2HQSC

Crystal structure of tolb/pal complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolB
publication title Molecular mimicry enables competitive recruitment by a natively disordered protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/lipoprotein
total genus 35
structure length 107
sequence length 107
chains with identical sequence E, G, H
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2hqsC00
2ZVZA 4ZHWA 3OONA 2AIZP 4PWTA 2KGWA 3TD5A 2K1SA 3S0WA 5EB0A 3IMPA 2LBTA 2HQSC 5EB1B 4G4XA 3S02A 1OAPA 3WPWA 3TD3A 3CYQA 4B62A 2LCAA 4G4WA 4G88A 2ZVYA 4ZHYB 2MQEA 2L26A 3KHNA 5EAZA 3S03A 4ZHVA 4G4VA 4R40B 3S0HA 3TD4A 4ERHA 3S06A 2W8BC 2ZF8A 3LDTA 4G4ZA 1R1MA 3WPXA 4B5CA 4RHAA 2ZOVA 4G4YA 2N48A 3S0YA 3CYPB
chains in the Genus database with same CATH superfamily
2ZVZA 4BT2A 5GIOC 3NK6A 1H48A 1RQ7A 4LNUA 4DRXA 2YYEA 1E7KA 1JN1A 3E20B 1W59A 4IIJB 3J81M 1ZWZA 4FFBA 2HP0A 2OTMA 5CA0A 3LWPC 2CVLA 1XBIA 5EZYA 3HJWC 2OZBA 1GO1A 1JY8A 1W5FA 1DT9A 1Q86H 2Z1FA 3JCMM 2OTJF 3N2GB 3RE3A 2R6R1 1NJIH 2P6YA 2UYPA 3KE1A 3VOBA 4YJ2A 4I4TB 5LOVA 1DBFA 3G71F 2Z1EA 3GTZA 1VH8A 3MQWA 2VGNA 2Z1UA 5GIPC 2CZWA 3LWQC 1U43A 4BW0B 5HY1A 4RQOA 3NK7A 3FPIA 5J2UA 5GINC 3NVKE 5CA1B 2Z01A 1QAHA 1Z5VA 4R40B 1COMA 3G4SF 1X7OA 1VQKF 1W581 2HRYA 4G4ZA 4X20A 2BTQB 3GYQA 1RA4A 3G6EF 3FBAA 1M90H 3JALA 3JAKB 4O4JB 1XRGA 1H7MA 3HWUA 1YHQF 3CCVF 2NMUA 4ZI7B 2EWCA 1VQMF 2F9ZC 1GO0A 1W5EA 3HKEA 4IHJA 5EB1B 5GAPK 3ON1A 2LCAA 3MDOA 1UFYA 2Z1TA 3HTNA 1VHAA 3O85A 3UT5A 3RYFB 5LYJA 1PF5A 4O4IA 2HP3A 3S0HA 4NQ3A 2ZF8A 2R751 4B5CA 5IJ0A 3HKDA 4B46A 4O4LB 4KWEA 1KQSF 3JATA 1VQLF 3OONA 4X1YA 5JVDA 1FNJA 1U3LA 3LMEA 3N4ZA 5DCVA 5HXZA 1FSZA 4O2BB 3WGLA 3JAWA 5FNVA 5C8YA 5ITZB 1Q7YH 1VQ7F 3DC2A 3K2XA 3OBYA 2AIFA 1NMUB 4YJ3B 2RHHA 5HP7A 3WXMB 1X25A 3ZOPA 3M4SA 3I56F 2QEXF 1Q81H 1FFXB 2RB9A 3FFMA 4TV9A 1VK3A 4BT3A 4F6RB 3JASB 4C81A 2VXYA 5KX5A 5LP6B 4U3JB 2CHTA 4WBNA 2AMTA 2RHJA 4O2AB 1UI9A 1RQ2A 2UYJA 3JARA 4TUYB 1RLGA 5EWRA 3EORA 2LBWA 1OFUA 5HWEA 3CC4F 2QTPA 2KTVA 3LWVC 3ZP7A 1SA0B 3WJQA 3RYHB 3VOAA 2ZAUA 5HP8A 5EO3A 1YQNA 3ESJA 3M1XA 5JCOA 3PLAC 3CD6F 2HS0A 1W3EX 4X1IB 4ZOLA 5JCOC 4RHAA 1QU9A 3OBWA 5LXTA 3I7TA 1VQNF 5IYZA 4BVSA 4BVQA 3S0WA 5EB0A 3IMPA 3IR9A 3RYCA 3E1YA 5FJ4C 4O4HB 5JH7B 4G4WA 2FC3A 3CB2A 5LA6A 5CB4B 5KMGB 3TD4A 5BMVA 1X52A 1GZ0A 4HNAB 3HKBB 1R1MA 3LYBA 2DT4A 4G4YA 3VMFB 4ZHWA 3P4EA 4I50A 1TVKA 3E22B 1W40A 3MCQA 4NWOB 4LCKA 3FD6A 1OAPA 3RYIA 3CC2F 3N2KA 3GHZA 5JQGB 2ZVYA 3SIVA 4TV8A 3QTYA 4ZHQA 3CCJF 1JFFA 3F6MA 5IJ9B 3CCQF 3CCUF 3LDTA 3WGMA 1QD9A 2IQQA 1FNKA 3IEQA 5HY0A 1KNJA 2JNBA 3WPWA 5EYPB 2N48A 3S0YA 3I3FA 1YIJF 4IIJA 5MN5A 3VYUC 4DXDA 3K14A 4BT5A 5J2TB 3ZP4A 2LBTA 3V4DA 3K0TA 1S72F 2UYNB 3J80M 1XHOA 4X3LA 3BYQA 3WGJA 3CMEF 3N2GA 1YJNF 2IG8A 3R0PA 2KTUA 4ZHYB 4I55B 5EIBC 3WGNA 1Q82H 3C8LA 4I4TA 1VQ5F 3I55F 3AGKA 2IAFA 3CG6A 3D01A 3MCAB 2KGWA 2I6RA 3V7QA 5AVMA 1T0KB 3JVHA 3HKCB 4PWTA 4X1KB 2HS4A 3V7EA 3J7AR 1VQ6F 3U0OA 1IV2A 3CPWF 1KD1H 4C8EA 5CA1A 2H8CA 1H47A 3VO8A 1VQ4F 4EI9A 3RA6A 5EIBD 2MQEA 2G9IA 4EB6B 4ZHVA 3N4YA 3LWRC 2PHNA 3JAKA 3VIUA 2UYKA 4O4JA 2H6LA 1TUBB 3RA5A 3JAMM 5GONB 4ZI7A 3CC7F 3CYPB 5HXUA 1K8AH 3KJJA 4BVRA 1IV3A 4BT6A 1KNKA 4BT7A 1W57A 3RYFA 3WJPA 4LNUB 3CCSF 1K73H 2ZODA 4DRXB 3F0GA 4FFBB 1IV4A 2HP0B 5CA0B 1IPAA 3VCZA 1NQ3A 5EZYB 4O4LA 2B33A 3VYTC 2I6DA 3CCEF 5B8FA 1J7HA 3IKFA 5IT9M 4O2BA 5ITZA 2HVYD 4C4WC 4YJ2B 1XV2A 4BVTA 2CW4A 3KJKA 3T80A 5LOVB 4EI7A 3C9RA 4YJ3A 2QA4F 1YITF 3VTIC 1JJ2F 3CPQA 3SIUA 3V3TA 1KC8H 2RHLA 1FFXA 4F6RA 4X3MA 3HAXD 4ZK7A 3JASA 2BO1A 5LP6A 4U3JA 2OHWA 2DYYA 5J2UB 3ZO8A 4C82A 5LP6C 4EI8A 5MN6A 4O2AA 1IV1A 3ELCA 3WJRA 1X7PA 4TUYA 2UZHA 1U3PA 3CCRF 2RHOA 1W41A 2AIZP 1QVFF 4X20B 2CSLA 5G4VC 2LBXA 1SA0A 3RYHA 3JALB 1VQOF 2BTOA 1W2BF 3IEWA 3FD5A 3S02A 2VAWA 1Q8RA 5G4UC 3TD3A 1W5AA 4U39A 1N8RH 3HKEB 1VQ8F 4IHJB 4X1IA 2GZLA 5EAZA 3S03A 1K9MH 1CLIA 4E6EA 2ALEA 3NVIB 3F0EA 3UT5B 3B6NA 2VGMA 5LYJB 1GX1A 4O4IB 2ZOVA 2KG4A 1VQ9F 3C9SA 3CMAF 2HS3A 5HY2A 3Q8HA 5IJ0B 3HKDB 3CXCF 4O4HA 5JH7A 3JATB 3VI6A 5CB4A 4X1YB 5JVDB 2WALA 1VQPF 1VQVA 5KMGA 3IKEA 3JAWB 5FNVB 5C8YB 4HNAA 1M1KH 2BTUA 3HKBA 3KHNA 5HY4A 3VYSC 2OTLF 1RLUA 3KIZA 3ERNA 3E22A 2Q1YA 3D54A 4TV9B 1SDSA 3LFOA 2CWJA 1PXWA 5KX5B 3TD5A 1YJWF 1U40A 2FGYA 5JQGA 4WBNB 2HQSC 1T0AA 3NMUC 3PAFA 3JARB 2GLZA 5IJ9A 1W42A 3CCMF 3CCLF 2L26A 4G4VA 1SZQA 1YI2F 5EYPA 2YXZA 2GVIA 2W8BC 1W5BA 5J2TA 1QVGF 3K12A 1Z5WA 2UYNA 4NUTA 4ZOLB 1CN7A 2H8EA 3F0DA 4C8IA 1W55A 2QI2A 4I55A 5LXTB 5GANK 4BT4A 5IYZB 3CYQA 4G88A 2V9YA 3RYCB 2CHSA 4ERHA 3S06A 3P0ZA 1JD1A 5LA6B 3WGKA 3HKCA 3QHDA 5FLXM 3WPXA 4BY9D 1CK2A 4X1KA 2Q1XA 4G4XA 5BMVB 3P10A 4M8IA 1ONIA 3C9TA 4TZZA 2HX0A 2K1SA 2VAMA 4B45A 3F0FA 5MN4A 4I50B 1YJ9F 1TVKB 3D00A 4EB6A 1YGYA 2VAPA 4B62A 5A2QM 3C9UA 3QUWA 3MBMA 1TUBA 3RYIB 5GONA 3N2KB 2HRUA 3LWOC 3L7QA 4TV8B 3OW2F 1ODEA 2PMPA 4C8GA 4ZHQB 4XCQA 3DDNA 1JFFB 3M84A
chains in the Genus database with same CATH topology
2ZVZA 4ZHWA 3OONA 2AIZP 4PWTA 2KGWA 3TD5A 2K1SA 3S0WA 5EB0A 3IMPA 2LBTA 2HQSC 5EB1B 4G4XA 3S02A 1OAPA 3WPWA 3TD3A 3CYQA 4B62A 2LCAA 4G4WA 4G88A 2ZVYA 4ZHYB 2MQEA 2L26A 3KHNA 5EAZA 3S03A 4ZHVA 4G4VA 4R40B 3S0HA 3TD4A 4ERHA 3S06A 2W8BC 2ZF8A 3LDTA 4G4ZA 1R1MA 3WPXA 4B5CA 4RHAA 2ZOVA 4G4YA 2N48A 3S0YA 3CYPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVZ A;  4ZHW A;  3OON A;  2AIZ P;  4PWT A;  2KGW A;  3TD5 A;  2K1S A;  3S0W A;  5EB0 A;  3IMP A;  2LBT A;  2HQS C;  5EB1 B;  4G4X A;  3S02 A;  1OAP A;  3WPW A;  3TD3 A;  3CYQ A;  4B62 A;  2LCA A;  4G4W A;  4G88 A;  2ZVY A;  4ZHY B;  2MQE A;  2L26 A;  3KHN A;  5EAZ A;  3S03 A;  4ZHV A;  4G4V A;  4R40 B;  3S0H A;  3TD4 A;  4ERH A;  3S06 A;  2W8B C;  2ZF8 A;  3LDT A;  4G4Z A;  1R1M A;  3WPX A;  4B5C A;  4RHA A;  2ZOV A;  4G4Y A;  2N48 A;  3S0Y A;  3CYP B; 
#chains in the Genus database with same CATH topology
 2ZVZ A;  4BT2 A;  5GIO C;  3NK6 A;  1H48 A;  1RQ7 A;  4LNU A;  4DRX A;  2YYE A;  1E7K A;  1JN1 A;  3E20 B;  1W59 A;  4IIJ B;  3J81 M;  1ZWZ A;  4FFB A;  2HP0 A;  2OTM A;  5CA0 A;  3LWP C;  2CVL A;  1XBI A;  5EZY A;  3HJW C;  2OZB A;  1GO1 A;  1JY8 A;  1W5F A;  1DT9 A;  1Q86 H;  2Z1F A;  3JCM M;  2OTJ F;  3N2G B;  3RE3 A;  2R6R 1;  1NJI H;  2P6Y A;  2UYP A;  3KE1 A;  3VOB A;  4YJ2 A;  4I4T B;  5LOV A;  1DBF A;  3G71 F;  2Z1E A;  3GTZ A;  1VH8 A;  3MQW A;  2VGN A;  2Z1U A;  5GIP C;  2CZW A;  3LWQ C;  1U43 A;  4BW0 B;  5HY1 A;  4RQO A;  3NK7 A;  3FPI A;  5J2U A;  5GIN C;  3NVK E;  5CA1 B;  2Z01 A;  1QAH A;  1Z5V A;  4R40 B;  1COM A;  3G4S F;  1X7O A;  1VQK F;  1W58 1;  2HRY A;  4G4Z A;  4X20 A;  2BTQ B;  3GYQ A;  1RA4 A;  3G6E F;  3FBA A;  1M90 H;  3JAL A;  3JAK B;  4O4J B;  1XRG A;  1H7M A;  3HWU A;  1YHQ F;  3CCV F;  2NMU A;  4ZI7 B;  2EWC A;  1VQM F;  2F9Z C;  1GO0 A;  1W5E A;  3HKE A;  4IHJ A;  5EB1 B;  5GAP K;  3ON1 A;  2LCA A;  3MDO A;  1UFY A;  2Z1T A;  3HTN A;  1VHA A;  3O85 A;  3UT5 A;  3RYF B;  5LYJ A;  1PF5 A;  4O4I A;  2HP3 A;  3S0H A;  4NQ3 A;  2ZF8 A;  2R75 1;  4B5C A;  5IJ0 A;  3HKD A;  4B46 A;  4O4L B;  4KWE A;  1KQS F;  3JAT A;  1VQL F;  3OON A;  4X1Y A;  5JVD A;  1FNJ A;  1U3L A;  3LME A;  3N4Z A;  5DCV A;  5HXZ A;  1FSZ A;  4O2B B;  3WGL A;  3JAW A;  5FNV A;  5C8Y A;  5ITZ B;  1Q7Y H;  1VQ7 F;  3DC2 A;  3K2X A;  3OBY A;  2AIF A;  1NMU B;  4YJ3 B;  2RHH A;  5HP7 A;  3WXM B;  1X25 A;  3ZOP A;  3M4S A;  3I56 F;  2QEX F;  1Q81 H;  1FFX B;  2RB9 A;  3FFM A;  4TV9 A;  1VK3 A;  4BT3 A;  4F6R B;  3JAS B;  4C81 A;  2VXY A;  5KX5 A;  5LP6 B;  4U3J B;  2CHT A;  4WBN A;  2AMT A;  2RHJ A;  4O2A B;  1UI9 A;  1RQ2 A;  2UYJ A;  3JAR A;  4TUY B;  1RLG A;  5EWR A;  3EOR A;  2LBW A;  1OFU A;  5HWE A;  3CC4 F;  2QTP A;  2KTV A;  3LWV C;  3ZP7 A;  1SA0 B;  3WJQ A;  3RYH B;  3VOA A;  2ZAU A;  5HP8 A;  5EO3 A;  1YQN A;  3ESJ A;  3M1X A;  5JCO A;  3PLA C;  3CD6 F;  2HS0 A;  1W3E X;  4X1I B;  4ZOL A;  5JCO C;  4RHA A;  1QU9 A;  3OBW A;  5LXT A;  3I7T A;  1VQN F;  5IYZ A;  4BVS A;  4BVQ A;  3S0W A;  5EB0 A;  3IMP A;  3IR9 A;  3RYC A;  3E1Y A;  5FJ4 C;  4O4H B;  5JH7 B;  4G4W A;  2FC3 A;  3CB2 A;  5LA6 A;  5CB4 B;  5KMG B;  3TD4 A;  5BMV A;  1X52 A;  1GZ0 A;  4HNA B;  3HKB B;  1R1M A;  3LYB A;  2DT4 A;  4G4Y A;  3VMF B;  4ZHW A;  3P4E A;  4I50 A;  1TVK A;  3E22 B;  1W40 A;  3MCQ A;  4NWO B;  4LCK A;  3FD6 A;  1OAP A;  3RYI A;  3CC2 F;  3N2K A;  3GHZ A;  5JQG B;  2ZVY A;  3SIV A;  4TV8 A;  3QTY A;  4ZHQ A;  3CCJ F;  1JFF A;  3F6M A;  5IJ9 B;  3CCQ F;  3CCU F;  3LDT A;  3WGM A;  1QD9 A;  2IQQ A;  1FNK A;  3IEQ A;  5HY0 A;  1KNJ A;  2JNB A;  3WPW A;  5EYP B;  2N48 A;  3S0Y A;  3I3F A;  1YIJ F;  4IIJ A;  5MN5 A;  3VYU C;  4DXD A;  3K14 A;  4BT5 A;  5J2T B;  3ZP4 A;  2LBT A;  3V4D A;  3K0T A;  1S72 F;  2UYN B;  3J80 M;  1XHO A;  4X3L A;  3BYQ A;  3WGJ A;  3CME F;  3N2G A;  1YJN F;  2IG8 A;  3R0P A;  2KTU A;  4ZHY B;  4I55 B;  5EIB C;  3WGN A;  1Q82 H;  3C8L A;  4I4T A;  1VQ5 F;  3I55 F;  3AGK A;  2IAF A;  3CG6 A;  3D01 A;  3MCA B;  2KGW A;  2I6R A;  3V7Q A;  5AVM A;  1T0K B;  3JVH A;  3HKC B;  4PWT A;  4X1K B;  2HS4 A;  3V7E A;  3J7A R;  1VQ6 F;  3U0O A;  1IV2 A;  3CPW F;  1KD1 H;  4C8E A;  5CA1 A;  2H8C A;  1H47 A;  3VO8 A;  1VQ4 F;  4EI9 A;  3RA6 A;  5EIB D;  2MQE A;  2G9I A;  4EB6 B;  4ZHV A;  3N4Y A;  3LWR C;  2PHN A;  3JAK A;  3VIU A;  2UYK A;  4O4J A;  2H6L A;  1TUB B;  3RA5 A;  3JAM M;  5GON B;  4ZI7 A;  3CC7 F;  3CYP B;  5HXU A;  1K8A H;  3KJJ A;  4BVR A;  1IV3 A;  4BT6 A;  1KNK A;  4BT7 A;  1W57 A;  3RYF A;  3WJP A;  4LNU B;  3CCS F;  1K73 H;  2ZOD A;  4DRX B;  3F0G A;  4FFB B;  1IV4 A;  2HP0 B;  5CA0 B;  1IPA A;  3VCZ A;  1NQ3 A;  5EZY B;  4O4L A;  2B33 A;  3VYT C;  2I6D A;  3CCE F;  5B8F A;  1J7H A;  3IKF A;  5IT9 M;  4O2B A;  5ITZ A;  2HVY D;  4C4W C;  4YJ2 B;  1XV2 A;  4BVT A;  2CW4 A;  3KJK A;  3T80 A;  5LOV B;  4EI7 A;  3C9R A;  4YJ3 A;  2QA4 F;  1YIT F;  3VTI C;  1JJ2 F;  3CPQ A;  3SIU A;  3V3T A;  1KC8 H;  2RHL A;  1FFX A;  4F6R A;  4X3M A;  3HAX D;  4ZK7 A;  3JAS A;  2BO1 A;  5LP6 A;  4U3J A;  2OHW A;  2DYY A;  5J2U B;  3ZO8 A;  4C82 A;  5LP6 C;  4EI8 A;  5MN6 A;  4O2A A;  1IV1 A;  3ELC A;  3WJR A;  1X7P A;  4TUY A;  2UZH A;  1U3P A;  3CCR F;  2RHO A;  1W41 A;  2AIZ P;  1QVF F;  4X20 B;  2CSL A;  5G4V C;  2LBX A;  1SA0 A;  3RYH A;  3JAL B;  1VQO F;  2BTO A;  1W2B F;  3IEW A;  3FD5 A;  3S02 A;  2VAW A;  1Q8R A;  5G4U C;  3TD3 A;  1W5A A;  4U39 A;  1N8R H;  3HKE B;  1VQ8 F;  4IHJ B;  4X1I A;  2GZL A;  5EAZ A;  3S03 A;  1K9M H;  1CLI A;  4E6E A;  2ALE A;  3NVI B;  3F0E A;  3UT5 B;  3B6N A;  2VGM A;  5LYJ B;  1GX1 A;  4O4I B;  2ZOV A;  2KG4 A;  1VQ9 F;  3C9S A;  3CMA F;  2HS3 A;  5HY2 A;  3Q8H A;  5IJ0 B;  3HKD B;  3CXC F;  4O4H A;  5JH7 A;  3JAT B;  3VI6 A;  5CB4 A;  4X1Y B;  5JVD B;  2WAL A;  1VQP F;  1VQV A;  5KMG A;  3IKE A;  3JAW B;  5FNV B;  5C8Y B;  4HNA A;  1M1K H;  2BTU A;  3HKB A;  3KHN A;  5HY4 A;  3VYS C;  2OTL F;  1RLU A;  3KIZ A;  3ERN A;  3E22 A;  2Q1Y A;  3D54 A;  4TV9 B;  1SDS A;  3LFO A;  2CWJ A;  1PXW A;  5KX5 B;  3TD5 A;  1YJW F;  1U40 A;  2FGY A;  5JQG A;  4WBN B;  2HQS C;  1T0A A;  3NMU C;  3PAF A;  3JAR B;  2GLZ A;  5IJ9 A;  1W42 A;  3CCM F;  3CCL F;  2L26 A;  4G4V A;  1SZQ A;  1YI2 F;  5EYP A;  2YXZ A;  2GVI A;  2W8B C;  1W5B A;  5J2T A;  1QVG F;  3K12 A;  1Z5W A;  2UYN A;  4NUT A;  4ZOL B;  1CN7 A;  2H8E A;  3F0D A;  4C8I A;  1W55 A;  2QI2 A;  4I55 A;  5LXT B;  5GAN K;  4BT4 A;  5IYZ B;  3CYQ A;  4G88 A;  2V9Y A;  3RYC B;  2CHS A;  4ERH A;  3S06 A;  3P0Z A;  1JD1 A;  5LA6 B;  3WGK A;  3HKC A;  3QHD A;  5FLX M;  3WPX A;  4BY9 D;  1CK2 A;  4X1K A;  2Q1X A;  4G4X A;  5BMV B;  3P10 A;  4M8I A;  1ONI A;  3C9T A;  4TZZ A;  2HX0 A;  2K1S A;  2VAM A;  4B45 A;  3F0F A;  5MN4 A;  4I50 B;  1YJ9 F;  1TVK B;  3D00 A;  4EB6 A;  1YGY A;  2VAP A;  4B62 A;  5A2Q M;  3C9U A;  3QUW A;  3MBM A;  1TUB A;  3RYI B;  5GON A;  3N2K B;  2HRU A;  3LWO C;  3L7Q A;  4TV8 B;  3OW2 F;  1ODE A;  2PMP A;  4C8G A;  4ZHQ B;  4XCQ A;  3DDN A;  1JFF B;  3M84 A; 
#chains in the Genus database with same CATH homology
 2ZVZ A;  4ZHW A;  3OON A;  2AIZ P;  4PWT A;  2KGW A;  3TD5 A;  2K1S A;  3S0W A;  5EB0 A;  3IMP A;  2LBT A;  2HQS C;  5EB1 B;  4G4X A;  3S02 A;  1OAP A;  3WPW A;  3TD3 A;  3CYQ A;  4B62 A;  2LCA A;  4G4W A;  4G88 A;  2ZVY A;  4ZHY B;  2MQE A;  2L26 A;  3KHN A;  5EAZ A;  3S03 A;  4ZHV A;  4G4V A;  4R40 B;  3S0H A;  3TD4 A;  4ERH A;  3S06 A;  2W8B C;  2ZF8 A;  3LDT A;  4G4Z A;  1R1M A;  3WPX A;  4B5C A;  4RHA A;  2ZOV A;  4G4Y A;  2N48 A;  3S0Y A;  3CYP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...