1VQ6F

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq6F00
3E20B 1Q7YH 1VQ5F 3SIUA 3J81M 1DT9A 1VQMF 1ZWZA 3CCLF 3AGKA 4C4WC 3CXCF 1Q82H 1K9MH 3ON1A 1Q86H 1SDSA 2I6DA 1JJ2F 2KG4A 4X3MA 5GIOC 3G71F 3SIVA 1X7OA 2QA4F 5A2QM 3HAXD 1GO0A 3N4ZA 5FLXM 3CG6A 1VQ4F 3E1YA 3CCVF 5G4VC 2OTJF 1YI2F 2WALA 2BO1A 5EO3A 1VQ6F 3CMAF 2LBXA 1K8AH 3VI6A 3OBWA 1VQNF 3I55F 1M1KH 3NVIB 1VQLF 4BY9D 3CCRF 2HVYD 2QEXF 5GINC 5GAPK 3WXMB 5GIPC 2OZBA 3J80M 2QI2A 1YJNF 3CPQA 1X52A 3LFOA 3LWOC 3LWQC 3NVKE 2LBWA 2ALEA 1QVFF 1KQSF 3FFMA 1YITF 1CK2A 2VGMA 3OW2F 3NMUC 3JCMM 1VQPF 2JNBA 3PAFA 1IPAA 1X7PA 4BW0B 3LWVC 3O85A 1GO1A 1W41A 5FJ4C 2OTLF 3V7QA 3JAMM 1S72F 3NK6A 1QVGF 2AIFA 5EWRA 1CN7A 1KC8H 1W40A 3CCEF 1YJWF 3CCJF 3CC4F 3J7AR 3CCUF 3LWPC 5IT9M 3N4YA 1Q81H 1E7KA 3G6EF 1VQKF 2KTUA 3CCSF 5GANK 3PLAC 3VMFB 4NUTA 3I56F 1VQ9F 1YJ9F 3MCAB 1XBIA 1GZ0A 2FC3A 3CCMF 1K73H 3LWRC 1VQ7F 2KTVA 1YHQF 1W3EX 1VQOF 4LCKA 1KD1H 1H7MA 1RA4A 1T0KB 5DCVA 1W42A 3CC2F 1NJIH 3V7EA 2CZWA 1RLGA 3RA6A 2VGNA 3CC7F 3NK7A 3GYQA 4TZZA 3CCQF 3HJWC 1VQ8F 3CD6F 1YIJF 4X3LA 3CPWF 3G4SF 3RA5A 1M90H 3IR9A 3OBYA 1W2BF 1N8RH 3CMEF 5G4UC 1PXWA 2OHWA 1NMUB
chains in the Genus database with same CATH superfamily
1W5BA 1ZWZA 1W59A 4C4WC 2PHNA 3AGKA 3WJQA 4BT5A 1SDSA 2KG4A 4BT4A 2CHTA 4I4TA 5A2QM 3HAXD 1VQ4F 3CG6A 4NWOB 3E1YA 5HY4A 1H47A 4RQOA 1VQ6F 3HKBB 2KGWA 2Z1FA 2HS4A 3VYUC 2Q1XA 5LP6C 3D01A 3NVIB 3IKFA 3QTYA 5JCOC 4O4JB 4DXDA 2VXYA 1GX1A 5ITZA 1COMA 4IIJB 2UYJA 5IJ9A 5MN4A 1QVFF 1ODEA 3ZP4A 1CK2A 1R1MA 1IV2A 1JD1A 5HY1A 3NMUC 3PAFA 4DRXA 1X7PA 2VAPA 4I55A 1W41A 3WJRA 2HRYA 1W57A 2HP0B 1S72F 1FFXB 5LP6A 4G4ZA 3JAWA 5EWRA 1CN7A 4TV8B 4X1IB 4X1KA 3CC4F 5LOVB 3ELCA 5IT9M 4EI8A 2GZLA 5JQGA 1TUBB 1YJ9F 1GZ0A 5J2UA 3ZOPA 5EIBC 5CA0B 5JVDB 2ZVYA 2H6LA 1W3EX 5DCVA 1RA4A 2G9IA 1T0KB 5CA1B 3N2KA 4EI9A 4EI7A 3DC2A 3LYBA 3HKDA 1VHAA 3F0EA 1YIJF 1ONIA 3JASB 5KMGA 3RA5A 2UYNB 2AMTA 3ESJA 5EIBD 1W2BF 4C82A 4ZOLA 3RYIA 4B46A 4ZHWA 1Q8RA 2W8BC 3E20B 1XV2A 3JATA 4O4HB 4FFBB 1DT9A 4O4LB 4KWEA 1VQMF 3DDNA 1Q82H 3GHZA 1K9MH 4WBNA 1Q86H 1JFFA 1W5AA 3CYPB 2LBTA 3IEQA 4F6RA 3EORA 3VCZA 4TUYA 2Z1TA 1X7OA 1U43A 5BMVA 5IJ0B 3KIZA 4IHJA 2UYKA 3JVHA 2R751 4ZI7A 5FLXM 3HTNA 2ZODA 1GO0A 4YJ3A 4I4TB 3T80A 2OTJF 2QTPA 2BO1A 5EO3A 5HXUA 3CMAF 5JH7A 1QU9A 4EB6A 3V3TA 1T0AA 1CLIA 4C8EA 2Z1EA 3MQWA 4X20B 5CB4B 1M1KH 3K14A 2Q1YA 2F9ZC 1VQLF 3CCRF 2RHHA 1J7HA 2HVYD 2QEXF 4LNUA 3HKCA 4TV9A 5GAPK 5ITZB 5J2TA 3J80M 2QI2A 2V9YA 5EAZA 3LWQC 4NQ3A 1PF5A 3FBAA 4G88A 1JY8A 5LA6A 3K2XA 3K12A 5HWEA 3OW2F 1VQPF 3E22A 1IPAA 3WGJA 4X1YB 2YXZA 4YJ2A 3V7QA 2IAFA 4I55B 3C9RA 2AIFA 5EZYA 3I7TA 3TD4A 5IYZB 1KC8H 3CCEF 5LP6B 1XHOA 4O4IA 3V4DA 3JAWB 3CCJF 4HNAB 3F0DA 3LWPC 5MN6A 3CYQA 5HP7A 2UYPA 2I6RA 5MN5A 4ZHQA 3WPWA 3IKEA 3P4EA 3G6EF 1VQKF 4ZK7A 5GANK 3PLAC 4G4VA 4ZHYB 3I56F 1KNKA 1VQ9F 1RQ7A 3CCMF 4U3JA 3B6NA 4ERHA 1SA0B 3LWRC 1VQ7F 2P6YA 5J2UB 2ZAUA 5EB0A 3M4SA 5HY0A 1KD1H 3C9UA 1TVKA 1X25A 3RYCB 5C8YA 2CZWA 1RLGA 3CC7F 3WGKA 3JALB 3GYQA 3CCQF 3N2KB 5LXTB 4X3LA 3HKDB 4E6EA 3KJJA 3M84A 5KMGB 4M8IA 1PXWA 1U40A 5G4UC 1OFUA 2HX0A 5KX5A 3JARA 4O4JA 1NMUB 2IG8A 4BVTA 3GTZA 2R6R1 1VQ5F 3SIUA 3RYIB 3M1XA 3JATB 3CXCF 3ZO8A 3ON1A 5FNVA 1FNKA 3WJPA 4X3MA 5GIOC 1UI9A 3G71F 1JFFB 3SIVA 4F6RB 1U3PA 4TUYB 3VOAA 2Z1UA 4B45A 3CCVF 2N48A 3TD5A 4IHJB 2EWCA 3OONA 2WALA 3F0FA 2B33A 2LCAA 4YJ3B 3LDTA 2HP0A 3UT5B 3VI6A 4EB6B 2CWJA 3RYFA 1QD9A 3I55F 3VYTC 2BTOA 1W55A 5GINC 1YGYA 3S0YA 4X1IA 4BT2A 1W5FA 5LOVA 3VIUA 4LNUB 3WPXA 3WXMB 3HKCB 4TV9B 1YJNF 3RYHA 3CPQA 1X52A 2IQQA 3U0OA 3LWOC 1SZQA 4O2BA 5LYJA 2LBWA 3N2GA 2ALEA 2ZVZA 1TUBA 3WGNA 3FFMA 1VH8A 2VGMA 4G4WA 5CA0A 5JVDA 5LA6B 4BW0B 3LWVC 3O85A 5FJ4C 3MDOA 3E22B 2OTLF 2HS0A 3JAMM 3MBMA 3NK6A 4I50A 1OAPA 1U3LA 4YJ2B 3S03A 3QHDA 4BT7A 3P0ZA 2AIZP 5EZYB 2UYNA 3VTIC 3S0WA 3JAKA 3CCUF 3Q8HA 2PMPA 2BTUA 5AVMA 1VQVA 1E7KA 1QAHA 5GONA 3CCSF 2CVLA 5IJ9B 3LMEA 3VMFB 3P10A 4ZHQB 2FC3A 3KE1A 3WGMA 1K73H 3ZP7A 2KTVA 3C8LA 1RQ2A 4O2AA 4DRXB 4U3JB 1YHQF 2ZF8A 1NQ3A 5HP8A 5IJ0A 1W42A 1NJIH 5B8FA 1IV1A 3HKEA 2VGNA 3L7QA 4C8IA 2HQSC 1TVKB 4B62A 5C8YB 2FGYA 3S02A 2GLZA 3HJWC 2OTMA 1VQ8F 3HWUA 3KHNA 5EB1B 4G4YA 3G4SF 1M90H 2L26A 2NMUA 3S06A 4X1KB 3IR9A 3ERNA 5EYPA 3OBYA 1N8RH 3CMEF 4X20A 5CB4A 2OHWA 3D54A 3V7EA 1Q7YH 2DYYA 3J81M 5KX5B 3JARB 5JQGB 4BVQA 3CCLF 2I6DA 1XRGA 1JJ2F 4BVSA 5FNVB 2MQEA 2RHJA 3VO8A 1UFYA 2QA4F 3WGLA 3N4ZA 3HKBA 5G4VC 2HP3A 2HS3A 1YI2F 4X1YA 3VOBA 1JN1A 3D00A 1Z5VA 2LBXA 4RHAA 1K8AH 4G4XA 3IMPA 4C81A 3OBWA 1VQNF 5IYZA 4ZOLB 3R0PA 2H8CA 4BY9D 3RYFB 3C9TA 5JCOA 4HNAA 4IIJA 2K1SA 1VK3A 5HXZA 4WBNB 5GIPC 3CB2A 2OZBA 4C8GA 3LFOA 3NVKE 1W5EA 3RYHB 5BMVB 1KQSF 2CSLA 3IEWA 1YITF 4PWTA 4O2BB 5LYJB 3K0TA 4ZI7B 1FNJA 3N2GB 1SA0A 2HRUA 1IV3A 3JCMM 2JNBA 4U39A 1IV4A 3BYQA 4R40B 1FFXA 1GO1A 5JH7B 3FPIA 3RYCA 5HY2A 3MCQA 4TV8A 3RE3A 2ZOVA 3JALA 1QVGF 2VAMA 2RHOA 4I50B 1YQNA 1W40A 3F0GA 5LXTA 1KNJA 1YJWF 3S0HA 2H8EA 3J7AR 4BT6A 3FD5A 2BTQB 3N4YA 3JAKB 5J2TB 1Q81H 3KJKA 2KTUA 1W581 5GONB 4NUTA 1RLUA 2CW4A 2GVIA 3MCAB 1XBIA 4BVRA 2UZHA 4ZHVA 3C9SA 3TD3A 5CA1A 1VQOF 4LCKA 2CHSA 4BT3A 1H7MA 2YYEA 4O2AB 3FD6A 2RHLA 3CC2F 3RA6A 3NK7A 2RB9A 3VYSC 1H48A 3QUWA 4TZZA 3JASA 3HKEB 3I3FA 4XCQA 4B5CA 1DBFA 3CD6F 1FSZA 3F6MA 4O4IB 3CPWF 3UT5A 2VAWA 2Z01A 4O4HA 4FFBA 4O4LA 2DT4A 1Z5WA 5EYPB
chains in the Genus database with same CATH topology
3E20B 1Q7YH 1VQ5F 3SIUA 3J81M 1DT9A 1VQMF 1ZWZA 4BVQA 3CCLF 3AGKA 4C4WC 3CXCF 1Q82H 1K9MH 3ON1A 1Q86H 1SDSA 2I6DA 1JJ2F 2KG4A 4X3MA 5GIOC 3G71F 4BVSA 3SIVA 1X7OA 2QA4F 5A2QM 3HAXD 1GO0A 3N4ZA 5FLXM 3CG6A 5HY4A 3E1YA 1VQ4F 3CCVF 5G4VC 2OTJF 1YI2F 2WALA 2BO1A 5EO3A 1VQ6F 5HXUA 3D00A 3CMAF 2LBXA 3V3TA 1K8AH 3VI6A 3OBWA 1VQNF 3I55F 1M1KH 3NVIB 2F9ZC 1VQLF 4BY9D 3CCRF 2HVYD 2QEXF 5GINC 5GAPK 5HXZA 3WXMB 5GIPC 2OZBA 3J80M 2QI2A 1YJNF 3CPQA 1X52A 3LFOA 3LWOC 3LWQC 3NVKE 4NQ3A 2LBWA 2ALEA 1QVFF 1KQSF 3FFMA 1YITF 1CK2A 2VGMA 5HY1A 5HWEA 3OW2F 3NMUC 3JCMM 1VQPF 2JNBA 3PAFA 1IPAA 1X7PA 4BW0B 3LWVC 3O85A 1GO1A 1W41A 5FJ4C 2OTLF 5HY2A 3V7QA 3JAMM 1S72F 3NK6A 1QVGF 2AIFA 5EWRA 1CN7A 1KC8H 1W40A 3CCEF 1YJWF 3CCJF 3CC4F 3J7AR 3CCUF 3LWPC 5IT9M 3N4YA 1Q81H 1E7KA 4EI8A 3G6EF 2KTUA 3CCSF 1VQKF 5GANK 3PLAC 3VMFB 4NUTA 3I56F 1VQ9F 1YJ9F 3MCAB 1XBIA 1GZ0A 2FC3A 3CCMF 1K73H 3LWRC 4BVRA 1VQ7F 2KTVA 1YHQF 1W3EX 4BVTA 1VQOF 4LCKA 5HY0A 1KD1H 1H7MA 1RA4A 1T0KB 5DCVA 1W42A 3CC2F 1NJIH 3V7EA 2CZWA 1RLGA 3RA6A 2VGNA 3CC7F 4EI9A 3NK7A 4EI7A 3GYQA 4TZZA 3CCQF 2FGYA 4XCQA 3HJWC 2GLZA 1VQ8F 3CD6F 1YIJF 4X3LA 3CPWF 3G4SF 3RA5A 1M90H 3IR9A 3OBYA 1W2BF 1N8RH 3CMEF 5G4UC 1PXWA 2OHWA 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E20 B;  1Q7Y H;  1VQ5 F;  3SIU A;  3J81 M;  1DT9 A;  1VQM F;  1ZWZ A;  3CCL F;  3AGK A;  4C4W C;  3CXC F;  1Q82 H;  1K9M H;  3ON1 A;  1Q86 H;  1SDS A;  2I6D A;  1JJ2 F;  2KG4 A;  4X3M A;  5GIO C;  3G71 F;  3SIV A;  1X7O A;  2QA4 F;  5A2Q M;  3HAX D;  1GO0 A;  3N4Z A;  5FLX M;  3CG6 A;  1VQ4 F;  3E1Y A;  3CCV F;  5G4V C;  2OTJ F;  1YI2 F;  2WAL A;  2BO1 A;  5EO3 A;  1VQ6 F;  3CMA F;  2LBX A;  1K8A H;  3VI6 A;  3OBW A;  1VQN F;  3I55 F;  1M1K H;  3NVI B;  1VQL F;  4BY9 D;  3CCR F;  2HVY D;  2QEX F;  5GIN C;  5GAP K;  3WXM B;  5GIP C;  2OZB A;  3J80 M;  2QI2 A;  1YJN F;  3CPQ A;  1X52 A;  3LFO A;  3LWO C;  3LWQ C;  3NVK E;  2LBW A;  2ALE A;  1QVF F;  1KQS F;  3FFM A;  1YIT F;  1CK2 A;  2VGM A;  3OW2 F;  3NMU C;  3JCM M;  1VQP F;  2JNB A;  3PAF A;  1IPA A;  1X7P A;  4BW0 B;  3LWV C;  3O85 A;  1GO1 A;  1W41 A;  5FJ4 C;  2OTL F;  3V7Q A;  3JAM M;  1S72 F;  3NK6 A;  1QVG F;  2AIF A;  5EWR A;  1CN7 A;  1KC8 H;  1W40 A;  3CCE F;  1YJW F;  3CCJ F;  3CC4 F;  3J7A R;  3CCU F;  3LWP C;  5IT9 M;  3N4Y A;  1Q81 H;  1E7K A;  3G6E F;  1VQK F;  2KTU A;  3CCS F;  5GAN K;  3PLA C;  3VMF B;  4NUT A;  3I56 F;  1VQ9 F;  1YJ9 F;  3MCA B;  1XBI A;  1GZ0 A;  2FC3 A;  3CCM F;  1K73 H;  3LWR C;  1VQ7 F;  2KTV A;  1YHQ F;  1W3E X;  1VQO F;  4LCK A;  1KD1 H;  1H7M A;  1RA4 A;  1T0K B;  5DCV A;  1W42 A;  3CC2 F;  1NJI H;  3V7E A;  2CZW A;  1RLG A;  3RA6 A;  2VGN A;  3CC7 F;  3NK7 A;  3GYQ A;  4TZZ A;  3CCQ F;  3HJW C;  1VQ8 F;  3CD6 F;  1YIJ F;  4X3L A;  3CPW F;  3G4S F;  3RA5 A;  1M90 H;  3IR9 A;  3OBY A;  1W2B F;  1N8R H;  3CME F;  5G4U C;  1PXW A;  2OHW A;  1NMU B; 
#chains in the Genus database with same CATH topology
 1W5B A;  1ZWZ A;  1W59 A;  4C4W C;  2PHN A;  3AGK A;  3WJQ A;  4BT5 A;  1SDS A;  2KG4 A;  4BT4 A;  2CHT A;  4I4T A;  5A2Q M;  3HAX D;  1VQ4 F;  3CG6 A;  4NWO B;  3E1Y A;  5HY4 A;  1H47 A;  4RQO A;  1VQ6 F;  3HKB B;  2KGW A;  2Z1F A;  2HS4 A;  3VYU C;  2Q1X A;  5LP6 C;  3D01 A;  3NVI B;  3IKF A;  3QTY A;  5JCO C;  4O4J B;  4DXD A;  2VXY A;  1GX1 A;  5ITZ A;  1COM A;  4IIJ B;  2UYJ A;  5IJ9 A;  5MN4 A;  1QVF F;  1ODE A;  3ZP4 A;  1CK2 A;  1R1M A;  1IV2 A;  1JD1 A;  5HY1 A;  3NMU C;  3PAF A;  4DRX A;  1X7P A;  2VAP A;  4I55 A;  1W41 A;  3WJR A;  2HRY A;  1W57 A;  2HP0 B;  1S72 F;  1FFX B;  5LP6 A;  4G4Z A;  3JAW A;  5EWR A;  1CN7 A;  4TV8 B;  4X1I B;  4X1K A;  3CC4 F;  5LOV B;  3ELC A;  5IT9 M;  4EI8 A;  2GZL A;  5JQG A;  1TUB B;  1YJ9 F;  1GZ0 A;  5J2U A;  3ZOP A;  5EIB C;  5CA0 B;  5JVD B;  2ZVY A;  2H6L A;  1W3E X;  5DCV A;  1RA4 A;  2G9I A;  1T0K B;  5CA1 B;  3N2K A;  4EI9 A;  4EI7 A;  3DC2 A;  3LYB A;  3HKD A;  1VHA A;  3F0E A;  1YIJ F;  1ONI A;  3JAS B;  5KMG A;  3RA5 A;  2UYN B;  2AMT A;  3ESJ A;  5EIB D;  1W2B F;  4C82 A;  4ZOL A;  3RYI A;  4B46 A;  4ZHW A;  1Q8R A;  2W8B C;  3E20 B;  1XV2 A;  3JAT A;  4O4H B;  4FFB B;  1DT9 A;  4O4L B;  4KWE A;  1VQM F;  3DDN A;  1Q82 H;  3GHZ A;  1K9M H;  4WBN A;  1Q86 H;  1JFF A;  1W5A A;  3CYP B;  2LBT A;  3IEQ A;  4F6R A;  3EOR A;  3VCZ A;  4TUY A;  2Z1T A;  1X7O A;  1U43 A;  5BMV A;  5IJ0 B;  3KIZ A;  4IHJ A;  2UYK A;  3JVH A;  2R75 1;  4ZI7 A;  5FLX M;  3HTN A;  2ZOD A;  1GO0 A;  4YJ3 A;  4I4T B;  3T80 A;  2OTJ F;  2QTP A;  2BO1 A;  5EO3 A;  5HXU A;  3CMA F;  5JH7 A;  1QU9 A;  4EB6 A;  3V3T A;  1T0A A;  1CLI A;  4C8E A;  2Z1E A;  3MQW A;  4X20 B;  5CB4 B;  1M1K H;  3K14 A;  2Q1Y A;  2F9Z C;  1VQL F;  3CCR F;  2RHH A;  1J7H A;  2HVY D;  2QEX F;  4LNU A;  3HKC A;  4TV9 A;  5GAP K;  5ITZ B;  5J2T A;  3J80 M;  2QI2 A;  2V9Y A;  5EAZ A;  3LWQ C;  4NQ3 A;  1PF5 A;  3FBA A;  4G88 A;  1JY8 A;  5LA6 A;  3K2X A;  3K12 A;  5HWE A;  3OW2 F;  1VQP F;  3E22 A;  1IPA A;  3WGJ A;  4X1Y B;  2YXZ A;  4YJ2 A;  3V7Q A;  2IAF A;  4I55 B;  3C9R A;  2AIF A;  5EZY A;  3I7T A;  3TD4 A;  5IYZ B;  1KC8 H;  3CCE F;  5LP6 B;  1XHO A;  4O4I A;  3V4D A;  3JAW B;  3CCJ F;  4HNA B;  3F0D A;  3LWP C;  5MN6 A;  3CYQ A;  5HP7 A;  2UYP A;  2I6R A;  5MN5 A;  4ZHQ A;  3WPW A;  3IKE A;  3P4E A;  3G6E F;  1VQK F;  4ZK7 A;  5GAN K;  3PLA C;  4G4V A;  4ZHY B;  3I56 F;  1KNK A;  1VQ9 F;  1RQ7 A;  3CCM F;  4U3J A;  3B6N A;  4ERH A;  1SA0 B;  3LWR C;  1VQ7 F;  2P6Y A;  5J2U B;  2ZAU A;  5EB0 A;  3M4S A;  5HY0 A;  1KD1 H;  3C9U A;  1TVK A;  1X25 A;  3RYC B;  5C8Y A;  2CZW A;  1RLG A;  3CC7 F;  3WGK A;  3JAL B;  3GYQ A;  3CCQ F;  3N2K B;  5LXT B;  4X3L A;  3HKD B;  4E6E A;  3KJJ A;  3M84 A;  5KMG B;  4M8I A;  1PXW A;  1U40 A;  5G4U C;  1OFU A;  2HX0 A;  5KX5 A;  3JAR A;  4O4J A;  1NMU B;  2IG8 A;  4BVT A;  3GTZ A;  2R6R 1;  1VQ5 F;  3SIU A;  3RYI B;  3M1X A;  3JAT B;  3CXC F;  3ZO8 A;  3ON1 A;  5FNV A;  1FNK A;  3WJP A;  4X3M A;  5GIO C;  1UI9 A;  3G71 F;  1JFF B;  3SIV A;  4F6R B;  1U3P A;  4TUY B;  3VOA A;  2Z1U A;  4B45 A;  3CCV F;  2N48 A;  3TD5 A;  4IHJ B;  2EWC A;  3OON A;  2WAL A;  3F0F A;  2B33 A;  2LCA A;  4YJ3 B;  3LDT A;  2HP0 A;  3UT5 B;  3VI6 A;  4EB6 B;  2CWJ A;  3RYF A;  1QD9 A;  3I55 F;  3VYT C;  2BTO A;  1W55 A;  5GIN C;  1YGY A;  3S0Y A;  4X1I A;  4BT2 A;  1W5F A;  5LOV A;  3VIU A;  4LNU B;  3WPX A;  3WXM B;  3HKC B;  4TV9 B;  1YJN F;  3RYH A;  3CPQ A;  1X52 A;  2IQQ A;  3U0O A;  3LWO C;  1SZQ A;  4O2B A;  5LYJ A;  2LBW A;  3N2G A;  2ALE A;  2ZVZ A;  1TUB A;  3WGN A;  3FFM A;  1VH8 A;  2VGM A;  4G4W A;  5CA0 A;  5JVD A;  5LA6 B;  4BW0 B;  3LWV C;  3O85 A;  5FJ4 C;  3MDO A;  3E22 B;  2OTL F;  2HS0 A;  3JAM M;  3MBM A;  3NK6 A;  4I50 A;  1OAP A;  1U3L A;  4YJ2 B;  3S03 A;  3QHD A;  4BT7 A;  3P0Z A;  2AIZ P;  5EZY B;  2UYN A;  3VTI C;  3S0W A;  3JAK A;  3CCU F;  3Q8H A;  2PMP A;  2BTU A;  5AVM A;  1VQV A;  1E7K A;  1QAH A;  5GON A;  3CCS F;  2CVL A;  5IJ9 B;  3LME A;  3VMF B;  3P10 A;  4ZHQ B;  2FC3 A;  3KE1 A;  3WGM A;  1K73 H;  3ZP7 A;  2KTV A;  3C8L A;  1RQ2 A;  4O2A A;  4DRX B;  4U3J B;  1YHQ F;  2ZF8 A;  1NQ3 A;  5HP8 A;  5IJ0 A;  1W42 A;  1NJI H;  5B8F A;  1IV1 A;  3HKE A;  2VGN A;  3L7Q A;  4C8I A;  2HQS C;  1TVK B;  4B62 A;  5C8Y B;  2FGY A;  3S02 A;  2GLZ A;  3HJW C;  2OTM A;  1VQ8 F;  3HWU A;  3KHN A;  5EB1 B;  4G4Y A;  3G4S F;  1M90 H;  2L26 A;  2NMU A;  3S06 A;  4X1K B;  3IR9 A;  3ERN A;  5EYP A;  3OBY A;  1N8R H;  3CME F;  4X20 A;  5CB4 A;  2OHW A;  3D54 A;  3V7E A;  1Q7Y H;  2DYY A;  3J81 M;  5KX5 B;  3JAR B;  5JQG B;  4BVQ A;  3CCL F;  2I6D A;  1XRG A;  1JJ2 F;  4BVS A;  5FNV B;  2MQE A;  2RHJ A;  3VO8 A;  1UFY A;  2QA4 F;  3WGL A;  3N4Z A;  3HKB A;  5G4V C;  2HP3 A;  2HS3 A;  1YI2 F;  4X1Y A;  3VOB A;  1JN1 A;  3D00 A;  1Z5V A;  2LBX A;  4RHA A;  1K8A H;  4G4X A;  3IMP A;  4C81 A;  3OBW A;  1VQN F;  5IYZ A;  4ZOL B;  3R0P A;  2H8C A;  4BY9 D;  3RYF B;  3C9T A;  5JCO A;  4HNA A;  4IIJ A;  2K1S A;  1VK3 A;  5HXZ A;  4WBN B;  5GIP C;  3CB2 A;  2OZB A;  4C8G A;  3LFO A;  3NVK E;  1W5E A;  3RYH B;  5BMV B;  1KQS F;  2CSL A;  3IEW A;  1YIT F;  4PWT A;  4O2B B;  5LYJ B;  3K0T A;  4ZI7 B;  1FNJ A;  3N2G B;  1SA0 A;  2HRU A;  1IV3 A;  3JCM M;  2JNB A;  4U39 A;  1IV4 A;  3BYQ A;  4R40 B;  1FFX A;  1GO1 A;  5JH7 B;  3FPI A;  3RYC A;  5HY2 A;  3MCQ A;  4TV8 A;  3RE3 A;  2ZOV A;  3JAL A;  1QVG F;  2VAM A;  2RHO A;  4I50 B;  1YQN A;  1W40 A;  3F0G A;  5LXT A;  1KNJ A;  1YJW F;  3S0H A;  2H8E A;  3J7A R;  4BT6 A;  3FD5 A;  2BTQ B;  3N4Y A;  3JAK B;  5J2T B;  1Q81 H;  3KJK A;  2KTU A;  1W58 1;  5GON B;  4NUT A;  1RLU A;  2CW4 A;  2GVI A;  3MCA B;  1XBI A;  4BVR A;  2UZH A;  4ZHV A;  3C9S A;  3TD3 A;  5CA1 A;  1VQO F;  4LCK A;  2CHS A;  4BT3 A;  1H7M A;  2YYE A;  4O2A B;  3FD6 A;  2RHL A;  3CC2 F;  3RA6 A;  3NK7 A;  2RB9 A;  3VYS C;  1H48 A;  3QUW A;  4TZZ A;  3JAS A;  3HKE B;  3I3F A;  4XCQ A;  4B5C A;  1DBF A;  3CD6 F;  1FSZ A;  3F6M A;  4O4I B;  3CPW F;  3UT5 A;  2VAW A;  2Z01 A;  4O4H A;  4FFB A;  4O4L A;  2DT4 A;  1Z5W A;  5EYP B; 
#chains in the Genus database with same CATH homology
 3E20 B;  1Q7Y H;  1VQ5 F;  3SIU A;  3J81 M;  1DT9 A;  1VQM F;  1ZWZ A;  4BVQ A;  3CCL F;  3AGK A;  4C4W C;  3CXC F;  1Q82 H;  1K9M H;  3ON1 A;  1Q86 H;  1SDS A;  2I6D A;  1JJ2 F;  2KG4 A;  4X3M A;  5GIO C;  3G71 F;  4BVS A;  3SIV A;  1X7O A;  2QA4 F;  5A2Q M;  3HAX D;  1GO0 A;  3N4Z A;  5FLX M;  3CG6 A;  5HY4 A;  3E1Y A;  1VQ4 F;  3CCV F;  5G4V C;  2OTJ F;  1YI2 F;  2WAL A;  2BO1 A;  5EO3 A;  1VQ6 F;  5HXU A;  3D00 A;  3CMA F;  2LBX A;  3V3T A;  1K8A H;  3VI6 A;  3OBW A;  1VQN F;  3I55 F;  1M1K H;  3NVI B;  2F9Z C;  1VQL F;  4BY9 D;  3CCR F;  2HVY D;  2QEX F;  5GIN C;  5GAP K;  5HXZ A;  3WXM B;  5GIP C;  2OZB A;  3J80 M;  2QI2 A;  1YJN F;  3CPQ A;  1X52 A;  3LFO A;  3LWO C;  3LWQ C;  3NVK E;  4NQ3 A;  2LBW A;  2ALE A;  1QVF F;  1KQS F;  3FFM A;  1YIT F;  1CK2 A;  2VGM A;  5HY1 A;  5HWE A;  3OW2 F;  3NMU C;  3JCM M;  1VQP F;  2JNB A;  3PAF A;  1IPA A;  1X7P A;  4BW0 B;  3LWV C;  3O85 A;  1GO1 A;  1W41 A;  5FJ4 C;  2OTL F;  5HY2 A;  3V7Q A;  3JAM M;  1S72 F;  3NK6 A;  1QVG F;  2AIF A;  5EWR A;  1CN7 A;  1KC8 H;  1W40 A;  3CCE F;  1YJW F;  3CCJ F;  3CC4 F;  3J7A R;  3CCU F;  3LWP C;  5IT9 M;  3N4Y A;  1Q81 H;  1E7K A;  4EI8 A;  3G6E F;  2KTU A;  3CCS F;  1VQK F;  5GAN K;  3PLA C;  3VMF B;  4NUT A;  3I56 F;  1VQ9 F;  1YJ9 F;  3MCA B;  1XBI A;  1GZ0 A;  2FC3 A;  3CCM F;  1K73 H;  3LWR C;  4BVR A;  1VQ7 F;  2KTV A;  1YHQ F;  1W3E X;  4BVT A;  1VQO F;  4LCK A;  5HY0 A;  1KD1 H;  1H7M A;  1RA4 A;  1T0K B;  5DCV A;  1W42 A;  3CC2 F;  1NJI H;  3V7E A;  2CZW A;  1RLG A;  3RA6 A;  2VGN A;  3CC7 F;  4EI9 A;  3NK7 A;  4EI7 A;  3GYQ A;  4TZZ A;  3CCQ F;  2FGY A;  4XCQ A;  3HJW C;  2GLZ A;  1VQ8 F;  3CD6 F;  1YIJ F;  4X3L A;  3CPW F;  3G4S F;  3RA5 A;  1M90 H;  3IR9 A;  3OBY A;  1W2B F;  1N8R H;  3CME F;  5G4U C;  1PXW A;  2OHW A;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...