2HQSC

Crystal structure of tolb/pal complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/lipoprotein
molecule keywords Protein tolB
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 107
sequence length 107
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2hqsC00
5EAZA 2LCAA 2L26A 2K1SA 2LBTA 4B62A 3CYPB 3CYQA 3S0HA 4G4ZA 4B5CA 2ZOVA 3S02A 2ZF8A 2N48A 4ZHWA 2AIZP 2ZVZA 1OAPA 2MQEA 3TD3A 2HQSC 3OONA 4G4VA 4R40B 3S0YA 4G4XA 2W8BC 3WPXA 4PWTA 4RHAA 4G88A 4ZHYB 3LDTA 5EB1B 2ZVYA 3TD4A 3S06A 4ZHVA 2KGWA 1R1MA 3S03A 5EB0A 3IMPA 4G4YA 3S0WA 3KHNA 4ERHA 4G4WA 3WPWA 3TD5A
chains in the Genus database with same CATH superfamily
2LCAA 5G4VC 2OTLF 3IKFA 3NK6A 1IPAA 4WBNB 4O4HB 3QHDA 2PHNA 3HKEB 2HP3A 2CWJA 3LYBA 4TUYB 1VQMF 2BTUA 1IV2A 5J2UA 2W8BC 1N8RH 1W55A 3LDTA 1W40A 3M1XA 2ZVYA 4IHJB 1W41A 3JAWB 5EB0A 4O4JB 3JCMM 3RA5A 3MCAB 3RE3A 5HY2A 1VQ6F 4I4TB 2K1SA 1W57A 1S72F 5BMVA 1QU9A 5CB4B 3G4SF 1SZQA 1U43A 4ZI7B 3S0HA 1JJ2F 2JNBA 3N2GB 1UFYA 1YJ9F 3ON1A 3CCMF 1H48A 2UYNA 2H8CA 2HQSC 3JASB 3BYQA 1KQSF 1PXWA 4ZHQA 5EIBC 3WJQA 2Z1EA 3C9SA 4G88A 3TD4A 4O4HA 3C8LA 3MDOA 2OHWA 3HKEA 1Q82H 4M8IA 3HJWC 3K12A 1W5EA 2FGYA 5J2TB 3SIUA 4O4IA 2GVIA 4EB6B 3CYPB 1IV1A 3CYQA 5LXTA 4BVTA 3VMFB 3JAWA 2FC3A 2VXYA 2AIZP 3OONA 2YXZA 3S0YA 1VQNF 4O4JA 4I55B 5GIPC 3NVKE 2BTOA 3CCJF 2G9IA 1JFFA 4ZI7A 3JAKA 3N2GA 4ZOLA 3ZP7A 4NUTA 1YITF 1RLGA 4C82A 5MN6A 2L26A 3I7TA 3N2KA 1FNJA 2ZAUA 2QA4F 1Q86H 1UI9A 5HXUA 1X7PA 3ZOPA 1VQKF 1Z5VA 4X1KB 3I56F 1DT9A 3KE1A 2RHHA 1ODEA 2Q1XA 5LYJB 3WGLA 5LOVA 2CZWA 5J2TA 4EB6A 4RHAA 5KMGA 3S06A 2PMPA 4NQ3A 3S0WA 1Q8RA 5JCOA 5FNVB 3CCVF 1J7HA 3VIUA 1VK3A 5J2UB 3CPWF 2VGMA 5EYPA 3B6NA 3D54A 3FD6A 4I55A 2IG8A 4BT7A 5B8FA 3D01A 4IIJA 3CCUF 2GZLA 1E7KA 3MCQA 2BO1A 5CA0A 2H8EA 2RHLA 3VYUC 1VQ8F 1TUBB 2P6YA 3Q8HA 1YI2F 1VHAA 4I50A 3V4DA 2Z1FA 2EWCA 5HWEA 2HS0A 3WGNA 3K2XA 4BVSA 5MN5A 1W581 1K9MH 4YJ3A 3I55F 1RLUA 5LP6C 3WPWA 4KWEA 1W59A 2WALA 2AMTA 1NJIH 2UZHA 1VQ5F 2F9ZC 5GIOC 1PF5A 3CB2A 2KTVA 4G4ZA 3F0EA 2CSLA 3LWVC 3S02A 1ONIA 4TV8A 3CC7F 5FNVA 3ZP4A 5G4UC 4O4IB 1FSZA 1YIJF 3F0GA 5HP7A 5LXTB 2IQQA 1VQOF 1W2BF 4BVRA 3U0OA 1TUBA 4X1IB 1TVKB 2HRUA 2QTPA 4BW0B 1JFFB 4EI9A 4C4WC 3CD6F 3PAFA 3N4YA 3JAKB 3LWQC 1M90H 4ZOLB 2RHJA 1K73H 3G71F 4C8EA 4O2AA 3N2KB 1W3EX 3HKDB 1RQ7A 2CVLA 5IJ0A 2CHTA 1GO0A 1X7OA 1VQ9F 3EORA 2QEXF 3E22A 2DYYA 4G4YA 3HKCA 1KNKA 5DCVA 4ERHA 4G4WA 4C8GA 3RYIA 5LOVB 4LCKA 3K0TA 1W5AA 1YJWF 5KMGB 2HS4A 5HY1A 5IYZA 4LNUA 4C8IA 1OAPA 3TD3A 4BT6A 3MBMA 3NMUC 3G6EF 4X1YA 3RYHB 5EYPB 3OW2F 5KX5B 3GHZA 3FPIA 4X1IA 1QVFF 4IIJB 1IV4A 1TVKA 3P0ZA 4YJ2A 1NMUB 3C9RA 5CA0B 3IEQA 4C81A 5IJ9A 1W5BA 2BTQB 3KHNA 3QUWA 3HKBA 4DRXB 2UYPA 4I50B 1DBFA 4XCQA 3OBYA 3HKDA 3JALB 3FD5A 4BT4A 4B5CA 5LYJA 3WGJA 2LBWA 4YJ3B 2GLZA 3E20B 3UT5A 1U40A 4G4XA 3VOAA 2VAPA 2HP0B 2VAMA 5GONA 1RQ2A 2DT4A 5EB1B 3E1YA 1R1MA 3M4SA 3VCZA 2Z01A 4TV8B 3RYFB 3VTIC 5EAZA 1OFUA 4X3LA 3RYHA 3VYSC 3JATB 4EI8A 5KX5A 1Q81H 4TZZA 1VQPF 2CW4A 5HY0A 2OTJF 3RYCB 3CPQA 1Z5WA 1XHOA 3WPXA 3WGMA 4DRXA 1VQ7F 3VOBA 3JALA 4TV9A 3JARB 5FJ4C 1ZWZA 1KC8H 5GAPK 4O4LA 3HAXD 3TD5A 5LA6A 4O2AB 5LP6B 2R6R1 3R0PA 5IJ0B 2HP0A 5EO3A 3E22B 3HKCB 2Q1YA 3RYIB 3J81M 2KG4A 1T0KB 3RYFA 2CHSA 3VO8A 4FFBB 5MN4A 3GTZA 2AIFA 3QTYA 3JATA 3CC2F 1H47A 2VGNA 2KGWA 3IMPA 4U39A 3LWPC 5IYZB 1FFXA 1QVGF 4LNUB 1VQ4F 3KJJA 1GZ0A 3RYCA 3ESJA 4X1YB 3P10A 2LBTA 4B62A 1T0AA 4YJ2B 3HWUA 3I3FA 3CCSF 3JARA 5C8YB 5IJ9B 4BT2A 1QD9A 1YJNF 5JH7A 4HNAA 3HKBB 1X52A 4R40B 3V7EA 3MQWA 4F6RB 3FBAA 2VAWA 1Q7YH 2IAFA 5JVDA 5LP6A 4X20B 1GX1A 3JAMM 1M1KH 4O2BA 5JQGA 1XBIA 3OBWA 3WGKA 5EZYA 1SA0B 1GO1A 2OZBA 1JY8A 3CCQF 3IEWA 3UT5B 4BT5A 1KNJA 1CK2A 2QI2A 1W42A 3CCEF 1VQLF 4FFBA 4E6EA 5GONB 3VYTC 5CA1A 3F0DA 3ERNA 1XRGA 3AGKA 1H7MA 3ZO8A 1SDSA 1FNKA 2KTUA 2I6RA 1JD1A 2ZF8A 2N48A 2NMUA 1COMA 5HP8A 2RB9A 3P4EA 4PWTA 4WBNA 4ZHYB 5HXZA 3CMAF 5FLXM 4TUYA 4NWOB 1X25A 3LWOC 1U3PA 2ALEA 5C8YA 4ZHQB 5HY4A 3J7AR 3M84A 2B33A 5GINC 3J80M 4F6RA 1YQNA 4TV9B 4ZK7A 4X20A 5JCOC 4IHJA 3D00A 2ZOVA 3WXMB 3V3TA 1RA4A 1SA0A 5IT9M 4O4LB 2HX0A 1K8AH 2OTMA 5LA6B 4I4TA 3F6MA 3C9TA 3CG6A 5CB4A 3CCLF 1NQ3A 5AVMA 3S03A 3V7QA 3JVHA 3LMEA 2ZODA 5ITZB 4X3MA 3IKEA 2UYJA 3LFOA 3GYQA 3IR9A 3JASA 4U3JB 4RQOA 1YGYA 3WJRA 3SIVA 1CLIA 2YYEA 3HTNA 3CMEF 4B45A 3CC4F 1FFXB 3RA6A 4B46A 3CCRF 2MQEA 2ZVZA 4G4VA 2I6DA 1KD1H 5EWRA 1CN7A 4ZHVA 1XV2A 3O85A 3DDNA 5GANK 3WJPA 1U3LA 5JH7B 1W5FA 4HNAB 4BVQA 2HVYD 3L7QA 5JVDB 2R751 2UYKA 1YHQF 2RHOA 3VI6A 4O2BB 5EIBD 3FFMA 5JQGB 3F0FA 3ELCA 1JN1A 5EZYB 2Z1UA 3LWRC 2Z1TA 2V9YA 1VQVA 4ZHWA 5ITZA 3KJKA 3K14A 3NVIB 2HRYA 4DXDA 3PLAC 4U3JA 5BMVB 2LBXA 1IV3A 2HS3A 5A2QM 5CA1B 4BT3A 4BY9D 4EI7A 3NK7A 3DC2A 3C9UA 1QAHA 4X1KA 3N4ZA 2UYNB 3CXCF 3T80A 2H6LA 1VH8A 3KIZA
chains in the Genus database with same CATH topology
5EAZA 2LCAA 2L26A 2K1SA 2LBTA 4B62A 3CYPB 3CYQA 3S0HA 4G4ZA 4B5CA 2ZOVA 3S02A 2ZF8A 2N48A 4ZHWA 2AIZP 2ZVZA 1OAPA 2MQEA 3TD3A 2HQSC 3OONA 4G4VA 4R40B 3S0YA 4G4XA 2W8BC 3WPXA 4PWTA 4RHAA 4G88A 4ZHYB 3LDTA 5EB1B 2ZVYA 3TD4A 3S06A 4ZHVA 2KGWA 1R1MA 3S03A 5EB0A 3IMPA 4G4YA 3S0WA 3KHNA 4ERHA 4G4WA 3WPWA 3TD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAZ A;  2LCA A;  2L26 A;  2K1S A;  2LBT A;  4B62 A;  3CYP B;  3CYQ A;  3S0H A;  4G4Z A;  4B5C A;  2ZOV A;  3S02 A;  2ZF8 A;  2N48 A;  4ZHW A;  2AIZ P;  2ZVZ A;  1OAP A;  2MQE A;  3TD3 A;  2HQS C;  3OON A;  4G4V A;  4R40 B;  3S0Y A;  4G4X A;  2W8B C;  3WPX A;  4PWT A;  4RHA A;  4G88 A;  4ZHY B;  3LDT A;  5EB1 B;  2ZVY A;  3TD4 A;  3S06 A;  4ZHV A;  2KGW A;  1R1M A;  3S03 A;  5EB0 A;  3IMP A;  4G4Y A;  3S0W A;  3KHN A;  4ERH A;  4G4W A;  3WPW A;  3TD5 A; 
#chains in the Genus database with same CATH topology
 2LCA A;  5G4V C;  2OTL F;  3IKF A;  3NK6 A;  1IPA A;  4WBN B;  4O4H B;  3QHD A;  2PHN A;  3HKE B;  2HP3 A;  2CWJ A;  3LYB A;  4TUY B;  1VQM F;  2BTU A;  1IV2 A;  5J2U A;  2W8B C;  1N8R H;  1W55 A;  3LDT A;  1W40 A;  3M1X A;  2ZVY A;  4IHJ B;  1W41 A;  3JAW B;  5EB0 A;  4O4J B;  3JCM M;  3RA5 A;  3MCA B;  3RE3 A;  5HY2 A;  1VQ6 F;  4I4T B;  2K1S A;  1W57 A;  1S72 F;  5BMV A;  1QU9 A;  5CB4 B;  3G4S F;  1SZQ A;  1U43 A;  4ZI7 B;  3S0H A;  1JJ2 F;  2JNB A;  3N2G B;  1UFY A;  1YJ9 F;  3ON1 A;  3CCM F;  1H48 A;  2UYN A;  2H8C A;  2HQS C;  3JAS B;  3BYQ A;  1KQS F;  1PXW A;  4ZHQ A;  5EIB C;  3WJQ A;  2Z1E A;  3C9S A;  4G88 A;  3TD4 A;  4O4H A;  3C8L A;  3MDO A;  2OHW A;  3HKE A;  1Q82 H;  4M8I A;  3HJW C;  3K12 A;  1W5E A;  2FGY A;  5J2T B;  3SIU A;  4O4I A;  2GVI A;  4EB6 B;  3CYP B;  1IV1 A;  3CYQ A;  5LXT A;  4BVT A;  3VMF B;  3JAW A;  2FC3 A;  2VXY A;  2AIZ P;  3OON A;  2YXZ A;  3S0Y A;  1VQN F;  4O4J A;  4I55 B;  5GIP C;  3NVK E;  2BTO A;  3CCJ F;  2G9I A;  1JFF A;  4ZI7 A;  3JAK A;  3N2G A;  4ZOL A;  3ZP7 A;  4NUT A;  1YIT F;  1RLG A;  4C82 A;  5MN6 A;  2L26 A;  3I7T A;  3N2K A;  1FNJ A;  2ZAU A;  2QA4 F;  1Q86 H;  1UI9 A;  5HXU A;  1X7P A;  3ZOP A;  1VQK F;  1Z5V A;  4X1K B;  3I56 F;  1DT9 A;  3KE1 A;  2RHH A;  1ODE A;  2Q1X A;  5LYJ B;  3WGL A;  5LOV A;  2CZW A;  5J2T A;  4EB6 A;  4RHA A;  5KMG A;  3S06 A;  2PMP A;  4NQ3 A;  3S0W A;  1Q8R A;  5JCO A;  5FNV B;  3CCV F;  1J7H A;  3VIU A;  1VK3 A;  5J2U B;  3CPW F;  2VGM A;  5EYP A;  3B6N A;  3D54 A;  3FD6 A;  4I55 A;  2IG8 A;  4BT7 A;  5B8F A;  3D01 A;  4IIJ A;  3CCU F;  2GZL A;  1E7K A;  3MCQ A;  2BO1 A;  5CA0 A;  2H8E A;  2RHL A;  3VYU C;  1VQ8 F;  1TUB B;  2P6Y A;  3Q8H A;  1YI2 F;  1VHA A;  4I50 A;  3V4D A;  2Z1F A;  2EWC A;  5HWE A;  2HS0 A;  3WGN A;  3K2X A;  4BVS A;  5MN5 A;  1W58 1;  1K9M H;  4YJ3 A;  3I55 F;  1RLU A;  5LP6 C;  3WPW A;  4KWE A;  1W59 A;  2WAL A;  2AMT A;  1NJI H;  2UZH A;  1VQ5 F;  2F9Z C;  5GIO C;  1PF5 A;  3CB2 A;  2KTV A;  4G4Z A;  3F0E A;  2CSL A;  3LWV C;  3S02 A;  1ONI A;  4TV8 A;  3CC7 F;  5FNV A;  3ZP4 A;  5G4U C;  4O4I B;  1FSZ A;  1YIJ F;  3F0G A;  5HP7 A;  5LXT B;  2IQQ A;  1VQO F;  1W2B F;  4BVR A;  3U0O A;  1TUB A;  4X1I B;  1TVK B;  2HRU A;  2QTP A;  4BW0 B;  1JFF B;  4EI9 A;  4C4W C;  3CD6 F;  3PAF A;  3N4Y A;  3JAK B;  3LWQ C;  1M90 H;  4ZOL B;  2RHJ A;  1K73 H;  3G71 F;  4C8E A;  4O2A A;  3N2K B;  1W3E X;  3HKD B;  1RQ7 A;  2CVL A;  5IJ0 A;  2CHT A;  1GO0 A;  1X7O A;  1VQ9 F;  3EOR A;  2QEX F;  3E22 A;  2DYY A;  4G4Y A;  3HKC A;  1KNK A;  5DCV A;  4ERH A;  4G4W A;  4C8G A;  3RYI A;  5LOV B;  4LCK A;  3K0T A;  1W5A A;  1YJW F;  5KMG B;  2HS4 A;  5HY1 A;  5IYZ A;  4LNU A;  4C8I A;  1OAP A;  3TD3 A;  4BT6 A;  3MBM A;  3NMU C;  3G6E F;  4X1Y A;  3RYH B;  5EYP B;  3OW2 F;  5KX5 B;  3GHZ A;  3FPI A;  4X1I A;  1QVF F;  4IIJ B;  1IV4 A;  1TVK A;  3P0Z A;  4YJ2 A;  1NMU B;  3C9R A;  5CA0 B;  3IEQ A;  4C81 A;  5IJ9 A;  1W5B A;  2BTQ B;  3KHN A;  3QUW A;  3HKB A;  4DRX B;  2UYP A;  4I50 B;  1DBF A;  4XCQ A;  3OBY A;  3HKD A;  3JAL B;  3FD5 A;  4BT4 A;  4B5C A;  5LYJ A;  3WGJ A;  2LBW A;  4YJ3 B;  2GLZ A;  3E20 B;  3UT5 A;  1U40 A;  4G4X A;  3VOA A;  2VAP A;  2HP0 B;  2VAM A;  5GON A;  1RQ2 A;  2DT4 A;  5EB1 B;  3E1Y A;  1R1M A;  3M4S A;  3VCZ A;  2Z01 A;  4TV8 B;  3RYF B;  3VTI C;  5EAZ A;  1OFU A;  4X3L A;  3RYH A;  3VYS C;  3JAT B;  4EI8 A;  5KX5 A;  1Q81 H;  4TZZ A;  1VQP F;  2CW4 A;  5HY0 A;  2OTJ F;  3RYC B;  3CPQ A;  1Z5W A;  1XHO A;  3WPX A;  3WGM A;  4DRX A;  1VQ7 F;  3VOB A;  3JAL A;  4TV9 A;  3JAR B;  5FJ4 C;  1ZWZ A;  1KC8 H;  5GAP K;  4O4L A;  3HAX D;  3TD5 A;  5LA6 A;  4O2A B;  5LP6 B;  2R6R 1;  3R0P A;  5IJ0 B;  2HP0 A;  5EO3 A;  3E22 B;  3HKC B;  2Q1Y A;  3RYI B;  3J81 M;  2KG4 A;  1T0K B;  3RYF A;  2CHS A;  3VO8 A;  4FFB B;  5MN4 A;  3GTZ A;  2AIF A;  3QTY A;  3JAT A;  3CC2 F;  1H47 A;  2VGN A;  2KGW A;  3IMP A;  4U39 A;  3LWP C;  5IYZ B;  1FFX A;  1QVG F;  4LNU B;  1VQ4 F;  3KJJ A;  1GZ0 A;  3RYC A;  3ESJ A;  4X1Y B;  3P10 A;  2LBT A;  4B62 A;  1T0A A;  4YJ2 B;  3HWU A;  3I3F A;  3CCS F;  3JAR A;  5C8Y B;  5IJ9 B;  4BT2 A;  1QD9 A;  1YJN F;  5JH7 A;  4HNA A;  3HKB B;  1X52 A;  4R40 B;  3V7E A;  3MQW A;  4F6R B;  3FBA A;  2VAW A;  1Q7Y H;  2IAF A;  5JVD A;  5LP6 A;  4X20 B;  1GX1 A;  3JAM M;  1M1K H;  4O2B A;  5JQG A;  1XBI A;  3OBW A;  3WGK A;  5EZY A;  1SA0 B;  1GO1 A;  2OZB A;  1JY8 A;  3CCQ F;  3IEW A;  3UT5 B;  4BT5 A;  1KNJ A;  1CK2 A;  2QI2 A;  1W42 A;  3CCE F;  1VQL F;  4FFB A;  4E6E A;  5GON B;  3VYT C;  5CA1 A;  3F0D A;  3ERN A;  1XRG A;  3AGK A;  1H7M A;  3ZO8 A;  1SDS A;  1FNK A;  2KTU A;  2I6R A;  1JD1 A;  2ZF8 A;  2N48 A;  2NMU A;  1COM A;  5HP8 A;  2RB9 A;  3P4E A;  4PWT A;  4WBN A;  4ZHY B;  5HXZ A;  3CMA F;  5FLX M;  4TUY A;  4NWO B;  1X25 A;  3LWO C;  1U3P A;  2ALE A;  5C8Y A;  4ZHQ B;  5HY4 A;  3J7A R;  3M84 A;  2B33 A;  5GIN C;  3J80 M;  4F6R A;  1YQN A;  4TV9 B;  4ZK7 A;  4X20 A;  5JCO C;  4IHJ A;  3D00 A;  2ZOV A;  3WXM B;  3V3T A;  1RA4 A;  1SA0 A;  5IT9 M;  4O4L B;  2HX0 A;  1K8A H;  2OTM A;  5LA6 B;  4I4T A;  3F6M A;  3C9T A;  3CG6 A;  5CB4 A;  3CCL F;  1NQ3 A;  5AVM A;  3S03 A;  3V7Q A;  3JVH A;  3LME A;  2ZOD A;  5ITZ B;  4X3M A;  3IKE A;  2UYJ A;  3LFO A;  3GYQ A;  3IR9 A;  3JAS A;  4U3J B;  4RQO A;  1YGY A;  3WJR A;  3SIV A;  1CLI A;  2YYE A;  3HTN A;  3CME F;  4B45 A;  3CC4 F;  1FFX B;  3RA6 A;  4B46 A;  3CCR F;  2MQE A;  2ZVZ A;  4G4V A;  2I6D A;  1KD1 H;  5EWR A;  1CN7 A;  4ZHV A;  1XV2 A;  3O85 A;  3DDN A;  5GAN K;  3WJP A;  1U3L A;  5JH7 B;  1W5F A;  4HNA B;  4BVQ A;  2HVY D;  3L7Q A;  5JVD B;  2R75 1;  2UYK A;  1YHQ F;  2RHO A;  3VI6 A;  4O2B B;  5EIB D;  3FFM A;  5JQG B;  3F0F A;  3ELC A;  1JN1 A;  5EZY B;  2Z1U A;  3LWR C;  2Z1T A;  2V9Y A;  1VQV A;  4ZHW A;  5ITZ A;  3KJK A;  3K14 A;  3NVI B;  2HRY A;  4DXD A;  3PLA C;  4U3J A;  5BMV B;  2LBX A;  1IV3 A;  2HS3 A;  5A2Q M;  5CA1 B;  4BT3 A;  4BY9 D;  4EI7 A;  3NK7 A;  3DC2 A;  3C9U A;  1QAH A;  4X1K A;  3N4Z A;  2UYN B;  3CXC F;  3T80 A;  2H6L A;  1VH8 A;  3KIZ A; 
#chains in the Genus database with same CATH homology
 5EAZ A;  2LCA A;  2L26 A;  2K1S A;  2LBT A;  4B62 A;  3CYP B;  3CYQ A;  3S0H A;  4G4Z A;  4B5C A;  2ZOV A;  3S02 A;  2ZF8 A;  2N48 A;  4ZHW A;  2AIZ P;  2ZVZ A;  1OAP A;  2MQE A;  3TD3 A;  2HQS C;  3OON A;  4G4V A;  4R40 B;  3S0Y A;  4G4X A;  2W8B C;  3WPX A;  4PWT A;  4RHA A;  4G88 A;  4ZHY B;  3LDT A;  5EB1 B;  2ZVY A;  3TD4 A;  3S06 A;  4ZHV A;  2KGW A;  1R1M A;  3S03 A;  5EB0 A;  3IMP A;  4G4Y A;  3S0W A;  3KHN A;  4ERH A;  4G4W A;  3WPW A;  3TD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...