1VQ6F

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq6F00
3CMEF 1GO0A 2WALA 1ZWZA 1YI2F 3CCMF 1Q86H 1VQ4F 3CCQF 2KTVA 1N8RH 1Q82H 3WXMB 5FLXM 3LWRC 1JJ2F 1YITF 1NJIH 1H7MA 3CXCF 1VQNF 3G4SF 1GO1A 3CCVF 3CCRF 2JNBA 1YJNF 3LWPC 1X52A 5G4VC 3HAXD 2LBWA 4BW0B 3VMFB 3I56F 1M1KH 3RA5A 2FC3A 1SDSA 2AIFA 3ON1A 3VI6A 3LWVC 1NMUB 3J81M 1W40A 3V7EA 2OTJF 5GANK 2QI2A 3G71F 1K8AH 2I6DA 1Q7YH 3CPWF 1QVGF 3CG6A 2BO1A 3CCEF 3CCLF 3J7AR 1YJ9F 1KC8H 1VQKF 1W3EX 1Q81H 2OZBA 1DT9A 3PAFA 5A2QM 1YJWF 3CD6F 1YIJF 4C4WC 5GIOC 5GINC 1VQ7F 3N4ZA 1VQOF 3NVKE 3NVIB 3CMAF 2LBXA 3OBWA 5G4UC 5GIPC 3PLAC 1K9MH 3LWQC 4LCKA 1CK2A 3CC4F 3NK7A 2KG4A 1YHQF 5GAPK 3J80M 1VQ8F 3V7QA 1QVFF 1X7OA 2OHWA 3E1YA 1W42A 2KTUA 2VGMA 3LFOA 3CCJF 4X3MA 1S72F 4NUTA 1VQ5F 1X7PA 4X3LA 2CZWA 2QA4F 3OBYA 1E7KA 1IPAA 1KQSF 5EWRA 2ALEA 3HJWC 3G6EF 5IT9M 3GYQA 3FFMA 1VQMF 1PXWA 1VQ9F 1RLGA 1CN7A 2OTLF 3LWOC 1VQPF 1K73H 3SIUA 3E20B 3CCUF 3AGKA 3SIVA 3IR9A 1M90H 3NMUC 1KD1H 1VQ6F 3OW2F 5FJ4C 3CPQA 3RA6A 4TZZA 1GZ0A 1XBIA 1RA4A 3MCAB 3CC7F 3I55F 3NK6A 3CC2F 3JCMM 1T0KB 5EO3A 3CCSF 5DCVA 3O85A 1W2BF 2VGNA 4BY9D 1W41A 2HVYD 3N4YA 3JAMM 1VQLF 2QEXF
chains in the Genus database with same CATH superfamily
3JAWB 1VK3A 3CMEF 3ZP7A 1QAHA 4HNAB 1Q8RA 5LP6C 1W55A 1XHOA 2AMTA 4FFBB 4YJ3A 5MN4A 1N8RH 1Q82H 3MCQA 1UI9A 4B62A 2DYYA 3WJRA 3CCVF 5JH7B 4WBNA 3CCRF 4ZHWA 1W59A 5GONB 1RLUA 5LOVA 4IIJB 2UYNB 4O2BB 4C8IA 4X1IA 5J2TA 5HXZA 4BW0B 4NWOB 3I56F 1VH8A 5KMGB 2RHLA 3KJKA 2FC3A 2Q1XA 4O4HA 1SDSA 2AIFA 4YJ2B 3WJPA 3VI6A 3M1XA 5IYZA 3KIZA 3CPWF 3MQWA 3JATB 3CCEF 3I3FA 5EB1B 4XCQA 1FFXA 1DT9A 5A2QM 2P6YA 4TV8B 1YIJF 1W5AA 1U40A 4F6RB 1VQOF 1FNJA 4U39A 2HP0B 5EZYB 4BT5A 1OAPA 3OBWA 3CMAF 5JQGA 3HKDB 3CC4F 1YHQF 2RHJA 5ITZA 2ZAUA 3RYCA 2UYPA 5CA0A 2HQSC 2OHWA 1W42A 4U3JA 2YYEA 3N2KB 2Z1FA 2KTUA 1SZQA 3CCJF 4X3MA 1CLIA 4NUTA 3LDTA 2PMPA 1X7PA 3RYIA 4EI9A 1E7KA 3IMPA 3HJWC 4LNUB 3FFMA 3GYQA 1W5FA 5KX5A 1VQ9F 2RHOA 1RLGA 1CN7A 4X1KA 1W57A 5HY4A 2R6R1 1VQPF 3JAKA 2B33A 2UZHA 5EIBC 3AGKA 3SIVA 1PF5A 3D54A 3OW2F 4YJ3B 2W8BC 4DRXA 3P0ZA 5CB4A 4IHJA 3TD4A 2IAFA 5EO3A 4G4YA 3ZO8A 3O85A 4WBNB 3F0FA 4BT3A 5HXUA 5IJ0B 4G88A 3WGMA 2QEXF 2Z1UA 5J2TB 2K1SA 4I4TA 3B6NA 3CCMF 1COMA 2GLZA 1TUBB 1VQ4F 4C8EA 3WXMB 5EIBD 5IYZB 1YITF 3VYSC 1VQNF 5JVDA 2BTOA 1Z5VA 2EWCA 3LWPC 3S0YA 3C8LA 5G4VC 4RHAA 2ZODA 3VMFB 2H8CA 4BVTA 2H6LA 3RA5A 2CHSA 4G4XA 2HX0A 3ON1A 3LWVC 3HKBA 3S03A 3WPWA 1H48A 1ODEA 3V7EA 2N48A 4TUYB 1VHAA 2QI2A 4C81A 5HY0A 4EI8A 1ONIA 5LP6A 5AVMA 3RYCB 3CCLF 5BMVA 5CA0B 5HWEA 1KC8H 1VQKF 3D01A 1U3LA 4U3JB 5LYJA 5MN5A 3GHZA 3IKEA 2OZBA 1JD1A 3PAFA 1OFUA 3TD5A 5GINC 4B5CA 3S06A 3S02A 3NVKE 1W5BA 2LBXA 4O4LB 2HS3A 3KE1A 5HY1A 5GIPC 4I50A 3FD5A 5KX5B 4X1KB 1SA0A 5GAPK 3JAKB 2BTUA 1QVFF 3VOAA 3T80A 4B46A 1KNJA 2L26A 3KJJA 5CA1B 2VGMA 4BT2A 2ZVZA 1YQNA 3M84A 1S72F 3F0DA 1Z5WA 3VIUA 5CB4B 3RYFB 2ALEA 3QTYA 3G6EF 4BT4A 4I55A 3WGJA 5HP7A 1PXWA 2OTLF 3JALA 3LWOC 3ERNA 3MBMA 5J2UB 4I4TB 3E20B 3V3TA 3HWUA 3HKCA 5IJ9A 5EYPA 1VQ6F 3R0PA 3RYHA 1IV4A 5FJ4C 3CPQA 1TVKA 3LYBA 4TZZA 1GZ0A 3N2GA 3VCZA 3CC7F 2Q1YA 3I55F 3NK6A 3CC2F 3JCMM 5JCOC 1QU9A 2HRYA 4O4IB 4RQOA 3MDOA 3HKEA 4BVSA 4EB6A 2F9ZC 2VGNA 5LA6A 2FGYA 1W41A 3QUWA 3QHDA 4HNAA 1T0AA 4KWEA 3TD3A 5HP8A 2V9YA 1W581 4G4VA 1H47A 4FFBA 2WALA 1GO0A 1YI2F 3EORA 3V4DA 1R1MA 1Q86H 3CCQF 1JY8A 5FLXM 3FD6A 1H7MA 2H8EA 5GONA 4IIJA 3G4SF 2I6RA 4O2BA 5BMVB 1YJNF 1X52A 5LYJB 1NQ3A 5KMGA 2DT4A 2ZVYA 2LBWA 4ZHVA 5LOVB 1JFFA 2CW4A 4BVQA 4X1IB 3IEWA 3ELCA 3J81M 1W40A 2OTJF 3JARA 4O4HB 4DXDA 5GANK 3JATA 1K8AH 4C82A 3BYQA 3WGLA 1Q7YH 3UT5A 3M4SA 4ERHA 1SA0B 1XV2A 4BT6A 2VXYA 4B45A 2HRUA 4O4JA 1W3EX 1Q81H 4F6RA 1YJWF 3CD6F 4C4WC 5GIOC 3N4ZA 3U0OA 1FFXB 3HKDA 2PHNA 4X20A 2RHHA 2Z1TA 3PLAC 1K9MH 3E22A 1KNKA 3K12A 3LWQC 5JQGB 2QTPA 1CK2A 3JALB 3CYQA 3K0TA 2KGWA 3J80M 3N2KA 1VQ8F 3V7QA 5IJ9B 3HKCB 4G4WA 4ZK7A 5ITZB 3C9RA 3CYPB 2IG8A 3LFOA 1TVKB 3WPXA 2NMUA 2CVLA 3IKFA 4M8IA 5EAZA 1VQ5F 4X3LA 2QA4F 3HKEB 1IPAA 5EWRA 5LA6B 2VAMA 3RYIB 1VQMF 2RB9A 1W5EA 1K73H 3C9TA 3SIUA 1QD9A 3CCUF 1YGYA 3VTIC 4X1YA 2AIZP 1KD1H 3IEQA 4ZHQA 3S0WA 1RA4A 2BTQB 3WJQA 5IJ0A 3CCSF 5C8YA 1J7HA 5DCVA 4DRXB 1FSZA 3VOBA 4IHJB 4TV9A 4ZI7A 5LXTA 3JAMM 4R40B 3JASA 2OTMA 1TUBA 2LCAA 1JFFB 3DC2A 1ZWZA 3WGKA 4G4ZA 2MQEA 2KTVA 3RE3A 3JARB 3LWRC 1JJ2F 5HY2A 1NJIH 4O2AA 3CXCF 3UT5B 3ZOPA 5FNVA 1GO1A 2GZLA 2JNBA 4O4JB 5JVDB 4ZOLA 3JVHA 3HAXD 3JAWA 1M1KH 2CHTA 5JCOA 3L7QA 4TUYA 3WGNA 4X20B 1VQVA 3VO8A 1NMUB 1IV2A 3KHNA 1IV3A 3S0HA 3G71F 2I6DA 3E22B 3FPIA 2CWJA 3HKBB 3K2XA 5JH7A 3I7TA 3CG6A 1QVGF 2BO1A 1JN1A 2GVIA 1GX1A 2UYJA 3J7AR 1YJ9F 1XRGA 2YXZA 3D00A 2UYNA 2Z1EA 3P10A 4NQ3A 5LP6B 4O4LA 2G9IA 1VQ7F 3C9UA 3F0GA 3K14A 3VYTC 3GTZA 4YJ2A 3NVIB 1U3PA 1DBFA 5G4UC 4BT7A 5MN6A 3Q8HA 4EI7A 5EB0A 2CSLA 4LCKA 3F6MA 3NK7A 2KG4A 3C9SA 1RQ2A 3OONA 4E6EA 4I50B 4PWTA 5CA1A 1X7OA 3ESJA 1RQ7A 2R751 3E1YA 4X1YB 3ZP4A 4BVRA 3RYFA 4TV8A 2HS0A 4ZHQB 2LBTA 5B8FA 3F0EA 4ZHYB 2CZWA 2HP0A 3OBYA 2VAWA 3HTNA 5EZYA 5C8YB 1KQSF 5IT9M 3CB2A 5J2UA 4TV9B 4ZI7B 5LXTB 1U43A 3JASB 1FNKA 3FBAA 4I55B 3VYUC 3IR9A 3LMEA 1M90H 3NMUC 3P4EA 3RA6A 4O4IA 2IQQA 5EYPB 1XBIA 3MCAB 1X25A 2Z01A 4O2AB 3RYHB 1T0KB 3DDNA 1IV1A 2HS4A 5FNVB 3N2GB 1UFYA 1W2BF 4LNUA 2UYKA 2ZOVA 4BY9D 2HVYD 2VAPA 3N4YA 2ZF8A 4C8GA 2HP3A 4EB6B 4ZOLB 1VQLF
chains in the Genus database with same CATH topology
3CMEF 1GO0A 2WALA 1ZWZA 1YI2F 3CCMF 1Q86H 1VQ4F 2GLZA 3CCQF 2KTVA 1N8RH 1Q82H 3WXMB 5FLXM 3LWRC 1JJ2F 5HY2A 1YITF 1NJIH 1H7MA 3CXCF 1VQNF 3G4SF 1GO1A 3CCVF 3CCRF 2JNBA 1YJNF 3LWPC 1X52A 5G4VC 3HAXD 2LBWA 5HXZA 4BW0B 3VMFB 3I56F 1M1KH 4BVQA 4BVTA 3RA5A 2FC3A 1SDSA 2AIFA 3ON1A 3VI6A 3LWVC 1NMUB 3J81M 1W40A 3V7EA 2OTJF 5GANK 2QI2A 5HY0A 3G71F 1K8AH 2I6DA 4EI8A 1Q7YH 3CPWF 1QVGF 3CG6A 2BO1A 3CCEF 3CCLF 3J7AR 5HWEA 1YJ9F 1KC8H 1VQKF 3D00A 1W3EX 1Q81H 4NQ3A 4XCQA 2OZBA 1DT9A 3PAFA 5A2QM 1YJWF 3CD6F 1YIJF 4C4WC 5GINC 5GIOC 1VQ7F 3N4ZA 1VQOF 3NVKE 3NVIB 3CMAF 2LBXA 3OBWA 5G4UC 5HY1A 5GIPC 3PLAC 1K9MH 4EI7A 3LWQC 4LCKA 1CK2A 3CC4F 3NK7A 2KG4A 1YHQF 5GAPK 3J80M 1VQ8F 3V7QA 1QVFF 1X7OA 4BVRA 2OHWA 3E1YA 1W42A 2KTUA 2VGMA 3LFOA 3CCJF 4X3MA 1S72F 4NUTA 1VQ5F 1X7PA 4X3LA 2CZWA 2QA4F 3OBYA 4EI9A 1IPAA 1KQSF 5EWRA 2ALEA 1E7KA 3HJWC 3G6EF 5IT9M 3GYQA 3FFMA 1VQMF 1PXWA 1VQ9F 1RLGA 1CN7A 2OTLF 5HY4A 3LWOC 1VQPF 1K73H 3SIUA 3E20B 3V3TA 3CCUF 3AGKA 3SIVA 3IR9A 1M90H 3NMUC 1KD1H 1VQ6F 3OW2F 5FJ4C 3CPQA 3RA6A 4TZZA 1GZ0A 1XBIA 1RA4A 3MCAB 3CC7F 3I55F 3NK6A 3CC2F 3JCMM 1T0KB 5EO3A 4BVSA 3CCSF 5DCVA 3O85A 2F9ZC 1W2BF 2VGNA 5HXUA 2FGYA 4BY9D 1W41A 2HVYD 3N4YA 3JAMM 1VQLF 2QEXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME F;  1GO0 A;  2WAL A;  1ZWZ A;  1YI2 F;  3CCM F;  1Q86 H;  1VQ4 F;  3CCQ F;  2KTV A;  1N8R H;  1Q82 H;  3WXM B;  5FLX M;  3LWR C;  1JJ2 F;  1YIT F;  1NJI H;  1H7M A;  3CXC F;  1VQN F;  3G4S F;  1GO1 A;  3CCV F;  3CCR F;  2JNB A;  1YJN F;  3LWP C;  1X52 A;  5G4V C;  3HAX D;  2LBW A;  4BW0 B;  3VMF B;  3I56 F;  1M1K H;  3RA5 A;  2FC3 A;  1SDS A;  2AIF A;  3ON1 A;  3VI6 A;  3LWV C;  1NMU B;  3J81 M;  1W40 A;  3V7E A;  2OTJ F;  5GAN K;  2QI2 A;  3G71 F;  1K8A H;  2I6D A;  1Q7Y H;  3CPW F;  1QVG F;  3CG6 A;  2BO1 A;  3CCE F;  3CCL F;  3J7A R;  1YJ9 F;  1KC8 H;  1VQK F;  1W3E X;  1Q81 H;  2OZB A;  1DT9 A;  3PAF A;  5A2Q M;  1YJW F;  3CD6 F;  1YIJ F;  4C4W C;  5GIO C;  5GIN C;  1VQ7 F;  3N4Z A;  1VQO F;  3NVK E;  3NVI B;  3CMA F;  2LBX A;  3OBW A;  5G4U C;  5GIP C;  3PLA C;  1K9M H;  3LWQ C;  4LCK A;  1CK2 A;  3CC4 F;  3NK7 A;  2KG4 A;  1YHQ F;  5GAP K;  3J80 M;  1VQ8 F;  3V7Q A;  1QVF F;  1X7O A;  2OHW A;  3E1Y A;  1W42 A;  2KTU A;  2VGM A;  3LFO A;  3CCJ F;  4X3M A;  1S72 F;  4NUT A;  1VQ5 F;  1X7P A;  4X3L A;  2CZW A;  2QA4 F;  3OBY A;  1E7K A;  1IPA A;  1KQS F;  5EWR A;  2ALE A;  3HJW C;  3G6E F;  5IT9 M;  3GYQ A;  3FFM A;  1VQM F;  1PXW A;  1VQ9 F;  1RLG A;  1CN7 A;  2OTL F;  3LWO C;  1VQP F;  1K73 H;  3SIU A;  3E20 B;  3CCU F;  3AGK A;  3SIV A;  3IR9 A;  1M90 H;  3NMU C;  1KD1 H;  1VQ6 F;  3OW2 F;  5FJ4 C;  3CPQ A;  3RA6 A;  4TZZ A;  1GZ0 A;  1XBI A;  1RA4 A;  3MCA B;  3CC7 F;  3I55 F;  3NK6 A;  3CC2 F;  3JCM M;  1T0K B;  5EO3 A;  3CCS F;  5DCV A;  3O85 A;  1W2B F;  2VGN A;  4BY9 D;  1W41 A;  2HVY D;  3N4Y A;  3JAM M;  1VQL F;  2QEX F; 
#chains in the Genus database with same CATH topology
 3JAW B;  1VK3 A;  3CME F;  3ZP7 A;  1QAH A;  4HNA B;  1Q8R A;  5LP6 C;  1W55 A;  1XHO A;  2AMT A;  4FFB B;  4YJ3 A;  5MN4 A;  1N8R H;  1Q82 H;  3MCQ A;  1UI9 A;  4B62 A;  2DYY A;  3WJR A;  3CCV F;  5JH7 B;  4WBN A;  3CCR F;  4ZHW A;  1W59 A;  5GON B;  1RLU A;  5LOV A;  4IIJ B;  2UYN B;  4O2B B;  4C8I A;  4X1I A;  5J2T A;  5HXZ A;  4BW0 B;  4NWO B;  3I56 F;  1VH8 A;  5KMG B;  2RHL A;  3KJK A;  2FC3 A;  2Q1X A;  4O4H A;  1SDS A;  2AIF A;  4YJ2 B;  3WJP A;  3VI6 A;  3M1X A;  5IYZ A;  3KIZ A;  3CPW F;  3MQW A;  3JAT B;  3CCE F;  3I3F A;  5EB1 B;  4XCQ A;  1FFX A;  1DT9 A;  5A2Q M;  2P6Y A;  4TV8 B;  1YIJ F;  1W5A A;  1U40 A;  4F6R B;  1VQO F;  1FNJ A;  4U39 A;  2HP0 B;  5EZY B;  4BT5 A;  1OAP A;  3OBW A;  3CMA F;  5JQG A;  3HKD B;  3CC4 F;  1YHQ F;  2RHJ A;  5ITZ A;  2ZAU A;  3RYC A;  2UYP A;  5CA0 A;  2HQS C;  2OHW A;  1W42 A;  4U3J A;  2YYE A;  3N2K B;  2Z1F A;  2KTU A;  1SZQ A;  3CCJ F;  4X3M A;  1CLI A;  4NUT A;  3LDT A;  2PMP A;  1X7P A;  3RYI A;  4EI9 A;  1E7K A;  3IMP A;  3HJW C;  4LNU B;  3FFM A;  3GYQ A;  1W5F A;  5KX5 A;  1VQ9 F;  2RHO A;  1RLG A;  1CN7 A;  4X1K A;  1W57 A;  5HY4 A;  2R6R 1;  1VQP F;  3JAK A;  2B33 A;  2UZH A;  5EIB C;  3AGK A;  3SIV A;  1PF5 A;  3D54 A;  3OW2 F;  4YJ3 B;  2W8B C;  4DRX A;  3P0Z A;  5CB4 A;  4IHJ A;  3TD4 A;  2IAF A;  5EO3 A;  4G4Y A;  3ZO8 A;  3O85 A;  4WBN B;  3F0F A;  4BT3 A;  5HXU A;  5IJ0 B;  4G88 A;  3WGM A;  2QEX F;  2Z1U A;  5J2T B;  2K1S A;  4I4T A;  3B6N A;  3CCM F;  1COM A;  2GLZ A;  1TUB B;  1VQ4 F;  4C8E A;  3WXM B;  5EIB D;  5IYZ B;  1YIT F;  3VYS C;  1VQN F;  5JVD A;  2BTO A;  1Z5V A;  2EWC A;  3LWP C;  3S0Y A;  3C8L A;  5G4V C;  4RHA A;  2ZOD A;  3VMF B;  2H8C A;  4BVT A;  2H6L A;  3RA5 A;  2CHS A;  4G4X A;  2HX0 A;  3ON1 A;  3LWV C;  3HKB A;  3S03 A;  3WPW A;  1H48 A;  1ODE A;  3V7E A;  2N48 A;  4TUY B;  1VHA A;  2QI2 A;  4C81 A;  5HY0 A;  4EI8 A;  1ONI A;  5LP6 A;  5AVM A;  3RYC B;  3CCL F;  5BMV A;  5CA0 B;  5HWE A;  1KC8 H;  1VQK F;  3D01 A;  1U3L A;  4U3J B;  5LYJ A;  5MN5 A;  3GHZ A;  3IKE A;  2OZB A;  1JD1 A;  3PAF A;  1OFU A;  3TD5 A;  5GIN C;  4B5C A;  3S06 A;  3S02 A;  3NVK E;  1W5B A;  2LBX A;  4O4L B;  2HS3 A;  3KE1 A;  5HY1 A;  5GIP C;  4I50 A;  3FD5 A;  5KX5 B;  4X1K B;  1SA0 A;  5GAP K;  3JAK B;  2BTU A;  1QVF F;  3VOA A;  3T80 A;  4B46 A;  1KNJ A;  2L26 A;  3KJJ A;  5CA1 B;  2VGM A;  4BT2 A;  2ZVZ A;  1YQN A;  3M84 A;  1S72 F;  3F0D A;  1Z5W A;  3VIU A;  5CB4 B;  3RYF B;  2ALE A;  3QTY A;  3G6E F;  4BT4 A;  4I55 A;  3WGJ A;  5HP7 A;  1PXW A;  2OTL F;  3JAL A;  3LWO C;  3ERN A;  3MBM A;  5J2U B;  4I4T B;  3E20 B;  3V3T A;  3HWU A;  3HKC A;  5IJ9 A;  5EYP A;  1VQ6 F;  3R0P A;  3RYH A;  1IV4 A;  5FJ4 C;  3CPQ A;  1TVK A;  3LYB A;  4TZZ A;  1GZ0 A;  3N2G A;  3VCZ A;  3CC7 F;  2Q1Y A;  3I55 F;  3NK6 A;  3CC2 F;  3JCM M;  5JCO C;  1QU9 A;  2HRY A;  4O4I B;  4RQO A;  3MDO A;  3HKE A;  4BVS A;  4EB6 A;  2F9Z C;  2VGN A;  5LA6 A;  2FGY A;  1W41 A;  3QUW A;  3QHD A;  4HNA A;  1T0A A;  4KWE A;  3TD3 A;  5HP8 A;  2V9Y A;  1W58 1;  4G4V A;  1H47 A;  4FFB A;  2WAL A;  1GO0 A;  1YI2 F;  3EOR A;  3V4D A;  1R1M A;  1Q86 H;  3CCQ F;  1JY8 A;  5FLX M;  3FD6 A;  1H7M A;  2H8E A;  5GON A;  4IIJ A;  3G4S F;  2I6R A;  4O2B A;  5BMV B;  1YJN F;  1X52 A;  5LYJ B;  1NQ3 A;  5KMG A;  2DT4 A;  2ZVY A;  2LBW A;  4ZHV A;  5LOV B;  1JFF A;  2CW4 A;  4BVQ A;  4X1I B;  3IEW A;  3ELC A;  3J81 M;  1W40 A;  2OTJ F;  3JAR A;  4O4H B;  4DXD A;  5GAN K;  3JAT A;  1K8A H;  4C82 A;  3BYQ A;  3WGL A;  1Q7Y H;  3UT5 A;  3M4S A;  4ERH A;  1SA0 B;  1XV2 A;  4BT6 A;  2VXY A;  4B45 A;  2HRU A;  4O4J A;  1W3E X;  1Q81 H;  4F6R A;  1YJW F;  3CD6 F;  4C4W C;  5GIO C;  3N4Z A;  3U0O A;  1FFX B;  3HKD A;  2PHN A;  4X20 A;  2RHH A;  2Z1T A;  3PLA C;  1K9M H;  3E22 A;  1KNK A;  3K12 A;  3LWQ C;  5JQG B;  2QTP A;  1CK2 A;  3JAL B;  3CYQ A;  3K0T A;  2KGW A;  3J80 M;  3N2K A;  1VQ8 F;  3V7Q A;  5IJ9 B;  3HKC B;  4G4W A;  4ZK7 A;  5ITZ B;  3C9R A;  3CYP B;  2IG8 A;  3LFO A;  1TVK B;  3WPX A;  2NMU A;  2CVL A;  3IKF A;  4M8I A;  5EAZ A;  1VQ5 F;  4X3L A;  2QA4 F;  3HKE B;  1IPA A;  5EWR A;  5LA6 B;  2VAM A;  3RYI B;  1VQM F;  2RB9 A;  1W5E A;  1K73 H;  3C9T A;  3SIU A;  1QD9 A;  3CCU F;  1YGY A;  3VTI C;  4X1Y A;  2AIZ P;  1KD1 H;  3IEQ A;  4ZHQ A;  3S0W A;  1RA4 A;  2BTQ B;  3WJQ A;  5IJ0 A;  3CCS F;  5C8Y A;  1J7H A;  5DCV A;  4DRX B;  1FSZ A;  3VOB A;  4IHJ B;  4TV9 A;  4ZI7 A;  5LXT A;  3JAM M;  4R40 B;  3JAS A;  2OTM A;  1TUB A;  2LCA A;  1JFF B;  3DC2 A;  1ZWZ A;  3WGK A;  4G4Z A;  2MQE A;  2KTV A;  3RE3 A;  3JAR B;  3LWR C;  1JJ2 F;  5HY2 A;  1NJI H;  4O2A A;  3CXC F;  3UT5 B;  3ZOP A;  5FNV A;  1GO1 A;  2GZL A;  2JNB A;  4O4J B;  5JVD B;  4ZOL A;  3JVH A;  3HAX D;  3JAW A;  1M1K H;  2CHT A;  5JCO A;  3L7Q A;  4TUY A;  3WGN A;  4X20 B;  1VQV A;  3VO8 A;  1NMU B;  1IV2 A;  3KHN A;  1IV3 A;  3S0H A;  3G71 F;  2I6D A;  3E22 B;  3FPI A;  2CWJ A;  3HKB B;  3K2X A;  5JH7 A;  3I7T A;  3CG6 A;  1QVG F;  2BO1 A;  1JN1 A;  2GVI A;  1GX1 A;  2UYJ A;  3J7A R;  1YJ9 F;  1XRG A;  2YXZ A;  3D00 A;  2UYN A;  2Z1E A;  3P10 A;  4NQ3 A;  5LP6 B;  4O4L A;  2G9I A;  1VQ7 F;  3C9U A;  3F0G A;  3K14 A;  3VYT C;  3GTZ A;  4YJ2 A;  3NVI B;  1U3P A;  1DBF A;  5G4U C;  4BT7 A;  5MN6 A;  3Q8H A;  4EI7 A;  5EB0 A;  2CSL A;  4LCK A;  3F6M A;  3NK7 A;  2KG4 A;  3C9S A;  1RQ2 A;  3OON A;  4E6E A;  4I50 B;  4PWT A;  5CA1 A;  1X7O A;  3ESJ A;  1RQ7 A;  2R75 1;  3E1Y A;  4X1Y B;  3ZP4 A;  4BVR A;  3RYF A;  4TV8 A;  2HS0 A;  4ZHQ B;  2LBT A;  5B8F A;  3F0E A;  4ZHY B;  2CZW A;  2HP0 A;  3OBY A;  2VAW A;  3HTN A;  5EZY A;  5C8Y B;  1KQS F;  5IT9 M;  3CB2 A;  5J2U A;  4TV9 B;  4ZI7 B;  5LXT B;  1U43 A;  3JAS B;  1FNK A;  3FBA A;  4I55 B;  3VYU C;  3IR9 A;  3LME A;  1M90 H;  3NMU C;  3P4E A;  3RA6 A;  4O4I A;  2IQQ A;  5EYP B;  1XBI A;  3MCA B;  1X25 A;  2Z01 A;  4O2A B;  3RYH B;  1T0K B;  3DDN A;  1IV1 A;  2HS4 A;  5FNV B;  3N2G B;  1UFY A;  1W2B F;  4LNU A;  2UYK A;  2ZOV A;  4BY9 D;  2HVY D;  2VAP A;  3N4Y A;  2ZF8 A;  4C8G A;  2HP3 A;  4EB6 B;  4ZOL B;  1VQL F; 
#chains in the Genus database with same CATH homology
 3CME F;  1GO0 A;  2WAL A;  1ZWZ A;  1YI2 F;  3CCM F;  1Q86 H;  1VQ4 F;  2GLZ A;  3CCQ F;  2KTV A;  1N8R H;  1Q82 H;  3WXM B;  5FLX M;  3LWR C;  1JJ2 F;  5HY2 A;  1YIT F;  1NJI H;  1H7M A;  3CXC F;  1VQN F;  3G4S F;  1GO1 A;  3CCV F;  3CCR F;  2JNB A;  1YJN F;  3LWP C;  1X52 A;  5G4V C;  3HAX D;  2LBW A;  5HXZ A;  4BW0 B;  3VMF B;  3I56 F;  1M1K H;  4BVQ A;  4BVT A;  3RA5 A;  2FC3 A;  1SDS A;  2AIF A;  3ON1 A;  3VI6 A;  3LWV C;  1NMU B;  3J81 M;  1W40 A;  3V7E A;  2OTJ F;  5GAN K;  2QI2 A;  5HY0 A;  3G71 F;  1K8A H;  2I6D A;  4EI8 A;  1Q7Y H;  3CPW F;  1QVG F;  3CG6 A;  2BO1 A;  3CCE F;  3CCL F;  3J7A R;  5HWE A;  1YJ9 F;  1KC8 H;  1VQK F;  3D00 A;  1W3E X;  1Q81 H;  4NQ3 A;  4XCQ A;  2OZB A;  1DT9 A;  3PAF A;  5A2Q M;  1YJW F;  3CD6 F;  1YIJ F;  4C4W C;  5GIN C;  5GIO C;  1VQ7 F;  3N4Z A;  1VQO F;  3NVK E;  3NVI B;  3CMA F;  2LBX A;  3OBW A;  5G4U C;  5HY1 A;  5GIP C;  3PLA C;  1K9M H;  4EI7 A;  3LWQ C;  4LCK A;  1CK2 A;  3CC4 F;  3NK7 A;  2KG4 A;  1YHQ F;  5GAP K;  3J80 M;  1VQ8 F;  3V7Q A;  1QVF F;  1X7O A;  4BVR A;  2OHW A;  3E1Y A;  1W42 A;  2KTU A;  2VGM A;  3LFO A;  3CCJ F;  4X3M A;  1S72 F;  4NUT A;  1VQ5 F;  1X7P A;  4X3L A;  2CZW A;  2QA4 F;  3OBY A;  4EI9 A;  1IPA A;  1KQS F;  5EWR A;  2ALE A;  1E7K A;  3HJW C;  3G6E F;  5IT9 M;  3GYQ A;  3FFM A;  1VQM F;  1PXW A;  1VQ9 F;  1RLG A;  1CN7 A;  2OTL F;  5HY4 A;  3LWO C;  1VQP F;  1K73 H;  3SIU A;  3E20 B;  3V3T A;  3CCU F;  3AGK A;  3SIV A;  3IR9 A;  1M90 H;  3NMU C;  1KD1 H;  1VQ6 F;  3OW2 F;  5FJ4 C;  3CPQ A;  3RA6 A;  4TZZ A;  1GZ0 A;  1XBI A;  1RA4 A;  3MCA B;  3CC7 F;  3I55 F;  3NK6 A;  3CC2 F;  3JCM M;  1T0K B;  5EO3 A;  4BVS A;  3CCS F;  5DCV A;  3O85 A;  2F9Z C;  1W2B F;  2VGN A;  5HXU A;  2FGY A;  4BY9 D;  1W41 A;  2HVY D;  3N4Y A;  3JAM M;  1VQL F;  2QEX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...