3ESJA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
b'MLEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Escherichia coli k-12
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
total genus 50
structure length 162
sequence length 162
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3esjA00
1YQNA 2UZHA 2GZLA 1KNKA 4C8IA 3IKFA 3ESJA 1KNJA 3MBMA 3FBAA 1VHAA 4C8EA 1IV3A 3F0DA 3KE1A 1H47A 1U3PA 2PMPA 3RE3A 3B6NA 3IKEA 3F6MA 1GX1A 1VH8A 3K14A 3T80A 1U40A 1U3LA 1U43A 4C81A 3GHZA 4C82A 3QHDA 1IV2A 2AMTA 3EORA 1JN1A 3P10A 1IV1A 3FPIA 3P0ZA 3ERNA 3JVHA 3F0GA 3Q8HA 1JY8A 1IV4A 1W55A 3ELCA 3IEQA 3K2XA 1H48A 1W57A 3F0EA 3IEWA 4C8GA 1T0AA 5B8FA 3F0FA
chains in the Genus database with same CATH superfamily
2OHWA 2RHLA 3NVKE 3TD3A 3D54A 1K9MH 5LXTB 3N4YA 4BT3A 3VOAA 1K73H 5JCOA 3CD6F 4C8EA 1SA0A 3KE1A 3E1YA 1U3PA 1R1MA 5HP8A 1VQPF 5JH7A 4C81A 3CC4F 1YHQF 4R40B 1FSZA 3LWQC 5LP6B 1JN1A 2KTVA 2LCAA 5HP7A 1FNKA 4ZK7A 3I7TA 1JY8A 1NJIH 4O4IA 3K2XA 1XRGA 1SA0B 2IQQA 4EB6A 2HX0A 3IR9A 3S0WA 4F6RA 3S0HA 5EIBC 1X25A 1ONIA 4ZHQB 1IV3A 1OFUA 3P4EA 3N2GB 2VAPA 3S06A 1QVFF 3K14A 5EO3A 4BT2A 4O4IB 3HKEA 2HRUA 2UYNB 5ITZA 1GZ0A 3TD4A 4F6RB 3J7AR 5MN4A 2Z1EA 4ZHQA 2JNBA 3VI6A 3ESJA 1TUBB 5C8YA 4X3MA 4BT5A 5JQGB 3HKEB 4BY9D 5HY4A 3D00A 4NQ3A 5EAZA 4WBNB 4NUTA 4U3JB 3CMEF 4G4YA 1W3EX 1VQ9F 1H7MA 3HKBA 3ZP7A 3IMPA 1VQKF 1SDSA 4G88A 4O4HA 1Q86H 4HNAB 1W42A 5GANK 4EI9A 5B8FA 1K8AH 2Q1YA 2CHTA 2RHOA 1W5BA 3V7QA 1J7HA 3MBMA 5FJ4C 3L7QA 4TV9B 2GLZA 2PMPA 2VGMA 2K1SA 5CA0B 2R751 5CA1B 2B33A 2ZVYA 1N8RH 2QI2A 5EB1B 5GIOC 3CC7F 3JASB 2HP3A 1IPAA 2Z1UA 3IEQA 2N48A 4TV9A 3AGKA 4TUYB 1YJNF 2HS4A 2YYEA 3M4SA 2GZLA 3WJQA 5CA0A 2MQEA 5CA1A 3C9RA 1VHAA 5J2UB 1FFXA 4O2AB 5HXZA 3RE3A 4BVTA 2Q1XA 5KMGB 4ZI7A 1PXWA 1U3LA 4TUYA 2V9YA 4O4JB 3UT5B 3CCEF 4O2BB 1YIJF 3V4DA 3F0GA 1KC8H 3CXCF 1W581 1JD1A 3LFOA 4ERHA 5GINC 1GO0A 4RQOA 2AIZP 4ZI7B 2YXZA 3S02A 4BT7A 3WGMA 3G71F 4O4JA 4G4WA 5KX5A 2R6R1 4YJ3A 1YITF 1QD9A 3VCZA 2WALA 2BTOA 3KJKA 4O2BA 3C9TA 3BYQA 4B5CA 1NMUB 2IAFA 4X1YB 3CCUF 1VQMF 3FD5A 1W5FA 3E20B 4EI7A 2HQSC 4I50B 2KGWA 2ALEA 3RYHA 1PF5A 1CLIA 3C8LA 4YJ3B 3LWOC 5FLXM 5JH7B 2UZHA 3DDNA 3MDOA 4G4XA 1KNJA 3JAWB 1ODEA 1NQ3A 1SZQA 1RLGA 1E7KA 1VQ7F 3B6NA 1W5EA 2BO1A 1YJWF 2KTUA 3RYHB 1X7OA 2CZWA 1XBIA 2Z01A 4C82A 3E22B 3RA6A 1VQNF 3WJRA 3CCLF 4BVSA 5IJ9A 1XHOA 3MQWA 2ZODA 2GVIA 3JAWA 1Q7YH 3CCJF 4I4TB 3N2GA 2G9IA 3KIZA 4G4ZA 1GO1A 2CVLA 1RA4A 2UYNA 2OTJF 3FBAA 2P6YA 4YJ2A 5DCVA 2W8BC 3R0PA 3K12A 4XCQA 4BVRA 3RYCA 3IKEA 3F6MA 2LBXA 1VK3A 3T80A 3V7EA 1YGYA 3JATA 5LOVA 1Q82H 3CYPB 3P10A 4BW0B 1CK2A 1TUBA 5C8YB 3FPIA 3MCAB 5EZYB 3GTZA 4LNUB 3I55F 5G4VC 3RYIA 1X52A 4TV8B 4YJ2B 3DC2A 4WBNA 3CCRF 4U3JA 3F0FA 2RHHA 3RYCB 3HKBB 4X1KB 5LA6A 3JATB 5EIBD 4BT4A 4I55A 5HXUA 4DRXB 3QTYA 3PLAC 1TVKB 1YJ9F 3HTNA 4LNUA 3JAMM 4HNAA 1VH8A 3WGKA 3RYIB 2AIFA 4TV8A 1COMA 1YI2F 1VQ4F 3QHDA 1M1KH 1IV2A 5JCOC 2OTMA 1M90H 2FC3A 2H8CA 5LYJB 3JVHA 1JJ2F 3VO8A 5G4UC 3LMEA 5HWEA 5MN6A 1UFYA 3KJJA 1VQ8F 2ZAUA 2F9ZC 1W57A 2Z1TA 4DRXA 2ZF8A 2L26A 1Z5VA 2BTQB 3OBWA 3WJPA 3SIUA 3WPXA 3JASA 4KWEA 2VAMA 4G4VA 3S03A 2CW4A 2H6LA 3CCSF 4BT6A 3PAFA 1OAPA 3VIUA 3I3FA 1W40A 3WGNA 3P0ZA 3CPQA 3FFMA 3Q8HA 1IV4A 5J2UA 1FFXB 1DT9A 1RQ2A 5HY1A 3F0EA 5BMVA 5KMGA 4FFBA 5IYZB 1VQOF 5HY2A 2HVYD 3JALA 3UT5A 4IIJA 3I56F 1S72F 2RHJA 4X1IA 3F0DA 3MCQA 4NWOB 1RQ7A 1VQVA 1GX1A 3J81M 3CYQA 5BMVB 1QU9A 4PWTA 3CCMF 5JVDB 5LXTA 4FFBB 1Z5WA 1DBFA 1XV2A 1IV1A 3JCMM 1KQSF 2Z1FA 2VXYA 3HWUA 3U0OA 5GIPC 3IEWA 3LYBA 4C8GA 3O85A 1W2BF 3ZP4A 5CB4B 3CPWF 5LP6A 3IKFA 5GONA 3CB2A 3VYUC 3CC2F 1UI9A 3WGJA 4I50A 2DT4A 5JVDA 4M8IA 3JARB 4B62A 3G6EF 3ZO8A 2QEXF 2I6DA 5EYPA 2EWCA 1VQ5F 4EB6B 1VQLF 3GHZA 3M1XA 2CWJA 3OONA 3TD5A 4B45A 3VOBA 5CB4A 3OW2F 3ERNA 5GONB 2LBTA 1CN7A 3LWPC 1T0KB 3ELCA 1Q81H 3CCQF 3JARA 5IJ0A 3RA5A 2BTUA 2HS3A 5EYPB 3HKCB 3E22A 5ITZB 4X20B 5HY0A 3NVIB 3VTIC 2I6RA 3LDTA 3OBYA 3K0TA 3JAKB 2LBWA 5IJ9B 3KHNA 3D01A 2H8EA 4I4TA 3CG6A 3CCVF 4O4LA 1RLUA 2UYJA 1KD1H 5EWRA 5IJ0B 2AMTA 2RB9A 5JQGA 3RYFB 3WGLA 3HKCA 3CMAF 4X20A 1W55A 3NK7A 2ZOVA 3N2KB 2QTPA 2FGYA 3JAKA 1T0AA 2QA4F 3HJWC 4X3LA 3NMUC 3QUWA 3VYSC 5LOVB 4LCKA 4O4LB 2OTLF 5EZYA 3RYFA 2PHNA 4O4HB 3J80M 2ZVZA 2VAWA 1QVGF 5IT9M 4BVQA 3G4SF 5EB0A 3N2KA 2HP0A 1W5AA 5J2TB 3EORA 3N4ZA 4X1KA 5GAPK 5LA6B 5A2QM 4I55B 3LWVC 1ZWZA 1TVKA 5MN5A 3NK6A 1YQNA 2HS0A 1KNKA 4DXDA 3FD6A 2IG8A 3GYQA 2HP0B 2CSLA 5LYJA 5J2TA 5FNVA 4EI8A 2OZBA 1H47A 2NMUA 3V3TA 4U39A 4TZZA 1U40A 3HKDB 4E6EA 2HRYA 3HAXD 3WPWA 4O2AA 3S0YA 4C4WC 3WXMB 1JFFB 5FNVB 1VQ6F 4ZOLA 1X7PA 4IHJA 2DYYA 3C9UA 1W59A 3LWRC 4RHAA 4C8IA 3C9SA 5LP6C 1QAHA 3HKDA 1W41A 2CHSA 2UYKA 3M84A 5AVMA 1Q8RA 3VMFB 4B46A 3VYTC 1U43A 1JFFA 5IYZA 4ZOLB 1FNJA 4IHJB 4ZHYB 5KX5B 4ZHVA 3JALB 3ZOPA 2KG4A 2VGNA 4IIJB 4X1IB 3SIVA 1H48A 4X1YA 4ZHWA 3ON1A 2UYPA
chains in the Genus database with same CATH topology
1YQNA 2UZHA 2GZLA 1KNKA 4C8IA 3IKFA 3ESJA 1KNJA 3MBMA 3FBAA 1VHAA 4C8EA 1IV3A 3F0DA 3KE1A 1H47A 1U3PA 2PMPA 3RE3A 3B6NA 3IKEA 3F6MA 1GX1A 1VH8A 3K14A 3T80A 1U40A 1U3LA 1U43A 4C81A 3GHZA 4C82A 3QHDA 1IV2A 2AMTA 3EORA 1JN1A 3P10A 1IV1A 3FPIA 3P0ZA 3ERNA 3JVHA 3F0GA 3Q8HA 1JY8A 1IV4A 1W55A 3ELCA 3IEQA 3K2XA 1H48A 1W57A 3F0EA 3IEWA 4C8GA 1T0AA 5B8FA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQN A;  2UZH A;  2GZL A;  1KNK A;  4C8I A;  3IKF A;  3ESJ A;  1KNJ A;  3MBM A;  3FBA A;  1VHA A;  4C8E A;  1IV3 A;  3F0D A;  3KE1 A;  1H47 A;  1U3P A;  2PMP A;  3RE3 A;  3B6N A;  3IKE A;  3F6M A;  1GX1 A;  1VH8 A;  3K14 A;  3T80 A;  1U40 A;  1U3L A;  1U43 A;  4C81 A;  3GHZ A;  4C82 A;  3QHD A;  1IV2 A;  2AMT A;  3EOR A;  1JN1 A;  3P10 A;  1IV1 A;  3FPI A;  3P0Z A;  3ERN A;  3JVH A;  3F0G A;  3Q8H A;  1JY8 A;  1IV4 A;  1W55 A;  3ELC A;  3IEQ A;  3K2X A;  1H48 A;  1W57 A;  3F0E A;  3IEW A;  4C8G A;  1T0A A;  5B8F A;  3F0F A; 
#chains in the Genus database with same CATH topology
 2OHW A;  2RHL A;  3NVK E;  3TD3 A;  3D54 A;  1K9M H;  5LXT B;  3N4Y A;  4BT3 A;  3VOA A;  1K73 H;  5JCO A;  3CD6 F;  4C8E A;  1SA0 A;  3KE1 A;  3E1Y A;  1U3P A;  1R1M A;  5HP8 A;  1VQP F;  5JH7 A;  4C81 A;  3CC4 F;  1YHQ F;  4R40 B;  1FSZ A;  3LWQ C;  5LP6 B;  1JN1 A;  2KTV A;  2LCA A;  5HP7 A;  1FNK A;  4ZK7 A;  3I7T A;  1JY8 A;  1NJI H;  4O4I A;  3K2X A;  1XRG A;  1SA0 B;  2IQQ A;  4EB6 A;  2HX0 A;  3IR9 A;  3S0W A;  4F6R A;  3S0H A;  5EIB C;  1X25 A;  1ONI A;  4ZHQ B;  1IV3 A;  1OFU A;  3P4E A;  3N2G B;  2VAP A;  3S06 A;  1QVF F;  3K14 A;  5EO3 A;  4BT2 A;  4O4I B;  3HKE A;  2HRU A;  2UYN B;  5ITZ A;  1GZ0 A;  3TD4 A;  4F6R B;  3J7A R;  5MN4 A;  2Z1E A;  4ZHQ A;  2JNB A;  3VI6 A;  3ESJ A;  1TUB B;  5C8Y A;  4X3M A;  4BT5 A;  5JQG B;  3HKE B;  4BY9 D;  5HY4 A;  3D00 A;  4NQ3 A;  5EAZ A;  4WBN B;  4NUT A;  4U3J B;  3CME F;  4G4Y A;  1W3E X;  1VQ9 F;  1H7M A;  3HKB A;  3ZP7 A;  3IMP A;  1VQK F;  1SDS A;  4G88 A;  4O4H A;  1Q86 H;  4HNA B;  1W42 A;  5GAN K;  4EI9 A;  5B8F A;  1K8A H;  2Q1Y A;  2CHT A;  2RHO A;  1W5B A;  3V7Q A;  1J7H A;  3MBM A;  5FJ4 C;  3L7Q A;  4TV9 B;  2GLZ A;  2PMP A;  2VGM A;  2K1S A;  5CA0 B;  2R75 1;  5CA1 B;  2B33 A;  2ZVY A;  1N8R H;  2QI2 A;  5EB1 B;  5GIO C;  3CC7 F;  3JAS B;  2HP3 A;  1IPA A;  2Z1U A;  3IEQ A;  2N48 A;  4TV9 A;  3AGK A;  4TUY B;  1YJN F;  2HS4 A;  2YYE A;  3M4S A;  2GZL A;  3WJQ A;  5CA0 A;  2MQE A;  5CA1 A;  3C9R A;  1VHA A;  5J2U B;  1FFX A;  4O2A B;  5HXZ A;  3RE3 A;  4BVT A;  2Q1X A;  5KMG B;  4ZI7 A;  1PXW A;  1U3L A;  4TUY A;  2V9Y A;  4O4J B;  3UT5 B;  3CCE F;  4O2B B;  1YIJ F;  3V4D A;  3F0G A;  1KC8 H;  3CXC F;  1W58 1;  1JD1 A;  3LFO A;  4ERH A;  5GIN C;  1GO0 A;  4RQO A;  2AIZ P;  4ZI7 B;  2YXZ A;  3S02 A;  4BT7 A;  3WGM A;  3G71 F;  4O4J A;  4G4W A;  5KX5 A;  2R6R 1;  4YJ3 A;  1YIT F;  1QD9 A;  3VCZ A;  2WAL A;  2BTO A;  3KJK A;  4O2B A;  3C9T A;  3BYQ A;  4B5C A;  1NMU B;  2IAF A;  4X1Y B;  3CCU F;  1VQM F;  3FD5 A;  1W5F A;  3E20 B;  4EI7 A;  2HQS C;  4I50 B;  2KGW A;  2ALE A;  3RYH A;  1PF5 A;  1CLI A;  3C8L A;  4YJ3 B;  3LWO C;  5FLX M;  5JH7 B;  2UZH A;  3DDN A;  3MDO A;  4G4X A;  1KNJ A;  3JAW B;  1ODE A;  1NQ3 A;  1SZQ A;  1RLG A;  1E7K A;  1VQ7 F;  3B6N A;  1W5E A;  2BO1 A;  1YJW F;  2KTU A;  3RYH B;  1X7O A;  2CZW A;  1XBI A;  2Z01 A;  4C82 A;  3E22 B;  3RA6 A;  1VQN F;  3WJR A;  3CCL F;  4BVS A;  5IJ9 A;  1XHO A;  3MQW A;  2ZOD A;  2GVI A;  3JAW A;  1Q7Y H;  3CCJ F;  4I4T B;  3N2G A;  2G9I A;  3KIZ A;  4G4Z A;  1GO1 A;  2CVL A;  1RA4 A;  2UYN A;  2OTJ F;  3FBA A;  2P6Y A;  4YJ2 A;  5DCV A;  2W8B C;  3R0P A;  3K12 A;  4XCQ A;  4BVR A;  3RYC A;  3IKE A;  3F6M A;  2LBX A;  1VK3 A;  3T80 A;  3V7E A;  1YGY A;  3JAT A;  5LOV A;  1Q82 H;  3CYP B;  3P10 A;  4BW0 B;  1CK2 A;  1TUB A;  5C8Y B;  3FPI A;  3MCA B;  5EZY B;  3GTZ A;  4LNU B;  3I55 F;  5G4V C;  3RYI A;  1X52 A;  4TV8 B;  4YJ2 B;  3DC2 A;  4WBN A;  3CCR F;  4U3J A;  3F0F A;  2RHH A;  3RYC B;  3HKB B;  4X1K B;  5LA6 A;  3JAT B;  5EIB D;  4BT4 A;  4I55 A;  5HXU A;  4DRX B;  3QTY A;  3PLA C;  1TVK B;  1YJ9 F;  3HTN A;  4LNU A;  3JAM M;  4HNA A;  1VH8 A;  3WGK A;  3RYI B;  2AIF A;  4TV8 A;  1COM A;  1YI2 F;  1VQ4 F;  3QHD A;  1M1K H;  1IV2 A;  5JCO C;  2OTM A;  1M90 H;  2FC3 A;  2H8C A;  5LYJ B;  3JVH A;  1JJ2 F;  3VO8 A;  5G4U C;  3LME A;  5HWE A;  5MN6 A;  1UFY A;  3KJJ A;  1VQ8 F;  2ZAU A;  2F9Z C;  1W57 A;  2Z1T A;  4DRX A;  2ZF8 A;  2L26 A;  1Z5V A;  2BTQ B;  3OBW A;  3WJP A;  3SIU A;  3WPX A;  3JAS A;  4KWE A;  2VAM A;  4G4V A;  3S03 A;  2CW4 A;  2H6L A;  3CCS F;  4BT6 A;  3PAF A;  1OAP A;  3VIU A;  3I3F A;  1W40 A;  3WGN A;  3P0Z A;  3CPQ A;  3FFM A;  3Q8H A;  1IV4 A;  5J2U A;  1FFX B;  1DT9 A;  1RQ2 A;  5HY1 A;  3F0E A;  5BMV A;  5KMG A;  4FFB A;  5IYZ B;  1VQO F;  5HY2 A;  2HVY D;  3JAL A;  3UT5 A;  4IIJ A;  3I56 F;  1S72 F;  2RHJ A;  4X1I A;  3F0D A;  3MCQ A;  4NWO B;  1RQ7 A;  1VQV A;  1GX1 A;  3J81 M;  3CYQ A;  5BMV B;  1QU9 A;  4PWT A;  3CCM F;  5JVD B;  5LXT A;  4FFB B;  1Z5W A;  1DBF A;  1XV2 A;  1IV1 A;  3JCM M;  1KQS F;  2Z1F A;  2VXY A;  3HWU A;  3U0O A;  5GIP C;  3IEW A;  3LYB A;  4C8G A;  3O85 A;  1W2B F;  3ZP4 A;  5CB4 B;  3CPW F;  5LP6 A;  3IKF A;  5GON A;  3CB2 A;  3VYU C;  3CC2 F;  1UI9 A;  3WGJ A;  4I50 A;  2DT4 A;  5JVD A;  4M8I A;  3JAR B;  4B62 A;  3G6E F;  3ZO8 A;  2QEX F;  2I6D A;  5EYP A;  2EWC A;  1VQ5 F;  4EB6 B;  1VQL F;  3GHZ A;  3M1X A;  2CWJ A;  3OON A;  3TD5 A;  4B45 A;  3VOB A;  5CB4 A;  3OW2 F;  3ERN A;  5GON B;  2LBT A;  1CN7 A;  3LWP C;  1T0K B;  3ELC A;  1Q81 H;  3CCQ F;  3JAR A;  5IJ0 A;  3RA5 A;  2BTU A;  2HS3 A;  5EYP B;  3HKC B;  3E22 A;  5ITZ B;  4X20 B;  5HY0 A;  3NVI B;  3VTI C;  2I6R A;  3LDT A;  3OBY A;  3K0T A;  3JAK B;  2LBW A;  5IJ9 B;  3KHN A;  3D01 A;  2H8E A;  4I4T A;  3CG6 A;  3CCV F;  4O4L A;  1RLU A;  2UYJ A;  1KD1 H;  5EWR A;  5IJ0 B;  2AMT A;  2RB9 A;  5JQG A;  3RYF B;  3WGL A;  3HKC A;  3CMA F;  4X20 A;  1W55 A;  3NK7 A;  2ZOV A;  3N2K B;  2QTP A;  2FGY A;  3JAK A;  1T0A A;  2QA4 F;  3HJW C;  4X3L A;  3NMU C;  3QUW A;  3VYS C;  5LOV B;  4LCK A;  4O4L B;  2OTL F;  5EZY A;  3RYF A;  2PHN A;  4O4H B;  3J80 M;  2ZVZ A;  2VAW A;  1QVG F;  5IT9 M;  4BVQ A;  3G4S F;  5EB0 A;  3N2K A;  2HP0 A;  1W5A A;  5J2T B;  3EOR A;  3N4Z A;  4X1K A;  5GAP K;  5LA6 B;  5A2Q M;  4I55 B;  3LWV C;  1ZWZ A;  1TVK A;  5MN5 A;  3NK6 A;  1YQN A;  2HS0 A;  1KNK A;  4DXD A;  3FD6 A;  2IG8 A;  3GYQ A;  2HP0 B;  2CSL A;  5LYJ A;  5J2T A;  5FNV A;  4EI8 A;  2OZB A;  1H47 A;  2NMU A;  3V3T A;  4U39 A;  4TZZ A;  1U40 A;  3HKD B;  4E6E A;  2HRY A;  3HAX D;  3WPW A;  4O2A A;  3S0Y A;  4C4W C;  3WXM B;  1JFF B;  5FNV B;  1VQ6 F;  4ZOL A;  1X7P A;  4IHJ A;  2DYY A;  3C9U A;  1W59 A;  3LWR C;  4RHA A;  4C8I A;  3C9S A;  5LP6 C;  1QAH A;  3HKD A;  1W41 A;  2CHS A;  2UYK A;  3M84 A;  5AVM A;  1Q8R A;  3VMF B;  4B46 A;  3VYT C;  1U43 A;  1JFF A;  5IYZ A;  4ZOL B;  1FNJ A;  4IHJ B;  4ZHY B;  5KX5 B;  4ZHV A;  3JAL B;  3ZOP A;  2KG4 A;  2VGN A;  4IIJ B;  4X1I B;  3SIV A;  1H48 A;  4X1Y A;  4ZHW A;  3ON1 A;  2UYP A; 
#chains in the Genus database with same CATH homology
 1YQN A;  2UZH A;  2GZL A;  1KNK A;  4C8I A;  3IKF A;  3ESJ A;  1KNJ A;  3MBM A;  3FBA A;  1VHA A;  4C8E A;  1IV3 A;  3F0D A;  3KE1 A;  1H47 A;  1U3P A;  2PMP A;  3RE3 A;  3B6N A;  3IKE A;  3F6M A;  1GX1 A;  1VH8 A;  3K14 A;  3T80 A;  1U40 A;  1U3L A;  1U43 A;  4C81 A;  3GHZ A;  4C82 A;  3QHD A;  1IV2 A;  2AMT A;  3EOR A;  1JN1 A;  3P10 A;  1IV1 A;  3FPI A;  3P0Z A;  3ERN A;  3JVH A;  3F0G A;  3Q8H A;  1JY8 A;  1IV4 A;  1W55 A;  3ELC A;  3IEQ A;  3K2X A;  1H48 A;  1W57 A;  3F0E A;  3IEW A;  4C8G A;  1T0A A;  5B8F A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...