3ESJA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MLEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 50
structure length 162
sequence length 162
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3esjA00
1IV3A 3K2XA 4C8GA 3RE3A 1H47A 1GX1A 1KNJA 3FBAA 3K14A 2UZHA 3P0ZA 3IEQA 1U40A 1H48A 2PMPA 1VH8A 3IKEA 3MBMA 4C8IA 3ELCA 1KNKA 1W55A 3F0DA 5B8FA 3QHDA 1U3LA 1U43A 4C82A 3T80A 3FPIA 3KE1A 3EORA 3ERNA 1IV1A 3ESJA 1IV2A 3JVHA 4C81A 1U3PA 4C8EA 3F0FA 2AMTA 3IEWA 3F0GA 1YQNA 3IKFA 1JN1A 3P10A 1T0AA 2GZLA 1JY8A 3B6NA 1IV4A 3F6MA 1VHAA 3GHZA 1W57A 3Q8HA 3F0EA
chains in the Genus database with same CATH superfamily
3D00A 3CMAF 2VAMA 4ZOLA 5FNVA 2H8CA 2MQEA 2UYNB 3N4ZA 5IJ9A 3WPWA 1K8AH 5EIBD 3HKEB 2ZOVA 1TVKB 3WJPA 4IHJB 3WGMA 4B45A 3IKFA 3C9TA 3G71F 1YIJF 4HNAA 3MCQA 1QAHA 4G88A 5HP8A 4BT5A 2HS3A 2HRYA 4DXDA 2YYEA 3CD6F 3CCSF 2R751 5GANK 3VOAA 3MBMA 4EI7A 3WGLA 3F0DA 1H7MA 3IR9A 1FSZA 3HTNA 4X20A 3LWRC 5HXUA 1RLGA 1IV1A 3ESJA 3NK6A 1UI9A 2NMUA 4I50B 1K9MH 4X3LA 4WBNB 3F6MA 1QU9A 3JASB 5HY4A 2LBWA 3N2GA 5JCOA 1UFYA 1YI2F 4F6RB 1K73H 1RA4A 3CC2F 2IG8A 4PWTA 3HKDB 3RYIA 3HKCA 3HKBB 2OTMA 3E20B 2LCAA 1T0KB 4BT3A 3LMEA 1JJ2F 2ALEA 4C81A 3CPWF 1Q8RA 3JAWA 3JARB 5JH7A 4ZK7A 4ZHWA 3CCRF 2K1SA 3NMUC 4B46A 3OW2F 5EIBC 3S06A 2Z1EA 3LFOA 1U40A 2CHTA 2ZVYA 1RQ2A 3RYHB 5EB0A 2YXZA 1W581 3D01A 4KWEA 4IIJB 4O4LB 5CA1B 4BT4A 2HP0B 2KGWA 5LOVA 2RHHA 4O2BB 5CA0B 2PHNA 2HQSC 4YJ3A 3T80A 3VYSC 3KE1A 5HY1A 3P4EA 5HY0A 1FNJA 2KTVA 4G4XA 2VXYA 2Z1FA 4BW0B 1CK2A 1JFFB 4LNUA 5C8YB 2V9YA 5J2UA 1W2BF 3DDNA 4I4TA 3RYCA 1SDSA 3VOBA 5GINC 4B5CA 3JAWB 3PAFA 5HXZA 4O2AA 3CG6A 3S0HA 2DYYA 3C9UA 4X1YA 1Z5VA 4LCKA 4DRXB 4G4YA 3HKDA 2QTPA 4C82A 2QA4F 3CC7F 3I55F 5EAZA 2ZODA 3CCEF 5ITZA 3J81M 1KD1H 3HWUA 4BT6A 1JN1A 2L26A 1Q82H 5LOVB 2HP0A 4G4WA 1J7HA 3G6EF 1OFUA 2B33A 4O4LA 3LWVC 3LWQC 1N8RH 3RYHA 5A2QM 3FBAA 3E22B 3C9RA 5EZYB 1DBFA 3R0PA 2UZHA 4FFBB 4BVQA 3SIUA 5EYPB 1GZ0A 3RYCB 2KG4A 5J2UB 5C8YA 1QVGF 3ELCA 4M8IA 1PF5A 3TD5A 4EI8A 3LWOC 4X1IA 5GONB 1QVFF 3C9SA 3ZP7A 5EZYA 4BVTA 1U3PA 4O4IB 3S0WA 1YGYA 1JD1A 2N48A 3VTIC 3G4SF 1YJWF 2ZVZA 5CA1A 3LDTA 2CHSA 4C8IA 3S03A 1YJ9F 3HKBA 5MN6A 1H47A 3C8LA 4I55A 5ITZB 3JAMM 4IHJA 2FC3A 1Q7YH 1CLIA 4BVSA 1TVKA 1M90H 2ZF8A 1W42A 3ZO8A 3MDOA 3JASA 4NUTA 4WBNA 3LYBA 4I4TB 1U43A 2LBXA 1IPAA 3CC4F 3CB2A 4ZOLB 1GO1A 2GZLA 4I55B 3E22A 1W57A 3WGKA 1PXWA 1R1MA 1DT9A 4O2BA 5CA0A 5GIOC 2IQQA 2KTUA 1ODEA 3MQWA 3O85A 4O4IA 5GONA 2Z1UA 3N2GB 4X1IB 3V3TA 4RQOA 2AIZP 3RA5A 5JH7B 1QD9A 3JARA 3WJRA 3NK7A 2VAWA 5EYPA 1W5FA 4FFBA 3VIUA 3CCVF 4O2AB 1W40A 2UYKA 3RA6A 3CCMF 3NVKE 2CVLA 5EO3A 4ERHA 3KHNA 1JFFA 1X7OA 3ON1A 4TV9B 3WXMB 1XBIA 1VQOF 5LYJA 2OTLF 3S02A 2JNBA 3PLAC 1RLUA 1W55A 1RQ7A 3U0OA 2OHWA 3FD6A 3CYPB 5G4VC 2CSLA 4X3MA 5DCVA 1SA0B 4U39A 5HWEA 2UYNA 3K12A 3RE3A 2HX0A 1VQ5F 1VK3A 4B62A 1CN7A 5EWRA 3CCLF 1H48A 2Q1XA 5LP6C 4YJ3B 1YJNF 1GO0A 1KNKA 2UYJA 3KIZA 1W5BA 2BTOA 1Q86H 4IIJA 3FPIA 1W5AA 3RYIB 4E6EA 3VYTC 1COMA 4C8EA 1NJIH 4NQ3A 4ZHVA 3KJJA 4G4ZA 3GHZA 4F6RA 5KX5B 1VHAA 1X52A 3HKEA 3V4DA 4DRXA 3K2XA 5LP6B 3J7AR 4X1YB 3HAXD 3TD4A 1YHQF 1SZQA 3BYQA 2RHJA 3TD3A 3M1XA 2BTQB 4C4WC 5KMGA 3IKEA 2H8EA 3V7EA 3WJQA 4ZI7A 4TV8A 4TUYA 3JALA 4LNUB 5LA6A 2H6LA 1NQ3A 5GIPC 2OTJF 2Z01A 3JATA 3L7QA 2I6DA 5JCOC 5FNVB 1W5EA 3F0FA 3N2KA 1YQNA 3P10A 3IMPA 3B6NA 1TUBB 4BT7A 4X1KB 3CYQA 3UT5B 1W41A 2BO1A 5IYZA 1M1KH 3M84A 3E1YA 3MCAB 5JQGA 2LBTA 1ZWZA 5HY2A 5LXTB 1Q81H 1XRGA 1W3EX 3DC2A 2Q1YA 5BMVA 3QUWA 3VMFB 4BY9D 4EB6A 2RHOA 3ZOPA 3ZP4A 2CWJA 3KJKA 4RHAA 2UYPA 5B8FA 1U3LA 1KQSF 5IJ0B 4R40B 4U3JA 5BMVB 5MN4A 2R6R1 1VQVA 2AIFA 2VAPA 3HJWC 1T0AA 4XCQA 4NWOB 1JY8A 3M4SA 4G4VA 3JAKB 4ZHQA 3OONA 3F0EA 1VQ8F 1IV3A 4C8GA 1Z5WA 1FFXB 5J2TB 3HKCB 4BVRA 1KNJA 1VQPF 5FLXM 1VQ7F 3GTZA 4O4JB 2VGNA 3V7QA 3K0TA 3I7TA 4ZHQB 3QTYA 3I56F 5AVMA 3FFMA 3CMEF 2QEXF 3NVIB 4I50A 5JVDB 5CB4A 3EORA 3N4YA 1VQ9F 1VQNF 3RYFB 3IEWA 4X20B 3VYUC 4BT2A 1IV4A 3OBWA 2HP3A 3JCMM 1X25A 5MN5A 2P6YA 2F9ZC 1GX1A 1FNKA 4ZHYB 3VI6A 3CXCF 1XHOA 2WALA 3P0ZA 1VQ4F 4O4HA 5J2TA 1X7PA 1VH8A 3GYQA 3JAKA 3WGJA 1TUBA 2IAFA 4O4HB 2GVIA 4HNAB 1VQMF 2RHLA 2HVYD 3ERNA 2I6RA 1IV2A 5IJ0A 2W8BC 3F0GA 5LA6B 1VQKF 4TUYB 2HS0A 5CB4B 4ZI7B 5IJ9B 4EB6B 2QI2A 5KMGB 3RYFA 2G9IA 1W59A 4YJ2B 3J80M 1ONIA 3CPQA 5JVDA 5G4UC 2DT4A 1KC8H 5LP6A 1NMUB 3SIVA 2PMPA 1E7KA 2CW4A 4X1KA 1FFXA 2BTUA 3WPXA 1S72F 3N2KB 5LYJB 5FJ4C 2OZBA 2Z1TA 3D54A 3I3FA 3WGNA 4TV9A 5EB1B 1OAPA 4YJ2A 2FGYA 4TV8B 2HS4A 2EWCA 4U3JB 3Q8HA 3VO8A 2CZWA 2RB9A 1YITF 3AGKA 1XV2A 5IT9M 3K14A 5HP7A 4TZZA 3IEQA 3VCZA 2HRUA 5JQGB 5KX5A 3CCQF 5IYZB 3UT5A 3QHDA 1SA0A 3FD5A 3S0YA 3OBYA 3CCJF 2VGMA 4EI9A 1VQLF 2ZAUA 3JVHA 5LXTA 5GAPK 1VQ6F 4O4JA 2AMTA 3CCUF 2GLZA 3JATB 3LWPC 3JALB
chains in the Genus database with same CATH topology
1IV3A 3K2XA 4C8GA 3RE3A 1H47A 1GX1A 1KNJA 3FBAA 3K14A 2UZHA 3P0ZA 3IEQA 1U40A 1H48A 2PMPA 1VH8A 3IKEA 3MBMA 4C8IA 3ELCA 1KNKA 1W55A 3F0DA 5B8FA 3QHDA 1U3LA 1U43A 4C82A 3T80A 3FPIA 3KE1A 3EORA 3ERNA 1IV1A 3ESJA 1IV2A 3JVHA 4C81A 1U3PA 4C8EA 3F0FA 2AMTA 3IEWA 3F0GA 1YQNA 3IKFA 1JN1A 3P10A 1T0AA 2GZLA 1JY8A 3B6NA 1IV4A 3F6MA 1VHAA 3GHZA 1W57A 3Q8HA 3F0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV3 A;  3K2X A;  4C8G A;  3RE3 A;  1H47 A;  1GX1 A;  1KNJ A;  3FBA A;  3K14 A;  2UZH A;  3P0Z A;  3IEQ A;  1U40 A;  1H48 A;  2PMP A;  1VH8 A;  3IKE A;  3MBM A;  4C8I A;  3ELC A;  1KNK A;  1W55 A;  3F0D A;  5B8F A;  3QHD A;  1U3L A;  1U43 A;  4C82 A;  3T80 A;  3FPI A;  3KE1 A;  3EOR A;  3ERN A;  1IV1 A;  3ESJ A;  1IV2 A;  3JVH A;  4C81 A;  1U3P A;  4C8E A;  3F0F A;  2AMT A;  3IEW A;  3F0G A;  1YQN A;  3IKF A;  1JN1 A;  3P10 A;  1T0A A;  2GZL A;  1JY8 A;  3B6N A;  1IV4 A;  3F6M A;  1VHA A;  3GHZ A;  1W57 A;  3Q8H A;  3F0E A; 
#chains in the Genus database with same CATH topology
 3D00 A;  3CMA F;  2VAM A;  4ZOL A;  5FNV A;  2H8C A;  2MQE A;  2UYN B;  3N4Z A;  5IJ9 A;  3WPW A;  1K8A H;  5EIB D;  3HKE B;  2ZOV A;  1TVK B;  3WJP A;  4IHJ B;  3WGM A;  4B45 A;  3IKF A;  3C9T A;  3G71 F;  1YIJ F;  4HNA A;  3MCQ A;  1QAH A;  4G88 A;  5HP8 A;  4BT5 A;  2HS3 A;  2HRY A;  4DXD A;  2YYE A;  3CD6 F;  3CCS F;  2R75 1;  5GAN K;  3VOA A;  3MBM A;  4EI7 A;  3WGL A;  3F0D A;  1H7M A;  3IR9 A;  1FSZ A;  3HTN A;  4X20 A;  3LWR C;  5HXU A;  1RLG A;  1IV1 A;  3ESJ A;  3NK6 A;  1UI9 A;  2NMU A;  4I50 B;  1K9M H;  4X3L A;  4WBN B;  3F6M A;  1QU9 A;  3JAS B;  5HY4 A;  2LBW A;  3N2G A;  5JCO A;  1UFY A;  1YI2 F;  4F6R B;  1K73 H;  1RA4 A;  3CC2 F;  2IG8 A;  4PWT A;  3HKD B;  3RYI A;  3HKC A;  3HKB B;  2OTM A;  3E20 B;  2LCA A;  1T0K B;  4BT3 A;  3LME A;  1JJ2 F;  2ALE A;  4C81 A;  3CPW F;  1Q8R A;  3JAW A;  3JAR B;  5JH7 A;  4ZK7 A;  4ZHW A;  3CCR F;  2K1S A;  3NMU C;  4B46 A;  3OW2 F;  5EIB C;  3S06 A;  2Z1E A;  3LFO A;  1U40 A;  2CHT A;  2ZVY A;  1RQ2 A;  3RYH B;  5EB0 A;  2YXZ A;  1W58 1;  3D01 A;  4KWE A;  4IIJ B;  4O4L B;  5CA1 B;  4BT4 A;  2HP0 B;  2KGW A;  5LOV A;  2RHH A;  4O2B B;  5CA0 B;  2PHN A;  2HQS C;  4YJ3 A;  3T80 A;  3VYS C;  3KE1 A;  5HY1 A;  3P4E A;  5HY0 A;  1FNJ A;  2KTV A;  4G4X A;  2VXY A;  2Z1F A;  4BW0 B;  1CK2 A;  1JFF B;  4LNU A;  5C8Y B;  2V9Y A;  5J2U A;  1W2B F;  3DDN A;  4I4T A;  3RYC A;  1SDS A;  3VOB A;  5GIN C;  4B5C A;  3JAW B;  3PAF A;  5HXZ A;  4O2A A;  3CG6 A;  3S0H A;  2DYY A;  3C9U A;  4X1Y A;  1Z5V A;  4LCK A;  4DRX B;  4G4Y A;  3HKD A;  2QTP A;  4C82 A;  2QA4 F;  3CC7 F;  3I55 F;  5EAZ A;  2ZOD A;  3CCE F;  5ITZ A;  3J81 M;  1KD1 H;  3HWU A;  4BT6 A;  1JN1 A;  2L26 A;  1Q82 H;  5LOV B;  2HP0 A;  4G4W A;  1J7H A;  3G6E F;  1OFU A;  2B33 A;  4O4L A;  3LWV C;  3LWQ C;  1N8R H;  3RYH A;  5A2Q M;  3FBA A;  3E22 B;  3C9R A;  5EZY B;  1DBF A;  3R0P A;  2UZH A;  4FFB B;  4BVQ A;  3SIU A;  5EYP B;  1GZ0 A;  3RYC B;  2KG4 A;  5J2U B;  5C8Y A;  1QVG F;  3ELC A;  4M8I A;  1PF5 A;  3TD5 A;  4EI8 A;  3LWO C;  4X1I A;  5GON B;  1QVF F;  3C9S A;  3ZP7 A;  5EZY A;  4BVT A;  1U3P A;  4O4I B;  3S0W A;  1YGY A;  1JD1 A;  2N48 A;  3VTI C;  3G4S F;  1YJW F;  2ZVZ A;  5CA1 A;  3LDT A;  2CHS A;  4C8I A;  3S03 A;  1YJ9 F;  3HKB A;  5MN6 A;  1H47 A;  3C8L A;  4I55 A;  5ITZ B;  3JAM M;  4IHJ A;  2FC3 A;  1Q7Y H;  1CLI A;  4BVS A;  1TVK A;  1M90 H;  2ZF8 A;  1W42 A;  3ZO8 A;  3MDO A;  3JAS A;  4NUT A;  4WBN A;  3LYB A;  4I4T B;  1U43 A;  2LBX A;  1IPA A;  3CC4 F;  3CB2 A;  4ZOL B;  1GO1 A;  2GZL A;  4I55 B;  3E22 A;  1W57 A;  3WGK A;  1PXW A;  1R1M A;  1DT9 A;  4O2B A;  5CA0 A;  5GIO C;  2IQQ A;  2KTU A;  1ODE A;  3MQW A;  3O85 A;  4O4I A;  5GON A;  2Z1U A;  3N2G B;  4X1I B;  3V3T A;  4RQO A;  2AIZ P;  3RA5 A;  5JH7 B;  1QD9 A;  3JAR A;  3WJR A;  3NK7 A;  2VAW A;  5EYP A;  1W5F A;  4FFB A;  3VIU A;  3CCV F;  4O2A B;  1W40 A;  2UYK A;  3RA6 A;  3CCM F;  3NVK E;  2CVL A;  5EO3 A;  4ERH A;  3KHN A;  1JFF A;  1X7O A;  3ON1 A;  4TV9 B;  3WXM B;  1XBI A;  1VQO F;  5LYJ A;  2OTL F;  3S02 A;  2JNB A;  3PLA C;  1RLU A;  1W55 A;  1RQ7 A;  3U0O A;  2OHW A;  3FD6 A;  3CYP B;  5G4V C;  2CSL A;  4X3M A;  5DCV A;  1SA0 B;  4U39 A;  5HWE A;  2UYN A;  3K12 A;  3RE3 A;  2HX0 A;  1VQ5 F;  1VK3 A;  4B62 A;  1CN7 A;  5EWR A;  3CCL F;  1H48 A;  2Q1X A;  5LP6 C;  4YJ3 B;  1YJN F;  1GO0 A;  1KNK A;  2UYJ A;  3KIZ A;  1W5B A;  2BTO A;  1Q86 H;  4IIJ A;  3FPI A;  1W5A A;  3RYI B;  4E6E A;  3VYT C;  1COM A;  4C8E A;  1NJI H;  4NQ3 A;  4ZHV A;  3KJJ A;  4G4Z A;  3GHZ A;  4F6R A;  5KX5 B;  1VHA A;  1X52 A;  3HKE A;  3V4D A;  4DRX A;  3K2X A;  5LP6 B;  3J7A R;  4X1Y B;  3HAX D;  3TD4 A;  1YHQ F;  1SZQ A;  3BYQ A;  2RHJ A;  3TD3 A;  3M1X A;  2BTQ B;  4C4W C;  5KMG A;  3IKE A;  2H8E A;  3V7E A;  3WJQ A;  4ZI7 A;  4TV8 A;  4TUY A;  3JAL A;  4LNU B;  5LA6 A;  2H6L A;  1NQ3 A;  5GIP C;  2OTJ F;  2Z01 A;  3JAT A;  3L7Q A;  2I6D A;  5JCO C;  5FNV B;  1W5E A;  3F0F A;  3N2K A;  1YQN A;  3P10 A;  3IMP A;  3B6N A;  1TUB B;  4BT7 A;  4X1K B;  3CYQ A;  3UT5 B;  1W41 A;  2BO1 A;  5IYZ A;  1M1K H;  3M84 A;  3E1Y A;  3MCA B;  5JQG A;  2LBT A;  1ZWZ A;  5HY2 A;  5LXT B;  1Q81 H;  1XRG A;  1W3E X;  3DC2 A;  2Q1Y A;  5BMV A;  3QUW A;  3VMF B;  4BY9 D;  4EB6 A;  2RHO A;  3ZOP A;  3ZP4 A;  2CWJ A;  3KJK A;  4RHA A;  2UYP A;  5B8F A;  1U3L A;  1KQS F;  5IJ0 B;  4R40 B;  4U3J A;  5BMV B;  5MN4 A;  2R6R 1;  1VQV A;  2AIF A;  2VAP A;  3HJW C;  1T0A A;  4XCQ A;  4NWO B;  1JY8 A;  3M4S A;  4G4V A;  3JAK B;  4ZHQ A;  3OON A;  3F0E A;  1VQ8 F;  1IV3 A;  4C8G A;  1Z5W A;  1FFX B;  5J2T B;  3HKC B;  4BVR A;  1KNJ A;  1VQP F;  5FLX M;  1VQ7 F;  3GTZ A;  4O4J B;  2VGN A;  3V7Q A;  3K0T A;  3I7T A;  4ZHQ B;  3QTY A;  3I56 F;  5AVM A;  3FFM A;  3CME F;  2QEX F;  3NVI B;  4I50 A;  5JVD B;  5CB4 A;  3EOR A;  3N4Y A;  1VQ9 F;  1VQN F;  3RYF B;  3IEW A;  4X20 B;  3VYU C;  4BT2 A;  1IV4 A;  3OBW A;  2HP3 A;  3JCM M;  1X25 A;  5MN5 A;  2P6Y A;  2F9Z C;  1GX1 A;  1FNK A;  4ZHY B;  3VI6 A;  3CXC F;  1XHO A;  2WAL A;  3P0Z A;  1VQ4 F;  4O4H A;  5J2T A;  1X7P A;  1VH8 A;  3GYQ A;  3JAK A;  3WGJ A;  1TUB A;  2IAF A;  4O4H B;  2GVI A;  4HNA B;  1VQM F;  2RHL A;  2HVY D;  3ERN A;  2I6R A;  1IV2 A;  5IJ0 A;  2W8B C;  3F0G A;  5LA6 B;  1VQK F;  4TUY B;  2HS0 A;  5CB4 B;  4ZI7 B;  5IJ9 B;  4EB6 B;  2QI2 A;  5KMG B;  3RYF A;  2G9I A;  1W59 A;  4YJ2 B;  3J80 M;  1ONI A;  3CPQ A;  5JVD A;  5G4U C;  2DT4 A;  1KC8 H;  5LP6 A;  1NMU B;  3SIV A;  2PMP A;  1E7K A;  2CW4 A;  4X1K A;  1FFX A;  2BTU A;  3WPX A;  1S72 F;  3N2K B;  5LYJ B;  5FJ4 C;  2OZB A;  2Z1T A;  3D54 A;  3I3F A;  3WGN A;  4TV9 A;  5EB1 B;  1OAP A;  4YJ2 A;  2FGY A;  4TV8 B;  2HS4 A;  2EWC A;  4U3J B;  3Q8H A;  3VO8 A;  2CZW A;  2RB9 A;  1YIT F;  3AGK A;  1XV2 A;  5IT9 M;  3K14 A;  5HP7 A;  4TZZ A;  3IEQ A;  3VCZ A;  2HRU A;  5JQG B;  5KX5 A;  3CCQ F;  5IYZ B;  3UT5 A;  3QHD A;  1SA0 A;  3FD5 A;  3S0Y A;  3OBY A;  3CCJ F;  2VGM A;  4EI9 A;  1VQL F;  2ZAU A;  3JVH A;  5LXT A;  5GAP K;  1VQ6 F;  4O4J A;  2AMT A;  3CCU F;  2GLZ A;  3JAT B;  3LWP C;  3JAL B; 
#chains in the Genus database with same CATH homology
 1IV3 A;  3K2X A;  4C8G A;  3RE3 A;  1H47 A;  1GX1 A;  1KNJ A;  3FBA A;  3K14 A;  2UZH A;  3P0Z A;  3IEQ A;  1U40 A;  1H48 A;  2PMP A;  1VH8 A;  3IKE A;  3MBM A;  4C8I A;  3ELC A;  1KNK A;  1W55 A;  3F0D A;  5B8F A;  3QHD A;  1U3L A;  1U43 A;  4C82 A;  3T80 A;  3FPI A;  3KE1 A;  3EOR A;  3ERN A;  1IV1 A;  3ESJ A;  1IV2 A;  3JVH A;  4C81 A;  1U3P A;  4C8E A;  3F0F A;  2AMT A;  3IEW A;  3F0G A;  1YQN A;  3IKF A;  1JN1 A;  3P10 A;  1T0A A;  2GZL A;  1JY8 A;  3B6N A;  1IV4 A;  3F6M A;  1VHA A;  3GHZ A;  1W57 A;  3Q8H A;  3F0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...