1VQ6F

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq6F00
1W2BF 4NUTA 2HVYD 3CC4F 3N4ZA 2LBWA 2FC3A 5DCVA 1N8RH 3IR9A 2ALEA 3I55F 1CN7A 3LFOA 2OTLF 4TZZA 3J7AR 1VQ9F 3VMFB 3V7EA 3G4SF 3LWQC 1VQLF 2QEXF 3CCJF 1RA4A 1Q86H 3HAXD 3CCEF 2OTJF 3CXCF 3HJWC 3J80M 1QVFF 3LWVC 1VQ6F 5GANK 2KG4A 3CCMF 5FJ4C 1NMUB 1GZ0A 1W3EX 1S72F 1RLGA 3SIUA 1YITF 3AGKA 1X52A 5G4VC 3CD6F 4LCKA 3J81M 1VQ4F 3LWRC 3E20B 3OBWA 3CPWF 5GAPK 3WXMB 1Q81H 2BO1A 1PXWA 3G6EF 2CZWA 5A2QM 3CC2F 1DT9A 1SDSA 4BY9D 3CCSF 1QVGF 1VQMF 1M90H 3E1YA 4X3MA 1YHQF 1YJWF 1XBIA 1VQ7F 3NVIB 1GO1A 3SIVA 3NK6A 3GYQA 3RA5A 1ZWZA 3OBYA 2LBXA 3CCLF 2VGMA 3PLAC 3I56F 3CG6A 3RA6A 5GINC 1VQ5F 3NMUC 3CPQA 2I6DA 2OHWA 1K8AH 2JNBA 1JJ2F 2OZBA 3LWOC 2QI2A 3O85A 5GIPC 3JAMM 3MCAB 1YI2F 3CCUF 1VQNF 3CMAF 1W40A 3JCMM 1NJIH 5EWRA 3CCRF 1GO0A 1YJ9F 1KD1H 1IPAA 4X3LA 1KQSF 1H7MA 3N4YA 3LWPC 1E7KA 1T0KB 4C4WC 1X7PA 3CCVF 2AIFA 4BW0B 5IT9M 2KTVA 3PAFA 3CCQF 1Q7YH 2VGNA 2KTUA 5GIOC 1W41A 3G71F 5G4UC 2QA4F 2WALA 1W42A 3OW2F 1VQPF 3NK7A 5EO3A 1K9MH 3V7QA 3CMEF 1X7OA 1YIJF 1Q82H 1KC8H 1VQ8F 1K73H 5FLXM 3NVKE 1YJNF 1CK2A 3ON1A 1VQKF 1VQOF 3FFMA 3VI6A 3CC7F 1M1KH
chains in the Genus database with same CATH superfamily
1JY8A 4TV9B 3IEWA 4ZI7B 4O2AA 4O4HB 1QU9A 2UYNA 2RHHA 3IR9A 4X20B 3DC2A 5ITZB 2FGYA 4R40B 1COMA 3LFOA 5CA0B 4BT5A 5HXUA 2H6LA 3ZP7A 2HS0A 2IQQA 3S06A 3CXCF 3HJWC 4BT2A 4EI9A 3VYTC 5CB4A 2DYYA 1VQ6F 2GZLA 2Z1TA 3CCMF 5FJ4C 1S72F 4C8GA 4YJ2A 3D00A 1ONIA 3J81M 3CYPB 3WGMA 3CPWF 3JALA 4BVTA 3WGJA 3GTZA 2CZWA 2Q1YA 3JARA 5HY2A 1TUBB 2V9YA 1KNJA 1SDSA 1W5EA 3D54A 3CCSF 5BMVA 2VAPA 1R1MA 3JAWB 3RYCB 2N48A 3NVIB 1GO1A 1JN1A 3RA5A 1DBFA 1ODEA 1RLUA 1TVKB 1FNJA 2HP0A 1VHAA 4HNAA 5B8FA 5EYPA 3D01A 3CG6A 4I4TA 3I56F 1VQ5F 3FBAA 2ZVZA 4XCQA 1GX1A 2OZBA 3F0GA 2QI2A 4BT7A 1IV3A 2CHTA 5GIPC 4X1KB 4IHJA 1VQNF 4YJ3B 4BVRA 2YXZA 1VQVA 5JVDA 4X1YB 2DT4A 2MQEA 1VH8A 1XV2A 4O4JB 3UT5A 2HRUA 5LYJB 3WJQA 4DRXA 5AVMA 5EZYB 2HQSC 4BW0B 3RE3A 5IJ9A 3HKDA 2H8EA 4I55A 3VTIC 4M8IA 4RQOA 3HWUA 1W41A 3IEQA 4ZHYB 2QA4F 1SA0B 3EORA 2PMPA 4WBNA 5CB4B 3WGKA 1K9MH 3CMEF 2AMTA 1YIJF 3MBMA 2I6RA 4YJ2B 3ON1A 2IG8A 3F6MA 3TD4A 3WPWA 3CC7F 1W2BF 4NUTA 4O2BB 4B46A 2Z01A 5GONA 2BTQB 5LP6B 2FC3A 4ZHWA 1N8RH 3MCQA 5DCVA 4TV8B 1H47A 3C9RA 3JASA 2HP3A 3LMEA 5BMVB 3I7TA 3F0DA 4ZK7A 4X1IA 4IIJA 3GHZA 5KMGB 1UI9A 4EI7A 3V7EA 3G4SF 3KJJA 3TD3A 2QEXF 3CCEF 3IKEA 3QTYA 2HP0B 5JQGA 3J80M 3MQWA 5GANK 4B5CA 4B62A 5EYPB 4I4TB 5LXTA 5KX5A 2UYPA 3WGLA 3AGKA 1W59A 5G4VC 1W5AA 5MN4A 1VQ4F 4KWEA 5HY1A 5JCOA 3P4EA 3WXMB 1IV2A 1Q81H 3Q8HA 5JVDB 2VAMA 5IYZB 2CHSA 3P0ZA 1M90H 4C81A 1VQ7F 2AIZP 3ELCA 4DRXB 2ZF8A 3VYSC 3HKEA 3CCLF 3KHNA 3HKDB 3CB2A 3ZP4A 3JAKB 4I55B 2ZODA 2I6DA 2PHNA 2OHWA 4O4IA 2HRYA 3RYFA 5JH7A 2F9ZC 3LWOC 5LA6B 4BVQA 4WBNB 1UFYA 3VOBA 3S0HA 3JCMM 3S0WA 4C82A 2CSLA 3ESJA 2K1SA 3CCRF 3M1XA 1JFFA 3ERNA 3LDTA 1YJ9F 3E22A 4ERHA 1IPAA 4X3LA 3N4YA 3HKBA 1X7PA 2ZVYA 3IKFA 5FNVA 3JASB 4NQ3A 3BYQA 3C9TA 4G4WA 4X1IB 4IIJB 4TUYA 5HY4A 3R0PA 1Q7YH 5LOVA 2VGNA 2BTOA 2R6R1 3RYHB 1W42A 4BT4A 3NK7A 3LYBA 4C8EA 1IV4A 5C8YA 1K73H 5LXTB 1JD1A 5KX5B 1CK2A 5CA1A 3RYIA 5EB1B 2P6YA 4O2AB 2Z1FA 5JCOC 1T0AA 4F6RA 1J7HA 2HVYD 2UYNB 3S0YA 5HP8A 3CC4F 3N4ZA 2QTPA 4G88A 5MN6A 3WJRA 2ALEA 1CN7A 4X20A 2RHJA 1RQ7A 3J7AR 1XRGA 3VMFB 1IV1A 5CA0A 3WJPA 3LWQC 4G4VA 3L7QA 3HKEB 1Q86H 3T80A 5IJ0A 3HAXD 3LWVC 1GZ0A 1W3EX 2HS4A 3SIUA 1YITF 3JALB 5JH7B 3CD6F 4LCKA 4U3JA 2Q1XA 1FFXA 3K14A 3OBWA 4O4LA 2GVIA 3JARB 5GAPK 2RHLA 1W57A 4U39A 5A2QM 3CC2F 1VK3A 3MDOA 4LNUA 1H48A 4ZOLA 4DXDA 4BY9D 1VQMF 1TUBA 1Z5VA 3QHDA 2UZHA 1XBIA 3E22B 2CWJA 3F0FA 3SIVA 3JAWA 2CVLA 3HKBB 3KJKA 1ZWZA 3OBYA 2LBXA 4HNAB 5FNVB 2VGMA 3N2GA 1TVKA 4RHAA 3B6NA 3PLAC 3C8LA 4TUYB 3RA6A 5GINC 3M84A 5LOVB 2JNBA 1K8AH 5J2TA 2ZAUA 4G4YA 3VCZA 3O85A 4IHJB 3F0EA 5C8YB 1YI2F 4ZHQA 3CCUF 2B33A 3VIUA 3DDNA 3M4SA 3CMAF 3UT5B 4X1KA 5EB0A 5CA1B 2IAFA 4YJ3A 5EWRA 3RYIB 5EIBC 2OTMA 4E6EA 4G4XA 1H7MA 3LWPC 4F6RB 4B45A 1KQSF 4C4WC 3C9SA 2YYEA 3CCVF 5IJ9B 3C9UA 4EB6A 5EZYA 1XHOA 3FD6A 2KTVA 2UYJA 3CCQF 5HWEA 4NWOB 1W5BA 5G4UC 3G71F 5IJ0B 3ZO8A 5EO3A 2LBTA 1FNKA 4BVSA 3V7QA 1SA0A 1VQ8F 3K2XA 5FLXM 4FFBA 2HX0A 3JATA 1PF5A 1VQKF 4U3JB 1VQOF 3FFMA 1YQNA 4I50A 2RB9A 1FFXB 1M1KH 5GONB 4O4LB 2KGWA 1QD9A 2NMUA 3KE1A 4O2BA 5HXZA 5J2UA 2BTUA 2LBWA 4LNUB 4ZOLB 5LP6A 3I55F 3FPIA 5EIBD 2OTLF 4TV8A 2EWCA 4TZZA 1VQ9F 1QAHA 1VQLF 3QUWA 5JQGB 5KMGA 3K12A 3S02A 3CCJF 1RA4A 2OTJF 1QVFF 3N2GB 5HP7A 2KG4A 1NMUB 2HS3A 3WPXA 1RLGA 3HKCA 5J2TB 1X52A 3LWRC 3E20B 3N2KA 2H8CA 1NQ3A 3U0OA 4TV9A 2BO1A 1PXWA 4ZHQB 3G6EF 3VO8A 4ZI7A 4O4HA 1U43A 1DT9A 3FD5A 5ITZA 1FSZA 1QVGF 3E1YA 5MN5A 5IYZA 4X3MA 1YHQF 1YJWF 3I3FA 3NK6A 3GYQA 1SZQA 2CW4A 3OONA 3V4DA 1U40A 4BT6A 4EB6B 2VXYA 1Q8RA 1Z5WA 4O4IB 3KIZA 3VOAA 3RYFB 3NMUC 3CPQA 4EI8A 3JAKA 3TD5A 1JJ2F 1X25A 3P10A 2W8BC 3JAMM 5EAZA 1OFUA 5LA6A 3MCAB 4G4ZA 1W5FA 1KNKA 4FFBB 1W40A 4C8IA 5HY0A 3V3TA 1JFFB 2L26A 3JATB 1NJIH 3RYCA 4I50B 3WGNA 1GO0A 3CYQA 1KD1H 1E7KA 4BT3A 1T0KB 2LCAA 3S03A 2VAWA 5J2UB 1U3LA 2AIFA 2UYKA 3VYUC 3HTNA 5LP6C 5IT9M 2Z1EA 4ZHVA 3PAFA 1YGYA 2Z1UA 1OAPA 2ZOVA 2KTUA 5GIOC 1CLIA 1U3PA 3ZOPA 2WALA 3OW2F 1VQPF 2GLZA 4PWTA 3RYHA 1X7OA 1Q82H 1KC8H 1W55A 2RHOA 3NVKE 1YJNF 2R751 4X1YA 1W581 2G9IA 3HKCB 1RQ2A 3K0TA 4O4JA 3IMPA 3VI6A 3N2KB 3JVHA 5LYJA
chains in the Genus database with same CATH topology
1W2BF 4NUTA 2HVYD 3CC4F 5HXZA 3N4ZA 2LBWA 2FC3A 5DCVA 1N8RH 3IR9A 2FGYA 2ALEA 3I55F 1CN7A 3LFOA 2OTLF 5HXUA 4TZZA 3J7AR 1VQ9F 3VMFB 4EI7A 3V7EA 3G4SF 3LWQC 1VQLF 2QEXF 3CCJF 1RA4A 1Q86H 3HAXD 3CCEF 2OTJF 3CXCF 3HJWC 3J80M 4EI9A 3LWVC 1QVFF 1VQ6F 5GANK 2KG4A 3CCMF 5FJ4C 1NMUB 1GZ0A 1W3EX 1S72F 1RLGA 3SIUA 1YITF 3AGKA 1X52A 5G4VC 3CD6F 4LCKA 3D00A 3J81M 1VQ4F 3LWRC 3E20B 3OBWA 3CPWF 4BVTA 5HY1A 5GAPK 3WXMB 1Q81H 2BO1A 1PXWA 3G6EF 5HY2A 2CZWA 5A2QM 3CC2F 1DT9A 1SDSA 4BY9D 3CCSF 1QVGF 1VQMF 1M90H 3E1YA 4X3MA 1YHQF 1YJWF 1XBIA 1VQ7F 3NVIB 1GO1A 3SIVA 3NK6A 3GYQA 3RA5A 1ZWZA 3OBYA 2LBXA 3CCLF 2VGMA 3PLAC 3I56F 3CG6A 3RA6A 5GINC 1VQ5F 3NMUC 3CPQA 2I6DA 2OHWA 4EI8A 1K8AH 2JNBA 4XCQA 1JJ2F 2OZBA 2F9ZC 3LWOC 2QI2A 4BVQA 3O85A 5GIPC 3JAMM 3MCAB 1YI2F 3CCUF 1VQNF 4BVRA 5HY0A 3CMAF 1W40A 3JCMM 3V3TA 1NJIH 5EWRA 3CCRF 1GO0A 1YJ9F 1KD1H 1IPAA 4X3LA 1KQSF 1H7MA 3N4YA 3LWPC 1E7KA 1T0KB 4C4WC 1X7PA 3CCVF 2AIFA 4BW0B 4NQ3A 5IT9M 5HY4A 2KTVA 3PAFA 3CCQF 5HWEA 1Q7YH 2VGNA 2KTUA 5GIOC 1W41A 3G71F 5G4UC 2QA4F 2WALA 1W42A 3OW2F 1VQPF 3NK7A 2GLZA 5EO3A 4BVSA 1K9MH 3V7QA 3CMEF 1X7OA 1YIJF 1Q82H 1KC8H 1VQ8F 1K73H 5FLXM 3NVKE 1YJNF 1CK2A 3ON1A 1VQKF 1VQOF 3FFMA 3VI6A 3CC7F 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B F;  4NUT A;  2HVY D;  3CC4 F;  3N4Z A;  2LBW A;  2FC3 A;  5DCV A;  1N8R H;  3IR9 A;  2ALE A;  3I55 F;  1CN7 A;  3LFO A;  2OTL F;  4TZZ A;  3J7A R;  1VQ9 F;  3VMF B;  3V7E A;  3G4S F;  3LWQ C;  1VQL F;  2QEX F;  3CCJ F;  1RA4 A;  1Q86 H;  3HAX D;  3CCE F;  2OTJ F;  3CXC F;  3HJW C;  3J80 M;  1QVF F;  3LWV C;  1VQ6 F;  5GAN K;  2KG4 A;  3CCM F;  5FJ4 C;  1NMU B;  1GZ0 A;  1W3E X;  1S72 F;  1RLG A;  3SIU A;  1YIT F;  3AGK A;  1X52 A;  5G4V C;  3CD6 F;  4LCK A;  3J81 M;  1VQ4 F;  3LWR C;  3E20 B;  3OBW A;  3CPW F;  5GAP K;  3WXM B;  1Q81 H;  2BO1 A;  1PXW A;  3G6E F;  2CZW A;  5A2Q M;  3CC2 F;  1DT9 A;  1SDS A;  4BY9 D;  3CCS F;  1QVG F;  1VQM F;  1M90 H;  3E1Y A;  4X3M A;  1YHQ F;  1YJW F;  1XBI A;  1VQ7 F;  3NVI B;  1GO1 A;  3SIV A;  3NK6 A;  3GYQ A;  3RA5 A;  1ZWZ A;  3OBY A;  2LBX A;  3CCL F;  2VGM A;  3PLA C;  3I56 F;  3CG6 A;  3RA6 A;  5GIN C;  1VQ5 F;  3NMU C;  3CPQ A;  2I6D A;  2OHW A;  1K8A H;  2JNB A;  1JJ2 F;  2OZB A;  3LWO C;  2QI2 A;  3O85 A;  5GIP C;  3JAM M;  3MCA B;  1YI2 F;  3CCU F;  1VQN F;  3CMA F;  1W40 A;  3JCM M;  1NJI H;  5EWR A;  3CCR F;  1GO0 A;  1YJ9 F;  1KD1 H;  1IPA A;  4X3L A;  1KQS F;  1H7M A;  3N4Y A;  3LWP C;  1E7K A;  1T0K B;  4C4W C;  1X7P A;  3CCV F;  2AIF A;  4BW0 B;  5IT9 M;  2KTV A;  3PAF A;  3CCQ F;  1Q7Y H;  2VGN A;  2KTU A;  5GIO C;  1W41 A;  3G71 F;  5G4U C;  2QA4 F;  2WAL A;  1W42 A;  3OW2 F;  1VQP F;  3NK7 A;  5EO3 A;  1K9M H;  3V7Q A;  3CME F;  1X7O A;  1YIJ F;  1Q82 H;  1KC8 H;  1VQ8 F;  1K73 H;  5FLX M;  3NVK E;  1YJN F;  1CK2 A;  3ON1 A;  1VQK F;  1VQO F;  3FFM A;  3VI6 A;  3CC7 F;  1M1K H; 
#chains in the Genus database with same CATH topology
 1JY8 A;  4TV9 B;  3IEW A;  4ZI7 B;  4O2A A;  4O4H B;  1QU9 A;  2UYN A;  2RHH A;  3IR9 A;  4X20 B;  3DC2 A;  5ITZ B;  2FGY A;  4R40 B;  1COM A;  3LFO A;  5CA0 B;  4BT5 A;  5HXU A;  2H6L A;  3ZP7 A;  2HS0 A;  2IQQ A;  3S06 A;  3CXC F;  3HJW C;  4BT2 A;  4EI9 A;  3VYT C;  5CB4 A;  2DYY A;  1VQ6 F;  2GZL A;  2Z1T A;  3CCM F;  5FJ4 C;  1S72 F;  4C8G A;  4YJ2 A;  3D00 A;  1ONI A;  3J81 M;  3CYP B;  3WGM A;  3CPW F;  3JAL A;  4BVT A;  3WGJ A;  3GTZ A;  2CZW A;  2Q1Y A;  3JAR A;  5HY2 A;  1TUB B;  2V9Y A;  1KNJ A;  1SDS A;  1W5E A;  3D54 A;  3CCS F;  5BMV A;  2VAP A;  1R1M A;  3JAW B;  3RYC B;  2N48 A;  3NVI B;  1GO1 A;  1JN1 A;  3RA5 A;  1DBF A;  1ODE A;  1RLU A;  1TVK B;  1FNJ A;  2HP0 A;  1VHA A;  4HNA A;  5B8F A;  5EYP A;  3D01 A;  3CG6 A;  4I4T A;  3I56 F;  1VQ5 F;  3FBA A;  2ZVZ A;  4XCQ A;  1GX1 A;  2OZB A;  3F0G A;  2QI2 A;  4BT7 A;  1IV3 A;  2CHT A;  5GIP C;  4X1K B;  4IHJ A;  1VQN F;  4YJ3 B;  4BVR A;  2YXZ A;  1VQV A;  5JVD A;  4X1Y B;  2DT4 A;  2MQE A;  1VH8 A;  1XV2 A;  4O4J B;  3UT5 A;  2HRU A;  5LYJ B;  3WJQ A;  4DRX A;  5AVM A;  5EZY B;  2HQS C;  4BW0 B;  3RE3 A;  5IJ9 A;  3HKD A;  2H8E A;  4I55 A;  3VTI C;  4M8I A;  4RQO A;  3HWU A;  1W41 A;  3IEQ A;  4ZHY B;  2QA4 F;  1SA0 B;  3EOR A;  2PMP A;  4WBN A;  5CB4 B;  3WGK A;  1K9M H;  3CME F;  2AMT A;  1YIJ F;  3MBM A;  2I6R A;  4YJ2 B;  3ON1 A;  2IG8 A;  3F6M A;  3TD4 A;  3WPW A;  3CC7 F;  1W2B F;  4NUT A;  4O2B B;  4B46 A;  2Z01 A;  5GON A;  2BTQ B;  5LP6 B;  2FC3 A;  4ZHW A;  1N8R H;  3MCQ A;  5DCV A;  4TV8 B;  1H47 A;  3C9R A;  3JAS A;  2HP3 A;  3LME A;  5BMV B;  3I7T A;  3F0D A;  4ZK7 A;  4X1I A;  4IIJ A;  3GHZ A;  5KMG B;  1UI9 A;  4EI7 A;  3V7E A;  3G4S F;  3KJJ A;  3TD3 A;  2QEX F;  3CCE F;  3IKE A;  3QTY A;  2HP0 B;  5JQG A;  3J80 M;  3MQW A;  5GAN K;  4B5C A;  4B62 A;  5EYP B;  4I4T B;  5LXT A;  5KX5 A;  2UYP A;  3WGL A;  3AGK A;  1W59 A;  5G4V C;  1W5A A;  5MN4 A;  1VQ4 F;  4KWE A;  5HY1 A;  5JCO A;  3P4E A;  3WXM B;  1IV2 A;  1Q81 H;  3Q8H A;  5JVD B;  2VAM A;  5IYZ B;  2CHS A;  3P0Z A;  1M90 H;  4C81 A;  1VQ7 F;  2AIZ P;  3ELC A;  4DRX B;  2ZF8 A;  3VYS C;  3HKE A;  3CCL F;  3KHN A;  3HKD B;  3CB2 A;  3ZP4 A;  3JAK B;  4I55 B;  2ZOD A;  2I6D A;  2PHN A;  2OHW A;  4O4I A;  2HRY A;  3RYF A;  5JH7 A;  2F9Z C;  3LWO C;  5LA6 B;  4BVQ A;  4WBN B;  1UFY A;  3VOB A;  3S0H A;  3JCM M;  3S0W A;  4C82 A;  2CSL A;  3ESJ A;  2K1S A;  3CCR F;  3M1X A;  1JFF A;  3ERN A;  3LDT A;  1YJ9 F;  3E22 A;  4ERH A;  1IPA A;  4X3L A;  3N4Y A;  3HKB A;  1X7P A;  2ZVY A;  3IKF A;  5FNV A;  3JAS B;  4NQ3 A;  3BYQ A;  3C9T A;  4G4W A;  4X1I B;  4IIJ B;  4TUY A;  5HY4 A;  3R0P A;  1Q7Y H;  5LOV A;  2VGN A;  2BTO A;  2R6R 1;  3RYH B;  1W42 A;  4BT4 A;  3NK7 A;  3LYB A;  4C8E A;  1IV4 A;  5C8Y A;  1K73 H;  5LXT B;  1JD1 A;  5KX5 B;  1CK2 A;  5CA1 A;  3RYI A;  5EB1 B;  2P6Y A;  4O2A B;  2Z1F A;  5JCO C;  1T0A A;  4F6R A;  1J7H A;  2HVY D;  2UYN B;  3S0Y A;  5HP8 A;  3CC4 F;  3N4Z A;  2QTP A;  4G88 A;  5MN6 A;  3WJR A;  2ALE A;  1CN7 A;  4X20 A;  2RHJ A;  1RQ7 A;  3J7A R;  1XRG A;  3VMF B;  1IV1 A;  5CA0 A;  3WJP A;  3LWQ C;  4G4V A;  3L7Q A;  3HKE B;  1Q86 H;  3T80 A;  5IJ0 A;  3HAX D;  3LWV C;  1GZ0 A;  1W3E X;  2HS4 A;  3SIU A;  1YIT F;  3JAL B;  5JH7 B;  3CD6 F;  4LCK A;  4U3J A;  2Q1X A;  1FFX A;  3K14 A;  3OBW A;  4O4L A;  2GVI A;  3JAR B;  5GAP K;  2RHL A;  1W57 A;  4U39 A;  5A2Q M;  3CC2 F;  1VK3 A;  3MDO A;  4LNU A;  1H48 A;  4ZOL A;  4DXD A;  4BY9 D;  1VQM F;  1TUB A;  1Z5V A;  3QHD A;  2UZH A;  1XBI A;  3E22 B;  2CWJ A;  3F0F A;  3SIV A;  3JAW A;  2CVL A;  3HKB B;  3KJK A;  1ZWZ A;  3OBY A;  2LBX A;  4HNA B;  5FNV B;  2VGM A;  3N2G A;  1TVK A;  4RHA A;  3B6N A;  3PLA C;  3C8L A;  4TUY B;  3RA6 A;  5GIN C;  3M84 A;  5LOV B;  2JNB A;  1K8A H;  5J2T A;  2ZAU A;  4G4Y A;  3VCZ A;  3O85 A;  4IHJ B;  3F0E A;  5C8Y B;  1YI2 F;  4ZHQ A;  3CCU F;  2B33 A;  3VIU A;  3DDN A;  3M4S A;  3CMA F;  3UT5 B;  4X1K A;  5EB0 A;  5CA1 B;  2IAF A;  4YJ3 A;  5EWR A;  3RYI B;  5EIB C;  2OTM A;  4E6E A;  4G4X A;  1H7M A;  3LWP C;  4F6R B;  4B45 A;  1KQS F;  4C4W C;  3C9S A;  2YYE A;  3CCV F;  5IJ9 B;  3C9U A;  4EB6 A;  5EZY A;  1XHO A;  3FD6 A;  2KTV A;  2UYJ A;  3CCQ F;  5HWE A;  4NWO B;  1W5B A;  5G4U C;  3G71 F;  5IJ0 B;  3ZO8 A;  5EO3 A;  2LBT A;  1FNK A;  4BVS A;  3V7Q A;  1SA0 A;  1VQ8 F;  3K2X A;  5FLX M;  4FFB A;  2HX0 A;  3JAT A;  1PF5 A;  1VQK F;  4U3J B;  1VQO F;  3FFM A;  1YQN A;  4I50 A;  2RB9 A;  1FFX B;  1M1K H;  5GON B;  4O4L B;  2KGW A;  1QD9 A;  2NMU A;  3KE1 A;  4O2B A;  5HXZ A;  5J2U A;  2BTU A;  2LBW A;  4LNU B;  4ZOL B;  5LP6 A;  3I55 F;  3FPI A;  5EIB D;  2OTL F;  4TV8 A;  2EWC A;  4TZZ A;  1VQ9 F;  1QAH A;  1VQL F;  3QUW A;  5JQG B;  5KMG A;  3K12 A;  3S02 A;  3CCJ F;  1RA4 A;  2OTJ F;  1QVF F;  3N2G B;  5HP7 A;  2KG4 A;  1NMU B;  2HS3 A;  3WPX A;  1RLG A;  3HKC A;  5J2T B;  1X52 A;  3LWR C;  3E20 B;  3N2K A;  2H8C A;  1NQ3 A;  3U0O A;  4TV9 A;  2BO1 A;  1PXW A;  4ZHQ B;  3G6E F;  3VO8 A;  4ZI7 A;  4O4H A;  1U43 A;  1DT9 A;  3FD5 A;  5ITZ A;  1FSZ A;  1QVG F;  3E1Y A;  5MN5 A;  5IYZ A;  4X3M A;  1YHQ F;  1YJW F;  3I3F A;  3NK6 A;  3GYQ A;  1SZQ A;  2CW4 A;  3OON A;  3V4D A;  1U40 A;  4BT6 A;  4EB6 B;  2VXY A;  1Q8R A;  1Z5W A;  4O4I B;  3KIZ A;  3VOA A;  3RYF B;  3NMU C;  3CPQ A;  4EI8 A;  3JAK A;  3TD5 A;  1JJ2 F;  1X25 A;  3P10 A;  2W8B C;  3JAM M;  5EAZ A;  1OFU A;  5LA6 A;  3MCA B;  4G4Z A;  1W5F A;  1KNK A;  4FFB B;  1W40 A;  4C8I A;  5HY0 A;  3V3T A;  1JFF B;  2L26 A;  3JAT B;  1NJI H;  3RYC A;  4I50 B;  3WGN A;  1GO0 A;  3CYQ A;  1KD1 H;  1E7K A;  4BT3 A;  1T0K B;  2LCA A;  3S03 A;  2VAW A;  5J2U B;  1U3L A;  2AIF A;  2UYK A;  3VYU C;  3HTN A;  5LP6 C;  5IT9 M;  2Z1E A;  4ZHV A;  3PAF A;  1YGY A;  2Z1U A;  1OAP A;  2ZOV A;  2KTU A;  5GIO C;  1CLI A;  1U3P A;  3ZOP A;  2WAL A;  3OW2 F;  1VQP F;  2GLZ A;  4PWT A;  3RYH A;  1X7O A;  1Q82 H;  1KC8 H;  1W55 A;  2RHO A;  3NVK E;  1YJN F;  2R75 1;  4X1Y A;  1W58 1;  2G9I A;  3HKC B;  1RQ2 A;  3K0T A;  4O4J A;  3IMP A;  3VI6 A;  3N2K B;  3JVH A;  5LYJ A; 
#chains in the Genus database with same CATH homology
 1W2B F;  4NUT A;  2HVY D;  3CC4 F;  5HXZ A;  3N4Z A;  2LBW A;  2FC3 A;  5DCV A;  1N8R H;  3IR9 A;  2FGY A;  2ALE A;  3I55 F;  1CN7 A;  3LFO A;  2OTL F;  5HXU A;  4TZZ A;  3J7A R;  1VQ9 F;  3VMF B;  4EI7 A;  3V7E A;  3G4S F;  3LWQ C;  1VQL F;  2QEX F;  3CCJ F;  1RA4 A;  1Q86 H;  3HAX D;  3CCE F;  2OTJ F;  3CXC F;  3HJW C;  3J80 M;  4EI9 A;  3LWV C;  1QVF F;  1VQ6 F;  5GAN K;  2KG4 A;  3CCM F;  5FJ4 C;  1NMU B;  1GZ0 A;  1W3E X;  1S72 F;  1RLG A;  3SIU A;  1YIT F;  3AGK A;  1X52 A;  5G4V C;  3CD6 F;  4LCK A;  3D00 A;  3J81 M;  1VQ4 F;  3LWR C;  3E20 B;  3OBW A;  3CPW F;  4BVT A;  5HY1 A;  5GAP K;  3WXM B;  1Q81 H;  2BO1 A;  1PXW A;  3G6E F;  5HY2 A;  2CZW A;  5A2Q M;  3CC2 F;  1DT9 A;  1SDS A;  4BY9 D;  3CCS F;  1QVG F;  1VQM F;  1M90 H;  3E1Y A;  4X3M A;  1YHQ F;  1YJW F;  1XBI A;  1VQ7 F;  3NVI B;  1GO1 A;  3SIV A;  3NK6 A;  3GYQ A;  3RA5 A;  1ZWZ A;  3OBY A;  2LBX A;  3CCL F;  2VGM A;  3PLA C;  3I56 F;  3CG6 A;  3RA6 A;  5GIN C;  1VQ5 F;  3NMU C;  3CPQ A;  2I6D A;  2OHW A;  4EI8 A;  1K8A H;  2JNB A;  4XCQ A;  1JJ2 F;  2OZB A;  2F9Z C;  3LWO C;  2QI2 A;  4BVQ A;  3O85 A;  5GIP C;  3JAM M;  3MCA B;  1YI2 F;  3CCU F;  1VQN F;  4BVR A;  5HY0 A;  3CMA F;  1W40 A;  3JCM M;  3V3T A;  1NJI H;  5EWR A;  3CCR F;  1GO0 A;  1YJ9 F;  1KD1 H;  1IPA A;  4X3L A;  1KQS F;  1H7M A;  3N4Y A;  3LWP C;  1E7K A;  1T0K B;  4C4W C;  1X7P A;  3CCV F;  2AIF A;  4BW0 B;  4NQ3 A;  5IT9 M;  5HY4 A;  2KTV A;  3PAF A;  3CCQ F;  5HWE A;  1Q7Y H;  2VGN A;  2KTU A;  5GIO C;  1W41 A;  3G71 F;  5G4U C;  2QA4 F;  2WAL A;  1W42 A;  3OW2 F;  1VQP F;  3NK7 A;  2GLZ A;  5EO3 A;  4BVS A;  1K9M H;  3V7Q A;  3CME F;  1X7O A;  1YIJ F;  1Q82 H;  1KC8 H;  1VQ8 F;  1K73 H;  5FLX M;  3NVK E;  1YJN F;  1CK2 A;  3ON1 A;  1VQK F;  1VQO F;  3FFM A;  3VI6 A;  3CC7 F;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...