2HQSC

Crystal structure of tolb/pal complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolB
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/lipoprotein
total genus 35
structure length 107
sequence length 107
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2hqsC00
4G88A 2K1SA 2LCAA 3IMPA 3CYQA 2AIZP 2N48A 4G4YA 4PWTA 3CYPB 3S0WA 1R1MA 4ZHVA 3WPWA 2KGWA 3S0YA 3WPXA 4ERHA 2ZF8A 4G4XA 5EAZA 4ZHYB 3KHNA 3TD4A 3TD3A 4G4ZA 4B5CA 3OONA 4R40B 1OAPA 3S0HA 4B62A 4ZHWA 4G4WA 4RHAA 3S02A 2L26A 3S06A 3LDTA 5EB1B 2HQSC 2LBTA 3TD5A 5EB0A 2MQEA 4G4VA 2W8BC 2ZOVA 2ZVZA 3S03A 2ZVYA
chains in the Genus database with same CATH superfamily
5JCOC 1NQ3A 2HP3A 3CMEF 1H47A 3HKEA 1TUBB 3RYHA 3V4DA 5IJ9A 2VAWA 2VGMA 4I50B 2RB9A 2CVLA 5GONA 2ZODA 3B6NA 5EYPB 1SA0B 2Z01A 3C8LA 3V7EA 5GINC 3VMFB 3LYBA 3S0HA 4U3JB 3JALA 1IV2A 3HKDB 4X20B 3LDTA 1X52A 4C82A 1QVFF 3F6MA 1TVKB 5IYZA 5LOVB 1ONIA 2I6RA 5LXTA 1RLUA 1SDSA 2CSLA 3IMPA 3I7TA 3CCEF 1YI2F 5CA0B 4PWTA 4U39A 1VQNF 3OBWA 2AIFA 3ESJA 4O4JB 5JVDA 4X1YB 4X1KA 2LBXA 1RLGA 1W40A 1NMUB 3TD4A 3HKCB 3JAKB 4B5CA 4O4LA 4TV9B 3D54A 5EIBC 3ZP7A 4YJ2B 1RQ2A 2Q1YA 5EB1B 4BT3A 2FC3A 1VQVA 3N4ZA 3ERNA 3EORA 3LWQC 3VCZA 1IV3A 2KTUA 1X25A 4BW0B 5LYJA 3JASB 3JAMM 3CCUF 2UYJA 3IKEA 2HS0A 1KD1H 5G4VC 4I55B 4NWOB 3CC4F 5FNVA 4IIJB 4F6RB 1T0AA 5EZYB 5JCOA 4G4WA 4ZHWA 4O2BB 1KQSF 2GZLA 4O4HA 1KNKA 3I3FA 2HRYA 1XBIA 3CB2A 2QI2A 3HKDA 3OW2F 1CN7A 1YJWF 2Z1EA 4EB6B 1VQ7F 1FFXB 4O4IA 1UFYA 1J7HA 2KGWA 4BT7A 3VIUA 5HP7A 4LNUA 3P4EA 5J2UB 5EO3A 4FFBB 3RYFB 1IPAA 3HKCA 3JAKA 5HWEA 2PHNA 4TV9A 1K9MH 4BT6A 2W8BC 3JATB 1K73H 4YJ2A 3NVKE 3ZP4A 3HKBA 2K1SA 5DCVA 2HVYD 1M1KH 3IEQA 3K2XA 3V3TA 3JASA 5MN4A 1JFFB 1Q86H 4BVQA 3NK7A 2V9YA 3M1XA 3KJJA 4I55A 1YJ9F 5LP6A 4DRXB 1XV2A 3WJQA 3HTNA 4YJ3B 2UYNB 3IR9A 4IIJA 3P0ZA 3CCRF 4HNAB 4TV8B 5EZYA 3CD6F 3IKFA 4O2BA 3O85A 3CCLF 5J2TA 5IT9M 3F0EA 3PAFA 2UZHA 3WGMA 3VTIC 4G4YA 2H6LA 3FD6A 3ELCA 4WBNB 3U0OA 3WXMB 2R751 4I4TA 1FFXA 5KMGB 3E1YA 4BT4A 2JNBA 1VQ5F 3JCMM 3HAXD 1W5BA 3CMAF 2UYKA 4BT2A 1OFUA 3WGNA 2L26A 2OTJF 3FD5A 5J2UA 2NMUA 4RQOA 1E7KA 3RYFA 5GIOC 1GX1A 4TUYB 5LA6A 3Q8HA 4ZK7A 1Q81H 1Z5VA 2AMTA 3JATA 5BMVB 1M90H 1T0KB 2HX0A 3S0WA 4X3MA 1VQOF 1IV4A 3L7QA 1NJIH 1QAHA 3E22A 3ZO8A 2VAMA 4O2AB 1VQLF 1JFFA 2BTUA 3MDOA 4G4ZA 1W59A 5JQGA 3NMUC 3MCAB 1CK2A 4DRXA 2ZAUA 2WALA 1W42A 3G6EF 5EB0A 3CG6A 3NVIB 2UYNA 2MQEA 4M8IA 3CC2F 4ZHQB 5KX5B 4BVSA 3N2KB 2CHTA 2B33A 3N2GB 3C9UA 2CZWA 3CCMF 1R1MA 3MQWA 1VHAA 2H8CA 3WGKA 2DT4A 1S72F 1U3PA 1VQKF 1TUBA 2F9ZC 4IHJB 3WPXA 2OZBA 4I50A 4WBNA 1H48A 1XHOA 1W41A 5EYPA 3VO8A 5KMGA 1GO0A 4ZOLB 1SA0A 4E6EA 3E20B 5EWRA 1COMA 3VOBA 4ZI7B 3LMEA 2HP0B 4U3JA 4ZHYB 1VQMF 3RA5A 4X20A 5AVMA 4BVTA 5A2QM 3F0FA 1W5AA 2LCAA 1VQ9F 1TVKA 5LOVA 3C9SA 3AGKA 3F0DA 5BMVA 2BTOA 4C4WC 3I56F 3WJRA 1W5EA 4ERHA 5CA0A 3K12A 1VQ4F 4LCKA 3JARB 3KHNA 4KWEA 4O4JA 1JD1A 1FSZA 4R40B 4X1YA 3G4SF 1FNJA 1KC8H 4TZZA 1YHQF 4O2AA 3KJKA 1JJ2F 1YJNF 3D00A 3HKEB 1PF5A 5IJ0B 2LBWA 3RYHB 3CPWF 5IJ9B 2OTMA 3S03A 5GONB 2CHSA 3CCVF 4G88A 2VAPA 1RQ7A 5KX5A 3RA6A 2VGNA 2AIZP 3CXCF 3N2GA 3LWOC 4XCQA 2QA4F 1VK3A 3WPWA 4NUTA 2IQQA 3JVHA 4IHJA 3C9RA 5C8YB 3QUWA 5IYZB 5MN5A 4RHAA 2BTQB 2FGYA 2Q1XA 4DXDA 3M84A 4F6RA 1U40A 4G4VA 2YYEA 2VXYA 2ZVZA 4B46A 4NQ3A 3SIVA 5HY4A 1K8AH 5GIPC 2HP0A 3ON1A 1U43A 5CA1B 2UYPA 2CWJA 3SIUA 4ZHVA 3P10A 1W2BF 3HJWC 3KE1A 3C9TA 4O4LB 4G4XA 4EB6A 1VQ6F 1SZQA 5ITZB 3CCJF 5JH7B 3WGJA 1QU9A 1X7PA 2PMPA 2BO1A 3JARA 3HWUA 2KG4A 1FNKA 3UT5B 2RHHA 2P6YA 5LYJB 2ZVYA 4FFBA 5HY0A 2R6R1 5CB4B 5IJ0A 3N4YA 2HRUA 3JAWB 3LWPC 3K0TA 1ODEA 1JN1A 1Q8RA 1W57A 3DDNA 5FNVB 5FJ4C 3RYCB 3TD3A 2Z1FA 4O4HB 3OONA 3LFOA 2RHJA 4B62A 4X3LA 5C8YA 1N8RH 1W55A 2HQSC 3GYQA 3FPIA 1RA4A 4YJ3A 4BT5A 2QTPA 2OTLF 4C8IA 2Z1UA 2RHLA 4O4IB 1Q82H 2YXZA 4HNAA 4TV8A 1VH8A 3FBAA 3F0GA 4LNUB 3CC7F 3S0YA 3K14A 4BVRA 5CA1A 2ZF8A 2QEXF 3VYSC 3CCSF 1OAPA 3IEWA 5ITZA 1CLIA 2IAFA 5JH7A 2G9IA 5LP6C 3HKBB 3G71F 3TD5A 3RYIB 3T80A 1Z5WA 1DT9A 1KNJA 2ZOVA 3CCQF 2HS3A 1PXWA 3UT5A 4BY9D 3MCQA 1VQPF 5CB4A 1YIJF 3WJPA 4TUYA 5HP8A 1QD9A 3CPQA 3JAWA 5LP6B 5EIBD 3I55F 5GANK 3PLAC 2ALEA 3GTZA 4X1IB 4EI8A 3RYCA 5GAPK 2KTVA 3S02A 3S06A 3OBYA 3LWVC 5J2TB 5HXUA 1UI9A 3QHDA 1H7MA 5HY2A 3J81M 1VQ8F 4C8GA 3VYTC 1QVGF 2RHOA 1W5FA 3J80M 3NK6A 3KIZA 4I4TB 1GZ0A 3V7QA 4ZHQA 3J7AR 3N2KA 3CYPB 1XRGA 2GVIA 3MBMA 1X7OA 1W3EX 2I6DA 1Q7YH 5G4UC 3JALB 1YITF 1JY8A 3QTYA 5B8FA 3VYUC 1YQNA 3VI6A 1ZWZA 3D01A 5LA6B 3VOAA 5LXTB 4ZOLA 1DBFA 2DYYA 4B45A 3DC2A 2OHWA 1IV1A 3RYIA 2GLZA 3GHZA 4ZI7A 4C81A 5FLXM 3WGLA 3CYQA 5JVDB 2N48A 3E22B 4X1KB 2IG8A 3R0PA 4EI9A 3FFMA 5JQGB 2CW4A 5EAZA 3M4SA 5MN6A 1W581 1U3LA 5HXZA 3ZOPA 2HS4A 2EWCA 4EI7A 3BYQA 3RE3A 4X1IA 4C8EA 5HY1A 2LBTA 3LWRC 2Z1TA 1GO1A 2H8EA 1YGYA
chains in the Genus database with same CATH topology
4G88A 2K1SA 2LCAA 3IMPA 3CYQA 2AIZP 2N48A 4G4YA 4PWTA 3CYPB 3S0WA 1R1MA 4ZHVA 3WPWA 2KGWA 3S0YA 3WPXA 4ERHA 2ZF8A 4G4XA 5EAZA 4ZHYB 3KHNA 3TD4A 3TD3A 4G4ZA 4B5CA 3OONA 4R40B 1OAPA 3S0HA 4B62A 4ZHWA 4G4WA 4RHAA 3S02A 2L26A 3S06A 3LDTA 5EB1B 2HQSC 2LBTA 3TD5A 5EB0A 2MQEA 4G4VA 2W8BC 2ZOVA 2ZVZA 3S03A 2ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G88 A;  2K1S A;  2LCA A;  3IMP A;  3CYQ A;  2AIZ P;  2N48 A;  4G4Y A;  4PWT A;  3CYP B;  3S0W A;  1R1M A;  4ZHV A;  3WPW A;  2KGW A;  3S0Y A;  3WPX A;  4ERH A;  2ZF8 A;  4G4X A;  5EAZ A;  4ZHY B;  3KHN A;  3TD4 A;  3TD3 A;  4G4Z A;  4B5C A;  3OON A;  4R40 B;  1OAP A;  3S0H A;  4B62 A;  4ZHW A;  4G4W A;  4RHA A;  3S02 A;  2L26 A;  3S06 A;  3LDT A;  5EB1 B;  2HQS C;  2LBT A;  3TD5 A;  5EB0 A;  2MQE A;  4G4V A;  2W8B C;  2ZOV A;  2ZVZ A;  3S03 A;  2ZVY A; 
#chains in the Genus database with same CATH topology
 5JCO C;  1NQ3 A;  2HP3 A;  3CME F;  1H47 A;  3HKE A;  1TUB B;  3RYH A;  3V4D A;  5IJ9 A;  2VAW A;  2VGM A;  4I50 B;  2RB9 A;  2CVL A;  5GON A;  2ZOD A;  3B6N A;  5EYP B;  1SA0 B;  2Z01 A;  3C8L A;  3V7E A;  5GIN C;  3VMF B;  3LYB A;  3S0H A;  4U3J B;  3JAL A;  1IV2 A;  3HKD B;  4X20 B;  3LDT A;  1X52 A;  4C82 A;  1QVF F;  3F6M A;  1TVK B;  5IYZ A;  5LOV B;  1ONI A;  2I6R A;  5LXT A;  1RLU A;  1SDS A;  2CSL A;  3IMP A;  3I7T A;  3CCE F;  1YI2 F;  5CA0 B;  4PWT A;  4U39 A;  1VQN F;  3OBW A;  2AIF A;  3ESJ A;  4O4J B;  5JVD A;  4X1Y B;  4X1K A;  2LBX A;  1RLG A;  1W40 A;  1NMU B;  3TD4 A;  3HKC B;  3JAK B;  4B5C A;  4O4L A;  4TV9 B;  3D54 A;  5EIB C;  3ZP7 A;  4YJ2 B;  1RQ2 A;  2Q1Y A;  5EB1 B;  4BT3 A;  2FC3 A;  1VQV A;  3N4Z A;  3ERN A;  3EOR A;  3LWQ C;  3VCZ A;  1IV3 A;  2KTU A;  1X25 A;  4BW0 B;  5LYJ A;  3JAS B;  3JAM M;  3CCU F;  2UYJ A;  3IKE A;  2HS0 A;  1KD1 H;  5G4V C;  4I55 B;  4NWO B;  3CC4 F;  5FNV A;  4IIJ B;  4F6R B;  1T0A A;  5EZY B;  5JCO A;  4G4W A;  4ZHW A;  4O2B B;  1KQS F;  2GZL A;  4O4H A;  1KNK A;  3I3F A;  2HRY A;  1XBI A;  3CB2 A;  2QI2 A;  3HKD A;  3OW2 F;  1CN7 A;  1YJW F;  2Z1E A;  4EB6 B;  1VQ7 F;  1FFX B;  4O4I A;  1UFY A;  1J7H A;  2KGW A;  4BT7 A;  3VIU A;  5HP7 A;  4LNU A;  3P4E A;  5J2U B;  5EO3 A;  4FFB B;  3RYF B;  1IPA A;  3HKC A;  3JAK A;  5HWE A;  2PHN A;  4TV9 A;  1K9M H;  4BT6 A;  2W8B C;  3JAT B;  1K73 H;  4YJ2 A;  3NVK E;  3ZP4 A;  3HKB A;  2K1S A;  5DCV A;  2HVY D;  1M1K H;  3IEQ A;  3K2X A;  3V3T A;  3JAS A;  5MN4 A;  1JFF B;  1Q86 H;  4BVQ A;  3NK7 A;  2V9Y A;  3M1X A;  3KJJ A;  4I55 A;  1YJ9 F;  5LP6 A;  4DRX B;  1XV2 A;  3WJQ A;  3HTN A;  4YJ3 B;  2UYN B;  3IR9 A;  4IIJ A;  3P0Z A;  3CCR F;  4HNA B;  4TV8 B;  5EZY A;  3CD6 F;  3IKF A;  4O2B A;  3O85 A;  3CCL F;  5J2T A;  5IT9 M;  3F0E A;  3PAF A;  2UZH A;  3WGM A;  3VTI C;  4G4Y A;  2H6L A;  3FD6 A;  3ELC A;  4WBN B;  3U0O A;  3WXM B;  2R75 1;  4I4T A;  1FFX A;  5KMG B;  3E1Y A;  4BT4 A;  2JNB A;  1VQ5 F;  3JCM M;  3HAX D;  1W5B A;  3CMA F;  2UYK A;  4BT2 A;  1OFU A;  3WGN A;  2L26 A;  2OTJ F;  3FD5 A;  5J2U A;  2NMU A;  4RQO A;  1E7K A;  3RYF A;  5GIO C;  1GX1 A;  4TUY B;  5LA6 A;  3Q8H A;  4ZK7 A;  1Q81 H;  1Z5V A;  2AMT A;  3JAT A;  5BMV B;  1M90 H;  1T0K B;  2HX0 A;  3S0W A;  4X3M A;  1VQO F;  1IV4 A;  3L7Q A;  1NJI H;  1QAH A;  3E22 A;  3ZO8 A;  2VAM A;  4O2A B;  1VQL F;  1JFF A;  2BTU A;  3MDO A;  4G4Z A;  1W59 A;  5JQG A;  3NMU C;  3MCA B;  1CK2 A;  4DRX A;  2ZAU A;  2WAL A;  1W42 A;  3G6E F;  5EB0 A;  3CG6 A;  3NVI B;  2UYN A;  2MQE A;  4M8I A;  3CC2 F;  4ZHQ B;  5KX5 B;  4BVS A;  3N2K B;  2CHT A;  2B33 A;  3N2G B;  3C9U A;  2CZW A;  3CCM F;  1R1M A;  3MQW A;  1VHA A;  2H8C A;  3WGK A;  2DT4 A;  1S72 F;  1U3P A;  1VQK F;  1TUB A;  2F9Z C;  4IHJ B;  3WPX A;  2OZB A;  4I50 A;  4WBN A;  1H48 A;  1XHO A;  1W41 A;  5EYP A;  3VO8 A;  5KMG A;  1GO0 A;  4ZOL B;  1SA0 A;  4E6E A;  3E20 B;  5EWR A;  1COM A;  3VOB A;  4ZI7 B;  3LME A;  2HP0 B;  4U3J A;  4ZHY B;  1VQM F;  3RA5 A;  4X20 A;  5AVM A;  4BVT A;  5A2Q M;  3F0F A;  1W5A A;  2LCA A;  1VQ9 F;  1TVK A;  5LOV A;  3C9S A;  3AGK A;  3F0D A;  5BMV A;  2BTO A;  4C4W C;  3I56 F;  3WJR A;  1W5E A;  4ERH A;  5CA0 A;  3K12 A;  1VQ4 F;  4LCK A;  3JAR B;  3KHN A;  4KWE A;  4O4J A;  1JD1 A;  1FSZ A;  4R40 B;  4X1Y A;  3G4S F;  1FNJ A;  1KC8 H;  4TZZ A;  1YHQ F;  4O2A A;  3KJK A;  1JJ2 F;  1YJN F;  3D00 A;  3HKE B;  1PF5 A;  5IJ0 B;  2LBW A;  3RYH B;  3CPW F;  5IJ9 B;  2OTM A;  3S03 A;  5GON B;  2CHS A;  3CCV F;  4G88 A;  2VAP A;  1RQ7 A;  5KX5 A;  3RA6 A;  2VGN A;  2AIZ P;  3CXC F;  3N2G A;  3LWO C;  4XCQ A;  2QA4 F;  1VK3 A;  3WPW A;  4NUT A;  2IQQ A;  3JVH A;  4IHJ A;  3C9R A;  5C8Y B;  3QUW A;  5IYZ B;  5MN5 A;  4RHA A;  2BTQ B;  2FGY A;  2Q1X A;  4DXD A;  3M84 A;  4F6R A;  1U40 A;  4G4V A;  2YYE A;  2VXY A;  2ZVZ A;  4B46 A;  4NQ3 A;  3SIV A;  5HY4 A;  1K8A H;  5GIP C;  2HP0 A;  3ON1 A;  1U43 A;  5CA1 B;  2UYP A;  2CWJ A;  3SIU A;  4ZHV A;  3P10 A;  1W2B F;  3HJW C;  3KE1 A;  3C9T A;  4O4L B;  4G4X A;  4EB6 A;  1VQ6 F;  1SZQ A;  5ITZ B;  3CCJ F;  5JH7 B;  3WGJ A;  1QU9 A;  1X7P A;  2PMP A;  2BO1 A;  3JAR A;  3HWU A;  2KG4 A;  1FNK A;  3UT5 B;  2RHH A;  2P6Y A;  5LYJ B;  2ZVY A;  4FFB A;  5HY0 A;  2R6R 1;  5CB4 B;  5IJ0 A;  3N4Y A;  2HRU A;  3JAW B;  3LWP C;  3K0T A;  1ODE A;  1JN1 A;  1Q8R A;  1W57 A;  3DDN A;  5FNV B;  5FJ4 C;  3RYC B;  3TD3 A;  2Z1F A;  4O4H B;  3OON A;  3LFO A;  2RHJ A;  4B62 A;  4X3L A;  5C8Y A;  1N8R H;  1W55 A;  2HQS C;  3GYQ A;  3FPI A;  1RA4 A;  4YJ3 A;  4BT5 A;  2QTP A;  2OTL F;  4C8I A;  2Z1U A;  2RHL A;  4O4I B;  1Q82 H;  2YXZ A;  4HNA A;  4TV8 A;  1VH8 A;  3FBA A;  3F0G A;  4LNU B;  3CC7 F;  3S0Y A;  3K14 A;  4BVR A;  5CA1 A;  2ZF8 A;  2QEX F;  3VYS C;  3CCS F;  1OAP A;  3IEW A;  5ITZ A;  1CLI A;  2IAF A;  5JH7 A;  2G9I A;  5LP6 C;  3HKB B;  3G71 F;  3TD5 A;  3RYI B;  3T80 A;  1Z5W A;  1DT9 A;  1KNJ A;  2ZOV A;  3CCQ F;  2HS3 A;  1PXW A;  3UT5 A;  4BY9 D;  3MCQ A;  1VQP F;  5CB4 A;  1YIJ F;  3WJP A;  4TUY A;  5HP8 A;  1QD9 A;  3CPQ A;  3JAW A;  5LP6 B;  5EIB D;  3I55 F;  5GAN K;  3PLA C;  2ALE A;  3GTZ A;  4X1I B;  4EI8 A;  3RYC A;  5GAP K;  2KTV A;  3S02 A;  3S06 A;  3OBY A;  3LWV C;  5J2T B;  5HXU A;  1UI9 A;  3QHD A;  1H7M A;  5HY2 A;  3J81 M;  1VQ8 F;  4C8G A;  3VYT C;  1QVG F;  2RHO A;  1W5F A;  3J80 M;  3NK6 A;  3KIZ A;  4I4T B;  1GZ0 A;  3V7Q A;  4ZHQ A;  3J7A R;  3N2K A;  3CYP B;  1XRG A;  2GVI A;  3MBM A;  1X7O A;  1W3E X;  2I6D A;  1Q7Y H;  5G4U C;  3JAL B;  1YIT F;  1JY8 A;  3QTY A;  5B8F A;  3VYU C;  1YQN A;  3VI6 A;  1ZWZ A;  3D01 A;  5LA6 B;  3VOA A;  5LXT B;  4ZOL A;  1DBF A;  2DYY A;  4B45 A;  3DC2 A;  2OHW A;  1IV1 A;  3RYI A;  2GLZ A;  3GHZ A;  4ZI7 A;  4C81 A;  5FLX M;  3WGL A;  3CYQ A;  5JVD B;  2N48 A;  3E22 B;  4X1K B;  2IG8 A;  3R0P A;  4EI9 A;  3FFM A;  5JQG B;  2CW4 A;  5EAZ A;  3M4S A;  5MN6 A;  1W58 1;  1U3L A;  5HXZ A;  3ZOP A;  2HS4 A;  2EWC A;  4EI7 A;  3BYQ A;  3RE3 A;  4X1I A;  4C8E A;  5HY1 A;  2LBT A;  3LWR C;  2Z1T A;  1GO1 A;  2H8E A;  1YGY A; 
#chains in the Genus database with same CATH homology
 4G88 A;  2K1S A;  2LCA A;  3IMP A;  3CYQ A;  2AIZ P;  2N48 A;  4G4Y A;  4PWT A;  3CYP B;  3S0W A;  1R1M A;  4ZHV A;  3WPW A;  2KGW A;  3S0Y A;  3WPX A;  4ERH A;  2ZF8 A;  4G4X A;  5EAZ A;  4ZHY B;  3KHN A;  3TD4 A;  3TD3 A;  4G4Z A;  4B5C A;  3OON A;  4R40 B;  1OAP A;  3S0H A;  4B62 A;  4ZHW A;  4G4W A;  4RHA A;  3S02 A;  2L26 A;  3S06 A;  3LDT A;  5EB1 B;  2HQS C;  2LBT A;  3TD5 A;  5EB0 A;  2MQE A;  4G4V A;  2W8B C;  2ZOV A;  2ZVZ A;  3S03 A;  2ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...