWA 5HY2A 3CXCF 5EWRA 2FGYA 3AGKA 3LFOA 3E1YA 1S72F 1K9MH 1DT9A 2BO1A 5G4VC 1W40A 3CC2F 3IR9A 1X52A 1Q82H 1NMUB 1Q81H 3E20B 3LWVC 3G4SF 3J81M 1SDSA 3J7AR 4XCQA 3CCSF 4EI9A 5HY0A 5HWEA 3NK6A 1VQLF 2VGMA 4BVTA 1VQOF 2WALA 2CZWA 1YJ9F 3PLAC 2ALEA 1VQKF 3GYQA 4NQ3A 1YIJF 1VQ7F 1CN7A 1YJNF 3CC4F 3CG6A 5HY4A 2OTLF 2HVYD 1JJ2F 5DCVA 3G6EF 5GIPC 4C4WC 2OHWA 1VQ9F 3V3TA 1W2BF 3JCMM 1N8RH 5GANK 3HAXD 3I56F 5GINC 3OBYA 1YHQF 4X3MA 3LWPC 3CC7F 3ON1A 2QA4F 1QVFF 1XBIA 4BVQA 5FJ4C 2GLZA 3CCMF 3CCQF 1YJWF 2JNBA 3JAMM 3V7EA 4X3LA 1W3EX 3J80M 1K73H 5HXUA 3FFMA 1YI2F 1VQMF 1IPAA 3VMFB 4BVSA 1VQ5F 3CMAF 3V7QA 4LCKA 1QVGF 4BY9D 3O85A 3CCJF 1GO0A 5GAPK 3CCVF 2LBXA 1W42A 3CCUF 1H7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 F;  1YIT F;  5A2Q M;  3CPW F;  3CPQ A;  1W41 A;  1VQ4 F;  4TZZ A;  1Q86 H;  1VQN F;  3NK7 A;  3LWQ C;  3CCR F;  5GIO C;  1NJI H;  1T0K B;  1VQ6 F;  3NMU C;  2KTU A;  1CK2 A;  3NVI B;  1RA4 A;  2KG4 A;  3MCA B;  5G4U C;  1VQ8 F;  1KQS F;  3CCL F;  5FLX M;  2QEX F;  3VI6 A;  1KC8 H;  3SIV A;  2VGN A;  3N4Y A;  3PAF A;  2LBW A;  3LWO C;  3LWR C;  1ZWZ A;  3CME F;  3CCE F;  1M90 H;  4BW0 B;  1K8A H;  3NVK E;  3N4Z A;  1RLG A;  3HJW C;  3OW2 F;  2OZB A;  1GZ0 A;  1E7K A;  1Q7Y H;  1M1K H;  3CD6 F;  2OTJ F;  2FC3 A;  3SIU A;  2KTV A;  2QI2 A;  3WXM B;  2AIF A;  3RA6 A;  5IT9 M;  5EO3 A;  4NUT A;  1X7P A;  1KD1 H;  3I55 F;  1X7O A;  1PXW A;  3RA5 A;  1VQP F;  1GO1 A;  2I6D A;  3OBW A;  3CXC F;  5EWR A;  3AGK A;  3LFO A;  3E1Y A;  1S72 F;  1K9M H;  1DT9 A;  2BO1 A;  5G4V C;  1W40 A;  3CC2 F;  3IR9 A;  1X52 A;  1Q82 H;  1NMU B;  1Q81 H;  3E20 B;  3LWV C;  3G4S F;  3J81 M;  1SDS A;  3J7A R;  3CCS F;  1VQL F;  3NK6 A;  2VGM A;  1VQO F;  2WAL A;  2CZW A;  1YJ9 F;  3PLA C;  2ALE A;  1VQK F;  3GYQ A;  1YIJ F;  1CN7 A;  1VQ7 F;  1YJN F;  3CC4 F;  3CG6 A;  2OTL F;  2HVY D;  1JJ2 F;  5DCV A;  3G6E F;  5GIP C;  4C4W C;  2OHW A;  1VQ9 F;  1W2B F;  3JCM M;  1N8R H;  5GAN K;  3HAX D;  3I56 F;  5GIN C;  3OBY A;  1YHQ F;  4X3M A;  3LWP C;  3CC7 F;  3ON1 A;  2QA4 F;  1QVF F;  1XBI A;  5FJ4 C;  3CCQ F;  3CCM F;  1YJW F;  2JNB A;  3JAM M;  3V7E A;  4X3L A;  1W3E X;  3J80 M;  1K73 H;  3FFM A;  1YI2 F;  1VQM F;  1IPA A;  3VMF B;  1VQ5 F;  3CMA F;  3V7Q A;  4LCK A;  1QVG F;  4BY9 D;  3O85 A;  3CCJ F;  1GO0 A;  5GAP K;  3CCV F;  2LBX A;  1W42 A;  3CCU F;  1H7M A; 
#chains in the Genus database with same CATH topology
 5JH7 A;  3CPW F;  1W55 A;  1W41 A;  4TZZ A;  1VQV A;  2BTO A;  3NK7 A;  3QTY A;  3LWQ C;  5GIO C;  2GZL A;  5MN6 A;  1VQ6 F;  4FFB B;  2KTU A;  3NVI B;  3S06 A;  1RA4 A;  2KG4 A;  5GON B;  1TUB B;  2AMT A;  5G4U C;  1JN1 A;  3KE1 A;  4RHA A;  5JH7 B;  2P6Y A;  5FLX M;  3VI6 A;  3ZO8 A;  1KC8 H;  2LBW A;  3LWR C;  2RHH A;  3N4Z A;  3VYT C;  1E7K A;  2CW4 A;  2RHO A;  2Z01 A;  2UYN A;  3IKE A;  5JCO A;  2OTJ F;  3IMP A;  3ELC A;  2DT4 A;  3WXM B;  4BT7 A;  3RA6 A;  1Z5V A;  4NUT A;  2CHT A;  1X7O A;  3LYB A;  5EZY A;  1X25 A;  3RA5 A;  4ZHQ A;  1VQP F;  4EI8 A;  5J2U A;  4M8I A;  5EAZ A;  4B62 A;  5HY2 A;  5EWR A;  5LA6 A;  4X1I A;  5FNV A;  4BT5 A;  4C8E A;  1K9M H;  1DT9 A;  1W5B A;  5CB4 A;  3G4S F;  4O4I A;  2CWJ A;  3J81 M;  5EZY B;  4F6R A;  2IQQ A;  3CCS F;  3IEW A;  2Q1Y A;  4ZHQ B;  1XRG A;  1VQL F;  5J2U B;  1FFX A;  3FD5 A;  3M84 A;  1XV2 A;  4I55 A;  3PLA C;  1VQK F;  4RQO A;  2HP3 A;  1YIJ F;  1VQ7 F;  5LA6 B;  4X1I B;  1SZQ A;  5FNV B;  5HY4 A;  3R0P A;  1QD9 A;  3WJR A;  3WJQ A;  3D54 A;  1JJ2 F;  5CB4 B;  3M1X A;  4O4I B;  2VAW A;  4F6R B;  5GAN K;  2HQS C;  3D01 A;  1FFX B;  2RHJ A;  3DDN A;  4I55 B;  2HRU A;  2HP0 A;  3VYS C;  5KX5 A;  2N48 A;  1XBI A;  2UZH A;  4X3L A;  5LP6 A;  5JCO C;  3FD6 A;  4G4X A;  3KHN A;  4BVS A;  3CYP B;  2HS4 A;  3CMA F;  2AIZ P;  1GX1 A;  5LXT A;  3L7Q A;  2HP0 B;  4LCK A;  1Q8R A;  1UI9 A;  5KX5 B;  3F0D A;  3E22 A;  5LP6 B;  4B46 A;  5KMG A;  3Q8H A;  3G71 F;  1RQ7 A;  1YIT F;  1JD1 A;  1KNJ A;  1Q86 H;  4B45 A;  5LXT B;  1DBF A;  1VQN F;  1NJI H;  2RB9 A;  3HKE A;  3CYQ A;  3RYI A;  3E22 B;  3MCA B;  4EI7 A;  2Z1F A;  4TUY A;  5KMG B;  2ZAU A;  1KQS F;  3CCL F;  4ZI7 A;  2VGN A;  3MQW A;  3LWO C;  3CME F;  1ZWZ A;  2B33 A;  3U0O A;  1RQ2 A;  2ZVY A;  4YJ3 A;  3HJW C;  3HKE B;  5EB1 B;  5B8F A;  3KJJ A;  3RYI B;  1M1K H;  2Z1E A;  4TUY B;  3MDO A;  2UYP A;  2QI2 A;  4ZI7 B;  5IT9 M;  5EO3 A;  1X7P A;  4U3J A;  5IYZ A;  3CB2 A;  3I55 F;  1PXW A;  4YJ3 B;  4NWO B;  3ZP7 A;  3KJK A;  2I6D A;  3JVH A;  1OFU A;  5EB0 A;  5LYJ A;  3WGM A;  2IAF A;  5CA0 A;  1ONI A;  1JFF A;  1W57 A;  3C9R A;  5G4V C;  1U3L A;  3IR9 A;  2HRY A;  2VAP A;  4U3J B;  3E20 B;  3WGK A;  1Q81 H;  5IYZ B;  3K2X A;  3HKC A;  5J2T A;  3K12 A;  1VQO F;  1H47 A;  2WAL A;  4I50 A;  1YJ9 F;  3HTN A;  4BT4 A;  5LYJ B;  3K0T A;  3GYQ A;  2G9I A;  3VO8 A;  5EIB C;  3K14 A;  1YJN F;  5CA0 B;  1JFF B;  4I4T A;  1CLI A;  2EWC A;  2OHW A;  3UT5 A;  3V3T A;  1W2B F;  3HKC B;  3JCM M;  5J2T B;  1N8R H;  3FBA A;  2Z1U A;  4I50 B;  3OBY A;  3KIZ A;  3TD3 A;  1YHQ F;  1J7H A;  1FSZ A;  4YJ2 A;  4G88 A;  2MQE A;  2QTP A;  3ON1 A;  2QA4 F;  1QVF F;  2OTM A;  1TVK A;  3F0F A;  3LME A;  3HKB A;  5FJ4 C;  3CCM F;  2ZVZ A;  4I4T B;  3S03 A;  3WGJ A;  3UT5 B;  3FFM A;  1VK3 A;  3C9S A;  4YJ2 B;  4BT2 A;  2GVI A;  3VOB A;  4BT6 A;  5MN4 A;  1QVG F;  4BY9 D;  1GO0 A;  1TVK B;  3HKB B;  4ZOL A;  3CCV F;  3C9U A;  2PMP A;  3TD4 A;  5A2Q M;  3QHD A;  5ITZ A;  2K1S A;  5HXZ A;  1XHO A;  2W8B C;  3NMU C;  1CK2 A;  1R1M A;  4ZOL B;  2VXY A;  3S0W A;  2BTU A;  3S02 A;  5HY1 A;  1VHA A;  1VQ8 F;  4X20 A;  2H6L A;  2QEX F;  3SIV A;  5ITZ B;  2UYJ A;  3EOR A;  5JQG A;  3CCE F;  2Q1X A;  4ZHV A;  3JAW A;  1K8A H;  1RLG A;  4ERH A;  2OZB A;  3WGN A;  2I6R A;  4O2A A;  1Q7Y H;  4O4J A;  5CA1 A;  3N2K A;  3M4S A;  2F9Z C;  2FC3 A;  3SIU A;  3WJP A;  5LOV A;  2KTV A;  4X20 B;  4ZHW A;  4BVR A;  3D00 A;  5JQG B;  1KD1 H;  2R6R 1;  2KGW A;  3JAW B;  3V4D A;  4O2A B;  2LCA A;  4O4J B;  5CA1 B;  3CXC F;  1COM A;  3N2K B;  2FGY A;  5LOV B;  3BYQ A;  1ODE A;  1W40 A;  5IJ0 A;  3ZOP A;  1Z5W A;  1SDS A;  4XCQ A;  4EI9 A;  5HY0 A;  1U40 A;  4G4Y A;  5HWE A;  4TV8 A;  5MN5 A;  2VGM A;  1UFY A;  2CZW A;  3C9T A;  2ALE A;  2PHN A;  5C8Y A;  1U43 A;  1CN7 A;  4BT3 A;  2CVL A;  3WGL A;  3CC4 F;  5HP8 A;  2OTL F;  2HVY D;  3F0E A;  3VCZ A;  2CHS A;  5LP6 C;  3VOA A;  3P4E A;  3WPX A;  5IJ0 B;  3WPW A;  1VH8 A;  1W58 1;  2CSL A;  3HAX D;  4EB6 A;  3ZP4 A;  3I56 F;  4TV8 B;  3I7T A;  3B6N A;  5C8Y B;  2IG8 A;  4C8G A;  3CC7 F;  1QU9 A;  4C8I A;  4BVQ A;  2GLZ A;  3CCQ F;  3P10 A;  1YJW F;  2JNB A;  3V7E A;  1W5A A;  3J80 M;  1K73 H;  5HXU A;  2H8C A;  3JAR A;  4EB6 B;  1YI2 F;  2HS3 A;  1VQM F;  2V9Y A;  1IV1 A;  2HS0 A;  3JAK A;  1FNJ A;  3JAT A;  5HP7 A;  1VQ5 F;  2ZOD A;  3MCQ A;  4LNU A;  3DC2 A;  4ZHY B;  3JAL A;  1IV4 A;  3ESJ A;  3CCJ F;  1T0A A;  4U39 A;  1PF5 A;  5GAP K;  1W5E A;  2HX0 A;  4B5C A;  4X1Y A;  1W42 A;  1H7M A;  3LDT A;  4TV9 A;  2LBT A;  4DXD A;  3JAR B;  1NQ3 A;  3JAK B;  3CPQ A;  1VQ4 F;  3JAT B;  3QUW A;  4KWE A;  4E6E A;  3I3F A;  3CCR F;  4G4V A;  4LNU B;  4X1K A;  3JAL B;  1T0K B;  4PWT A;  3GTZ A;  4HNA A;  4X1Y B;  3T80 A;  4TV9 B;  1YQN A;  5EYP A;  1KNK A;  1JY8 A;  2UYN B;  5BMV A;  3N4Y A;  3PAF A;  3TD5 A;  2UYK A;  1M90 H;  4C82 A;  4BW0 B;  4X1K B;  3NVK E;  4C81 A;  3OW2 F;  1GZ0 A;  3F0G A;  3JAS A;  4HNA B;  4IIJ A;  3CD6 F;  1W5F A;  1IV3 A;  2YYE A;  5EYP B;  2AIF A;  3P0Z A;  3RYC A;  4O4L A;  5BMV B;  4DRX A;  1OAP A;  3IEQ A;  1IV2 A;  1GO1 A;  3OBW A;  2ZOV A;  3JAS B;  3IKF A;  1W59 A;  2BTQ B;  3OON A;  4IIJ B;  3AGK A;  3LFO A;  3E1Y A;  1S72 F;  3RYF A;  2BO1 A;  3S0Y A;  3GHZ A;  3VIU A;  4O4L B;  3RYC B;  3ERN A;  3MBM A;  1X52 A;  3CC2 F;  1Q82 H;  1NMU B;  2RHL A;  3N2G A;  4DRX B;  3LWV C;  2YXZ A;  2H8E A;  5IJ9 A;  3VTI C;  2VAM A;  3HKD A;  3J7A R;  5JVD A;  3NK6 A;  4BVT A;  4NQ3 A;  3CG6 A;  3RYF B;  1SA0 A;  3S0H A;  2NMU A;  5DCV A;  3G6E F;  3N2G B;  4IHJ A;  5IJ9 B;  5GIP C;  1YGY A;  4C4W C;  5EIB D;  1VQ9 F;  3C8L A;  3HKD B;  3RYH A;  5JVD B;  2ZF8 A;  5GIN C;  4X3M A;  4WBN A;  3HWU A;  1H48 A;  3FPI A;  4O2B A;  3LWP C;  1SA0 B;  4R40 B;  1QAH A;  5AVM A;  3JAM M;  4IHJ B;  4O4H A;  2R75 1;  1W3E X;  3VYU C;  4ZK7 A;  3RYH B;  1U3P A;  2Z1T A;  4G4W A;  1IPA A;  3VMF B;  4WBN B;  1RLU A;  1FNK A;  4O2B B;  3V7Q A;  3F6M A;  3O85 A;  4FFB A;  4G4Z A;  3RE3 A;  2LBX A;  4O4H B;  5GON A;  1TUB A;  3CCU F;  2DYY A;  2L26 A; 
#chains in the Genus database with same CATH homology
 3G71 F;  1YIT F;  5A2Q M;  3CPW F;  3CPQ A;  1W41 A;  1VQ4 F;  4TZZ A;  1Q86 H;  1VQN F;  3NK7 A;  3LWQ C;  5HXZ A;  3CCR F;  5GIO C;  1NJI H;  1T0K B;  1VQ6 F;  3NMU C;  2KTU A;  1CK2 A;  3NVI B;  1RA4 A;  2KG4 A;  3MCA B;  4EI7 A;  5HY1 A;  5G4U C;  1VQ8 F;  1KQS F;  3CCL F;  5FLX M;  2QEX F;  3VI6 A;  1KC8 H;  3SIV A;  2VGN A;  3N4Y A;  3PAF A;  2LBW A;  3LWO C;  3LWR C;  1ZWZ A;  3CME F;  3CCE F;  1M90 H;  4BW0 B;  1K8A H;  3NVK E;  3N4Z A;  1RLG A;  3HJW C;  3OW2 F;  2OZB A;  1GZ0 A;  1E7K A;  1Q7Y H;  1M1K H;  3CD6 F;  2F9Z C;  2OTJ F;  2FC3 A;  3SIU A;  2KTV A;  2QI2 A;  3WXM B;  2AIF A;  3RA6 A;  4BVR A;  5IT9 M;  5EO3 A;  3D00 A;  4NUT A;  1X7P A;  1KD1 H;  3I55 F;  1X7O A;  1PXW A;  3RA5 A;  1VQP F;  4EI8 A;  1GO1 A;  2I6D A;  3OBW A;  5HY2 A;  3CXC F;  5EWR A;  2FGY A;  3AGK A;  3LFO A;  3E1Y A;  1S72 F;  1K9M H;  1DT9 A;  2BO1 A;  5G4V C;  1W40 A;  3CC2 F;  3IR9 A;  1X52 A;  1Q82 H;  1NMU B;  1Q81 H;  3E20 B;  3LWV C;  3G4S F;  3J81 M;  1SDS A;  3J7A R;  4XCQ A;  3CCS F;  4EI9 A;  5HY0 A;  5HWE A;  3NK6 A;  1VQL F;  2VGM A;  4BVT A;  1VQO F;  2WAL A;  2CZW A;  1YJ9 F;  3PLA C;  2ALE A;  1VQK F;  3GYQ A;  4NQ3 A;  1YIJ F;  1VQ7 F;  1CN7 A;  1YJN F;  3CC4 F;  3CG6 A;  5HY4 A;  2OTL F;  2HVY D;  1JJ2 F;  5DCV A;  3G6E F;  5GIP C;  4C4W C;  2OHW A;  1VQ9 F;  3V3T A;  1W2B F;  3JCM M;  1N8R H;  5GAN K;  3HAX D;  3I56 F;  5GIN C;  3OBY A;  1YHQ F;  4X3M A;  3LWP C;  3CC7 F;  3ON1 A;  2QA4 F;  1QVF F;  1XBI A;  4BVQ A;  5FJ4 C;  2GLZ A;  3CCM F;  3CCQ F;  1YJW F;  2JNB A;  3JAM M;  3V7E A;  4X3L A;  1W3E X;  3J80 M;  1K73 H;  5HXU A;  3FFM A;  1YI2 F;  1VQM F;  1IPA A;  3VMF B;  4BVS A;  1VQ5 F;  3CMA F;  3V7Q A;  4LCK A;  1QVG F;  4BY9 D;  3O85 A;  3CCJ F;  1GO0 A;  5GAP K;  3CCV F;  2LBX A;  1W42 A;  3CCU F;  1H7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...