1K8AH

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k8aH00
2QEXF 1K73H 3V7QA 1Q82H 3E20B 3ON1A 2BO1A 3CCQF 3NK7A 3OBWA 3OBYA 5GINC 5GANK 5GIPC 5FJ4C 3O85A 1GO0A 3LWRC 1N8RH 2VGMA 1SDSA 3AGKA 2KTVA 1K8AH 1YITF 3CPWF 5IT9M 1X7PA 3LWVC 1Q7YH 2JNBA 1YJWF 1VQNF 2FC3A 1VQ9F 1DT9A 1RLGA 3I55F 3CCLF 1Q86H 3FFMA 1YI2F 3N4ZA 2OZBA 1X7OA 2KTUA 3NVIB 3VI6A 1T0KB 3CG6A 3HJWC 2QA4F 1VQ6F 3HAXD 3CC7F 1JJ2F 4BY9D 5GAPK 3CC2F 3VMFB 3WXMB 1QVFF 1W42A 2OHWA 5A2QM 3SIVA 1NMUB 1E7KA 3SIUA 1W3EX 2OTLF 1Q81H 1M90H 2LBXA 3RA5A 1K9MH 1GO1A 1X52A 5G4VC 5EO3A 3CCEF 1VQMF 3NVKE 5FLXM 1PXWA 2OTJF 1H7MA 3G6EF 2AIFA 1VQOF 1M1KH 3CXCF 5EWRA 5GIOC 3LFOA 1CK2A 3V7EA 1S72F 1RA4A 1VQPF 3CC4F 4LCKA 5DCVA 1QVGF 3LWQC 3GYQA 3N4YA 1NJIH 3I56F 1XBIA 1VQLF 3PLAC 3CD6F 3IR9A 3J80M 3MCAB 2ALEA 3CPQA 3J7AR 3PAFA 2I6DA 1VQ8F 3CMAF 3E1YA 3CCRF 1YHQF 3CCSF 2HVYD 1W41A 1W2BF 1VQ7F 3CCUF 3JAMM 2LBWA 2VGNA 3OW2F 3G4SF 3LWPC 3RA6A 3G71F 3CCMF 1YJ9F 1W40A 3CCVF 1YIJF 3CCJF 1CN7A 1VQ4F 1YJNF 4TZZA 1VQKF 4X3MA 2KG4A 1KQSF 3NK6A 3CMEF 1KC8H 5G4UC 1ZWZA 2QI2A 1IPAA 1GZ0A 3NMUC 1VQ5F 4C4WC 4BW0B 4NUTA 2WALA 3J81M 3LWOC 2CZWA 1KD1H 4X3LA 3JCMM
chains in the Genus database with same CATH superfamily
5EB1B 1YQNA 5KX5A 3HWUA 2UYNA 3OBWA 4PWTA 5GINC 5GIPC 1FFXB 1GO0A 2VAPA 4ZHQA 4EB6A 1SDSA 2KTVA 4ZOLB 3ELCA 3MQWA 5CA1A 5KMGB 3HKDB 5IJ0B 5MN5A 1Q7YH 2JNBA 2CHSA 1FSZA 4YJ2B 1VQNF 2ZVZA 1RLGA 1Q86H 3M1XA 1YI2F 3N4ZA 2OZBA 2CW4A 3WPWA 3K0TA 1FFXA 1KNKA 3C9RA 3NVIB 4ZOLA 1QU9A 3CG6A 5HY4A 5KMGA 3HKDA 5IJ0A 3B6NA 3HAXD 4O4LB 4BY9D 5LOVB 3CC2F 1COMA 3WGKA 4YJ2A 1SZQA 5HP7A 3SIVA 1E7KA 3SIUA 1W3EX 3JARB 4ZI7B 4F6RB 5HWEA 2IG8A 3CYPB 3IKEA 2CWJA 1GO1A 4X1KB 4O4LA 3NVKE 5LOVA 1PXWA 1H48A 3VYSC 5FLXM 3G6EF 4TV8B 5ITZB 1TUBB 2H6LA 3CXCF 3VOAA 4ZK7A 3VTIC 4FFBB 3WGLA 5GIOC 3JARA 4ZI7A 4F6RA 2AMTA 2VXYA 3K14A 5EYPB 3LWQC 1Z5VA 3ESJA 2BTUA 1JD1A 3V4DA 1W57A 5BMVB 3C9TA 4X1KA 1H47A 2Z01A 5HP8A 2AIZP 4TV8A 5HY1A 5ITZA 1TUBA 1VQVA 4O4HB 3J80M 2ALEA 4I50A 4FFBA 2I6DA 5EAZA 3CMAF 2YYEA 5EYPA 1W41A 5EIBC 3S03A 1VQ7F 5IYZB 4BT7A 3CCUF 5BMVA 3OW2F 3WPXA 1IV4A 1ONIA 2Z1TA 1IV3A 1W40A 4O4HA 1CN7A 4RHAA 2ZOVA 4X3MA 4BVQA 2KG4A 3NK6A 2CHTA 3C9SA 1X25A 1SA0B 1ZWZA 3RE3A 5IYZA 5G4UC 5JCOA 2H8CA 3NMUC 4C4WC 2Q1YA 1FNJA 1KD1H 2CSLA 3F0EA 1W5AA 3E20B 3ON1A 1CLIA 2BO1A 3U0OA 1SA0A 2ZODA 3M4SA 3KJJA 2HS4A 1U43A 3MDOA 3N2GB 3P10A 3T80A 5IT9M 5GONB 3LWVC 3S06A 3FD5A 1DT9A 3CCLF 1W55A 3S02A 2Z1UA 1XRGA 2KTUA 4M8IA 1T0KB 3DC2A 3ZP4A 4G4YA 3HKCB 3N2GA 3KE1A 3MCQA 5GONA 1JJ2F 4I55B 2ZF8A 5A2QM 4G88A 1NMUB 4RQOA 2OTLF 3VCZA 1RQ7A 3HKCA 4U3JB 1K9MH 2HP3A 2HX0A 1X52A 2G9IA 2HS0A 4I55A 1TVKB 5AVMA 3WGJA 2AIFA 2RHJA 5EWRA 5JH7B 1CK2A 3HKEB 5HY2A 1S72F 3CC4F 4LCKA 1JN1A 2GLZA 3GYQA 4U3JA 2DT4A 1GX1A 3QHDA 2W8BC 3F6MA 1TVKA 2DYYA 3FBAA 5JH7A 3HKEA 3PAFA 1W59A 2HVYD 1KNJA 1W2BF 2YXZA 3VO8A 2R751 4C81A 1U3PA 1QD9A 2GZLA 2UYKA 4C8IA 1J7HA 2HRYA 3RA6A 1UFYA 2HS3A 2R6R1 3CCVF 1YIJF 4WBNB 4G4XA 3IEQA 1R1MA 5IJ9B 2K1SA 4HNAB 3JAWB 3WJRA 2Z1FA 2IAFA 2QI2A 3ERNA 4DXDA 4BT2A 4I4TB 1GZ0A 1XV2A 3HKBB 1VQ5F 2UYPA 4B46A 4NQ3A 4NUTA 3J81M 5EZYB 1U3LA 4DRXB 1IV1A 4X3LA 2ZVYA 1OFUA 3JCMM 4WBNA 1VQPF 1JFFB 1K73H 5FNVB 3ZP7A 1Q82H 3GTZA 5IJ9A 3BYQA 4HNAA 1Q8RA 3VOBA 3JAWA 5JCOC 2HP0B 3WGNA 5GANK 2PMPA 4G4ZA 3EORA 4I4TA 3O85A 3JATB 3CB2A 1PF5A 2VGMA 3AGKA 4DRXA 1JFFA 3CPWF 1X7PA 3D54A 1FNKA 5FNVA 2HQSC 3RYHB 4B5CA 4EI9A 2FC3A 3JASB 2HP0A 3FFMA 3LYBA 2RHHA 3S0WA 5J2TB 3JATA 3LMEA 1VH8A 4KWEA 3FPIA 3HJWC 2OTMA 2QA4F 3WJPA 1VQ6F 1QAHA 3RYIB 3CYQA 3RYHA 5LP6B 1QVFF 1W42A 3JASA 4YJ3B 1W5BA 5LYJB 2RB9A 2CVLA 2B33A 2MQEA 1Q81H 1M90H 5J2TA 3P4EA 3TD3A 5JQGB 1JY8A 5B8FA 4X1IB 2VAWA 4G4WA 3UT5B 3RYIA 3RYCB 3CCEF 5EO3A 3V3TA 5LP6A 2GVIA 1H7MA 3QUWA 2NMUA 1NQ3A 2UYJA 4O4JB 5JVDB 4YJ3A 3JAKB 1M1KH 5LYJA 1YGYA 1T0AA 5HXZA 3LFOA 5DCVA 2H8EA 2RHLA 3C9UA 5J2UB 1QVGF 1XHOA 4C8GA 5JQGA 3OONA 3D01A 3R0PA 3UT5A 3RYCA 1VQLF 3PLAC 3FD6A 1VK3A 5JVDA 3M84A 4O4JA 3JAKA 3MCAB 3J7AR 4EB6B 5J2UA 1YHQF 3CCSF 5CA0B 3HTNA 3TD5A 3JAMM 2VGNA 3L7QA 2VAMA 1W5EA 1Z5WA 5EB0A 3CCMF 1YJ9F 5C8YB 1YJNF 5LA6B 1KQSF 3VYTC 5CA0A 4EI8A 3E22B 3IMPA 3I7TA 2UZHA 3IEWA 3DDNA 2FGYA 4EI7A 3LWOC 2CZWA 3N2KB 5C8YA 2IQQA 4TUYB 2QEXF 3V7QA 2QTPA 3K12A 4BVRA 5CB4B 2P6YA 3KHNA 5LA6A 4ERHA 2EWCA 3CCQF 3NK7A 4IHJB 3OBYA 3E22A 4R40B 2LBTA 5FJ4C 3MBMA 3F0GA 3LWRC 1W581 1N8RH 4BT6A 4IIJB 3Q8HA 2N48A 3N2KA 5HXUA 1K8AH 3P0ZA 4U39A 3I3FA 4B45A 4TUYA 1YITF 3S0HA 1RQ2A 1W5FA 3ZO8A 1YJWF 3C8LA 5CB4A 1VQ9F 3I55F 3WJQA 4IHJA 2F9ZC 1X7OA 3VI6A 4O2BB 4XCQA 4I50B 2KGWA 4IIJA 4B62A 2V9YA 4X1YB 4C8EA 3CC7F 2Q1XA 5GAPK 4BVTA 3ZOPA 3VMFB 3WXMB 4E6EA 2OHWA 5HY0A 3HKBA 3GHZA 3TD4A 4TV9B 3JVHA 5EZYA 4LNUB 3RYFB 5EIBD 3KJKA 2BTOA 2LBXA 3K2XA 4O2BA 3RA5A 3S0YA 3KIZA 4X1YA 2HRUA 1OAPA 5G4VC 1VQMF 2OTJF 1VQOF 3QTYA 4BT5A 3IKFA 3WGMA 3V7EA 4TV9A 3RYFA 2Z1EA 1RA4A 4LNUA 3LDTA 4G4VA 3VIUA 4O2AB 4ZHWA 3N4YA 5LP6C 3I56F 2BTQB 4BT4A 1NJIH 3JALB 2LCAA 1XBIA 3D00A 3CD6F 3IR9A 3VYUC 3CPQA 4X20B 4C82A 1VQ8F 2L26A 1VHAA 5LXTB 3E1YA 2PHNA 4BVSA 3CCRF 4O2AA 5MN4A 1IV2A 4ZHYB 1UI9A 3JALA 5MN6A 2LBWA 2ZAUA 4O4IB 3G4SF 1RLUA 3LWPC 3G71F 3F0DA 4ZHVA 3CCJF 1ODEA 4X20A 1VQ4F 4TZZA 1VQKF 5LXTA 2I6RA 3F0FA 4X1IA 2RHOA 5KX5B 3CMEF 2UYNB 1KC8H 1IPAA 1DBFA 1U40A 4O4IA 4ZHQB 4BT3A 4NWOB 4BW0B 2WALA 5CA1B
chains in the Genus database with same CATH topology
2QEXF 1K73H 3V7QA 1Q82H 3E20B 4BVRA 3ON1A 2BO1A 3CCQF 3NK7A 3OBWA 3OBYA 5GINC 5GANK 5GIPC 5FJ4C 3O85A 1GO0A 3LWRC 1N8RH 2VGMA 1SDSA 3AGKA 2KTVA 5HXUA 1K8AH 1YITF 3CPWF 5IT9M 1X7PA 3LWVC 1Q7YH 2JNBA 4EI9A 1YJWF 1VQNF 2FC3A 1VQ9F 1DT9A 1RLGA 3I55F 3CCLF 1Q86H 3FFMA 1YI2F 3N4ZA 2F9ZC 2OZBA 1X7OA 2KTUA 3NVIB 3VI6A 4XCQA 1T0KB 3CG6A 3HJWC 5HY4A 2QA4F 1VQ6F 3HAXD 3CC7F 1JJ2F 4BY9D 5GAPK 4BVTA 3CC2F 3VMFB 3WXMB 1QVFF 1W42A 2OHWA 5HY0A 5A2QM 3SIVA 1NMUB 1E7KA 3SIUA 1W3EX 2OTLF 5HWEA 1Q81H 1M90H 2LBXA 3RA5A 1K9MH 1GO1A 1X52A 5G4VC 5EO3A 3CCEF 3V3TA 1VQMF 1PXWA 5FLXM 3NVKE 1H7MA 2OTJF 3G6EF 2AIFA 1VQOF 1M1KH 3CXCF 5EWRA 5HXZA 5GIOC 3LFOA 1CK2A 5HY2A 1S72F 1RA4A 1VQPF 3CC4F 3V7EA 4LCKA 5DCVA 1QVGF 3LWQC 2GLZA 3GYQA 3N4YA 1NJIH 3I56F 1XBIA 3D00A 1VQLF 3PLAC 3CD6F 5HY1A 3IR9A 3J80M 3MCAB 2ALEA 3CPQA 3J7AR 3PAFA 2I6DA 1VQ8F 3CMAF 3E1YA 3CCRF 4BVSA 1YHQF 3CCSF 2HVYD 1W41A 1W2BF 1VQ7F 3CCUF 3JAMM 2LBWA 2VGNA 3OW2F 3G4SF 3LWPC 3RA6A 3G71F 3CCMF 1YJ9F 1W40A 3CCVF 1YIJF 3CCJF 1CN7A 1VQ4F 1YJNF 4TZZA 1VQKF 4X3MA 4BVQA 2KG4A 1KQSF 3NK6A 3CMEF 1KC8H 5G4UC 1ZWZA 2QI2A 4EI8A 1IPAA 1GZ0A 3NMUC 1VQ5F 4C4WC 4NQ3A 4NUTA 2WALA 3J81M 2FGYA 4BW0B 4EI7A 2CZWA 3LWOC 1KD1H 4X3LA 3JCMM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX F;  1K73 H;  3V7Q A;  1Q82 H;  3E20 B;  3ON1 A;  2BO1 A;  3CCQ F;  3NK7 A;  3OBW A;  3OBY A;  5GIN C;  5GAN K;  5GIP C;  5FJ4 C;  3O85 A;  1GO0 A;  3LWR C;  1N8R H;  2VGM A;  1SDS A;  3AGK A;  2KTV A;  1K8A H;  1YIT F;  3CPW F;  5IT9 M;  1X7P A;  3LWV C;  1Q7Y H;  2JNB A;  1YJW F;  1VQN F;  2FC3 A;  1VQ9 F;  1DT9 A;  1RLG A;  3I55 F;  3CCL F;  1Q86 H;  3FFM A;  1YI2 F;  3N4Z A;  2OZB A;  1X7O A;  2KTU A;  3NVI B;  3VI6 A;  1T0K B;  3CG6 A;  3HJW C;  2QA4 F;  1VQ6 F;  3HAX D;  3CC7 F;  1JJ2 F;  4BY9 D;  5GAP K;  3CC2 F;  3VMF B;  3WXM B;  1QVF F;  1W42 A;  2OHW A;  5A2Q M;  3SIV A;  1NMU B;  1E7K A;  3SIU A;  1W3E X;  2OTL F;  1Q81 H;  1M90 H;  2LBX A;  3RA5 A;  1K9M H;  1GO1 A;  1X52 A;  5G4V C;  5EO3 A;  3CCE F;  1VQM F;  3NVK E;  5FLX M;  1PXW A;  2OTJ F;  1H7M A;  3G6E F;  2AIF A;  1VQO F;  1M1K H;  3CXC F;  5EWR A;  5GIO C;  3LFO A;  1CK2 A;  3V7E A;  1S72 F;  1RA4 A;  1VQP F;  3CC4 F;  4LCK A;  5DCV A;  1QVG F;  3LWQ C;  3GYQ A;  3N4Y A;  1NJI H;  3I56 F;  1XBI A;  1VQL F;  3PLA C;  3CD6 F;  3IR9 A;  3J80 M;  3MCA B;  2ALE A;  3CPQ A;  3J7A R;  3PAF A;  2I6D A;  1VQ8 F;  3CMA F;  3E1Y A;  3CCR F;  1YHQ F;  3CCS F;  2HVY D;  1W41 A;  1W2B F;  1VQ7 F;  3CCU F;  3JAM M;  2LBW A;  2VGN A;  3OW2 F;  3G4S F;  3LWP C;  3RA6 A;  3G71 F;  3CCM F;  1YJ9 F;  1W40 A;  3CCV F;  1YIJ F;  3CCJ F;  1CN7 A;  1VQ4 F;  1YJN F;  4TZZ A;  1VQK F;  4X3M A;  2KG4 A;  1KQS F;  3NK6 A;  3CME F;  1KC8 H;  5G4U C;  1ZWZ A;  2QI2 A;  1IPA A;  1GZ0 A;  3NMU C;  1VQ5 F;  4C4W C;  4BW0 B;  4NUT A;  2WAL A;  3J81 M;  3LWO C;  2CZW A;  1KD1 H;  4X3L A;  3JCM M; 
#chains in the Genus database with same CATH topology
 5EB1 B;  1YQN A;  5KX5 A;  3HWU A;  2UYN A;  3OBW A;  4PWT A;  5GIN C;  5GIP C;  1FFX B;  1GO0 A;  2VAP A;  4ZHQ A;  4EB6 A;  1SDS A;  2KTV A;  4ZOL B;  3ELC A;  3MQW A;  5CA1 A;  5KMG B;  3HKD B;  5IJ0 B;  5MN5 A;  1Q7Y H;  2JNB A;  2CHS A;  1FSZ A;  4YJ2 B;  1VQN F;  2ZVZ A;  1RLG A;  1Q86 H;  3M1X A;  1YI2 F;  3N4Z A;  2OZB A;  2CW4 A;  3WPW A;  3K0T A;  1FFX A;  1KNK A;  3C9R A;  3NVI B;  4ZOL A;  1QU9 A;  3CG6 A;  5HY4 A;  5KMG A;  3HKD A;  5IJ0 A;  3B6N A;  3HAX D;  4O4L B;  4BY9 D;  5LOV B;  3CC2 F;  1COM A;  3WGK A;  4YJ2 A;  1SZQ A;  5HP7 A;  3SIV A;  1E7K A;  3SIU A;  1W3E X;  3JAR B;  4ZI7 B;  4F6R B;  5HWE A;  2IG8 A;  3CYP B;  3IKE A;  2CWJ A;  1GO1 A;  4X1K B;  4O4L A;  3NVK E;  5LOV A;  1PXW A;  1H48 A;  3VYS C;  5FLX M;  3G6E F;  4TV8 B;  5ITZ B;  1TUB B;  2H6L A;  3CXC F;  3VOA A;  4ZK7 A;  3VTI C;  4FFB B;  3WGL A;  5GIO C;  3JAR A;  4ZI7 A;  4F6R A;  2AMT A;  2VXY A;  3K14 A;  5EYP B;  3LWQ C;  1Z5V A;  3ESJ A;  2BTU A;  1JD1 A;  3V4D A;  1W57 A;  5BMV B;  3C9T A;  4X1K A;  1H47 A;  2Z01 A;  5HP8 A;  2AIZ P;  4TV8 A;  5HY1 A;  5ITZ A;  1TUB A;  1VQV A;  4O4H B;  3J80 M;  2ALE A;  4I50 A;  4FFB A;  2I6D A;  5EAZ A;  3CMA F;  2YYE A;  5EYP A;  1W41 A;  5EIB C;  3S03 A;  1VQ7 F;  5IYZ B;  4BT7 A;  3CCU F;  5BMV A;  3OW2 F;  3WPX A;  1IV4 A;  1ONI A;  2Z1T A;  1IV3 A;  1W40 A;  4O4H A;  1CN7 A;  4RHA A;  2ZOV A;  4X3M A;  4BVQ A;  2KG4 A;  3NK6 A;  2CHT A;  3C9S A;  1X25 A;  1SA0 B;  1ZWZ A;  3RE3 A;  5IYZ A;  5G4U C;  5JCO A;  2H8C A;  3NMU C;  4C4W C;  2Q1Y A;  1FNJ A;  1KD1 H;  2CSL A;  3F0E A;  1W5A A;  3E20 B;  3ON1 A;  1CLI A;  2BO1 A;  3U0O A;  1SA0 A;  2ZOD A;  3M4S A;  3KJJ A;  2HS4 A;  1U43 A;  3MDO A;  3N2G B;  3P10 A;  3T80 A;  5IT9 M;  5GON B;  3LWV C;  3S06 A;  3FD5 A;  1DT9 A;  3CCL F;  1W55 A;  3S02 A;  2Z1U A;  1XRG A;  2KTU A;  4M8I A;  1T0K B;  3DC2 A;  3ZP4 A;  4G4Y A;  3HKC B;  3N2G A;  3KE1 A;  3MCQ A;  5GON A;  1JJ2 F;  4I55 B;  2ZF8 A;  5A2Q M;  4G88 A;  1NMU B;  4RQO A;  2OTL F;  3VCZ A;  1RQ7 A;  3HKC A;  4U3J B;  1K9M H;  2HP3 A;  2HX0 A;  1X52 A;  2G9I A;  2HS0 A;  4I55 A;  1TVK B;  5AVM A;  3WGJ A;  2AIF A;  2RHJ A;  5EWR A;  5JH7 B;  1CK2 A;  3HKE B;  5HY2 A;  1S72 F;  3CC4 F;  4LCK A;  1JN1 A;  2GLZ A;  3GYQ A;  4U3J A;  2DT4 A;  1GX1 A;  3QHD A;  2W8B C;  3F6M A;  1TVK A;  2DYY A;  3FBA A;  5JH7 A;  3HKE A;  3PAF A;  1W59 A;  2HVY D;  1KNJ A;  1W2B F;  2YXZ A;  3VO8 A;  2R75 1;  4C81 A;  1U3P A;  1QD9 A;  2GZL A;  2UYK A;  4C8I A;  1J7H A;  2HRY A;  3RA6 A;  1UFY A;  2HS3 A;  2R6R 1;  3CCV F;  1YIJ F;  4WBN B;  4G4X A;  3IEQ A;  1R1M A;  5IJ9 B;  2K1S A;  4HNA B;  3JAW B;  3WJR A;  2Z1F A;  2IAF A;  2QI2 A;  3ERN A;  4DXD A;  4BT2 A;  4I4T B;  1GZ0 A;  1XV2 A;  3HKB B;  1VQ5 F;  2UYP A;  4B46 A;  4NQ3 A;  4NUT A;  3J81 M;  5EZY B;  1U3L A;  4DRX B;  1IV1 A;  4X3L A;  2ZVY A;  1OFU A;  3JCM M;  4WBN A;  1VQP F;  1JFF B;  1K73 H;  5FNV B;  3ZP7 A;  1Q82 H;  3GTZ A;  5IJ9 A;  3BYQ A;  4HNA A;  1Q8R A;  3VOB A;  3JAW A;  5JCO C;  2HP0 B;  3WGN A;  5GAN K;  2PMP A;  4G4Z A;  3EOR A;  4I4T A;  3O85 A;  3JAT B;  3CB2 A;  1PF5 A;  2VGM A;  3AGK A;  4DRX A;  1JFF A;  3CPW F;  1X7P A;  3D54 A;  1FNK A;  5FNV A;  2HQS C;  3RYH B;  4B5C A;  4EI9 A;  2FC3 A;  3JAS B;  2HP0 A;  3FFM A;  3LYB A;  2RHH A;  3S0W A;  5J2T B;  3JAT A;  3LME A;  1VH8 A;  4KWE A;  3FPI A;  3HJW C;  2OTM A;  2QA4 F;  3WJP A;  1VQ6 F;  1QAH A;  3RYI B;  3CYQ A;  3RYH A;  5LP6 B;  1QVF F;  1W42 A;  3JAS A;  4YJ3 B;  1W5B A;  5LYJ B;  2RB9 A;  2CVL A;  2B33 A;  2MQE A;  1Q81 H;  1M90 H;  5J2T A;  3P4E A;  3TD3 A;  5JQG B;  1JY8 A;  5B8F A;  4X1I B;  2VAW A;  4G4W A;  3UT5 B;  3RYI A;  3RYC B;  3CCE F;  5EO3 A;  3V3T A;  5LP6 A;  2GVI A;  1H7M A;  3QUW A;  2NMU A;  1NQ3 A;  2UYJ A;  4O4J B;  5JVD B;  4YJ3 A;  3JAK B;  1M1K H;  5LYJ A;  1YGY A;  1T0A A;  5HXZ A;  3LFO A;  5DCV A;  2H8E A;  2RHL A;  3C9U A;  5J2U B;  1QVG F;  1XHO A;  4C8G A;  5JQG A;  3OON A;  3D01 A;  3R0P A;  3UT5 A;  3RYC A;  1VQL F;  3PLA C;  3FD6 A;  1VK3 A;  5JVD A;  3M84 A;  4O4J A;  3JAK A;  3MCA B;  3J7A R;  4EB6 B;  5J2U A;  1YHQ F;  3CCS F;  5CA0 B;  3HTN A;  3TD5 A;  3JAM M;  2VGN A;  3L7Q A;  2VAM A;  1W5E A;  1Z5W A;  5EB0 A;  3CCM F;  1YJ9 F;  5C8Y B;  1YJN F;  5LA6 B;  1KQS F;  3VYT C;  5CA0 A;  4EI8 A;  3E22 B;  3IMP A;  3I7T A;  2UZH A;  3IEW A;  3DDN A;  2FGY A;  4EI7 A;  3LWO C;  2CZW A;  3N2K B;  5C8Y A;  2IQQ A;  4TUY B;  2QEX F;  3V7Q A;  2QTP A;  3K12 A;  4BVR A;  5CB4 B;  2P6Y A;  3KHN A;  5LA6 A;  4ERH A;  2EWC A;  3CCQ F;  3NK7 A;  4IHJ B;  3OBY A;  3E22 A;  4R40 B;  2LBT A;  5FJ4 C;  3MBM A;  3F0G A;  3LWR C;  1W58 1;  1N8R H;  4BT6 A;  4IIJ B;  3Q8H A;  2N48 A;  3N2K A;  5HXU A;  1K8A H;  3P0Z A;  4U39 A;  3I3F A;  4B45 A;  4TUY A;  1YIT F;  3S0H A;  1RQ2 A;  1W5F A;  3ZO8 A;  1YJW F;  3C8L A;  5CB4 A;  1VQ9 F;  3I55 F;  3WJQ A;  4IHJ A;  2F9Z C;  1X7O A;  3VI6 A;  4O2B B;  4XCQ A;  4I50 B;  2KGW A;  4IIJ A;  4B62 A;  2V9Y A;  4X1Y B;  4C8E A;  3CC7 F;  2Q1X A;  5GAP K;  4BVT A;  3ZOP A;  3VMF B;  3WXM B;  4E6E A;  2OHW A;  5HY0 A;  3HKB A;  3GHZ A;  3TD4 A;  4TV9 B;  3JVH A;  5EZY A;  4LNU B;  3RYF B;  5EIB D;  3KJK A;  2BTO A;  2LBX A;  3K2X A;  4O2B A;  3RA5 A;  3S0Y A;  3KIZ A;  4X1Y A;  2HRU A;  1OAP A;  5G4V C;  1VQM F;  2OTJ F;  1VQO F;  3QTY A;  4BT5 A;  3IKF A;  3WGM A;  3V7E A;  4TV9 A;  3RYF A;  2Z1E A;  1RA4 A;  4LNU A;  3LDT A;  4G4V A;  3VIU A;  4O2A B;  4ZHW A;  3N4Y A;  5LP6 C;  3I56 F;  2BTQ B;  4BT4 A;  1NJI H;  3JAL B;  2LCA A;  1XBI A;  3D00 A;  3CD6 F;  3IR9 A;  3VYU C;  3CPQ A;  4X20 B;  4C82 A;  1VQ8 F;  2L26 A;  1VHA A;  5LXT B;  3E1Y A;  2PHN A;  4BVS A;  3CCR F;  4O2A A;  5MN4 A;  1IV2 A;  4ZHY B;  1UI9 A;  3JAL A;  5MN6 A;  2LBW A;  2ZAU A;  4O4I B;  3G4S F;  1RLU A;  3LWP C;  3G71 F;  3F0D A;  4ZHV A;  3CCJ F;  1ODE A;  4X20 A;  1VQ4 F;  4TZZ A;  1VQK F;  5LXT A;  2I6R A;  3F0F A;  4X1I A;  2RHO A;  5KX5 B;  3CME F;  2UYN B;  1KC8 H;  1IPA A;  1DBF A;  1U40 A;  4O4I A;  4ZHQ B;  4BT3 A;  4NWO B;  4BW0 B;  2WAL A;  5CA1 B; 
#chains in the Genus database with same CATH homology
 2QEX F;  1K73 H;  3V7Q A;  1Q82 H;  3E20 B;  4BVR A;  3ON1 A;  2BO1 A;  3CCQ F;  3NK7 A;  3OBW A;  3OBY A;  5GIN C;  5GAN K;  5GIP C;  5FJ4 C;  3O85 A;  1GO0 A;  3LWR C;  1N8R H;  2VGM A;  1SDS A;  3AGK A;  2KTV A;  5HXU A;  1K8A H;  1YIT F;  3CPW F;  5IT9 M;  1X7P A;  3LWV C;  1Q7Y H;  2JNB A;  4EI9 A;  1YJW F;  1VQN F;  2FC3 A;  1VQ9 F;  1DT9 A;  1RLG A;  3I55 F;  3CCL F;  1Q86 H;  3FFM A;  1YI2 F;  3N4Z A;  2F9Z C;  2OZB A;  1X7O A;  2KTU A;  3NVI B;  3VI6 A;  4XCQ A;  1T0K B;  3CG6 A;  3HJW C;  5HY4 A;  2QA4 F;  1VQ6 F;  3HAX D;  3CC7 F;  1JJ2 F;  4BY9 D;  5GAP K;  4BVT A;  3CC2 F;  3VMF B;  3WXM B;  1QVF F;  1W42 A;  2OHW A;  5HY0 A;  5A2Q M;  3SIV A;  1NMU B;  1E7K A;  3SIU A;  1W3E X;  2OTL F;  5HWE A;  1Q81 H;  1M90 H;  2LBX A;  3RA5 A;  1K9M H;  1GO1 A;  1X52 A;  5G4V C;  5EO3 A;  3CCE F;  3V3T A;  1VQM F;  1PXW A;  5FLX M;  3NVK E;  1H7M A;  2OTJ F;  3G6E F;  2AIF A;  1VQO F;  1M1K H;  3CXC F;  5EWR A;  5HXZ A;  5GIO C;  3LFO A;  1CK2 A;  5HY2 A;  1S72 F;  1RA4 A;  1VQP F;  3CC4 F;  3V7E A;  4LCK A;  5DCV A;  1QVG F;  3LWQ C;  2GLZ A;  3GYQ A;  3N4Y A;  1NJI H;  3I56 F;  1XBI A;  3D00 A;  1VQL F;  3PLA C;  3CD6 F;  5HY1 A;  3IR9 A;  3J80 M;  3MCA B;  2ALE A;  3CPQ A;  3J7A R;  3PAF A;  2I6D A;  1VQ8 F;  3CMA F;  3E1Y A;  3CCR F;  4BVS A;  1YHQ F;  3CCS F;  2HVY D;  1W41 A;  1W2B F;  1VQ7 F;  3CCU F;  3JAM M;  2LBW A;  2VGN A;  3OW2 F;  3G4S F;  3LWP C;  3RA6 A;  3G71 F;  3CCM F;  1YJ9 F;  1W40 A;  3CCV F;  1YIJ F;  3CCJ F;  1CN7 A;  1VQ4 F;  1YJN F;  4TZZ A;  1VQK F;  4X3M A;  4BVQ A;  2KG4 A;  1KQS F;  3NK6 A;  3CME F;  1KC8 H;  5G4U C;  1ZWZ A;  2QI2 A;  4EI8 A;  1IPA A;  1GZ0 A;  3NMU C;  1VQ5 F;  4C4W C;  4NQ3 A;  4NUT A;  2WAL A;  3J81 M;  2FGY A;  4BW0 B;  4EI7 A;  2CZW A;  3LWO C;  1KD1 H;  4X3L A;  3JCM M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...