3ESJA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MLEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 50
structure length 162
sequence length 162
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3esjA00
1U3LA 3EORA 3ESJA 3F0GA 3IKEA 1KNKA 1U43A 2AMTA 2PMPA 3P10A 4C8EA 2GZLA 3K2XA 3F0DA 1KNJA 3Q8HA 1IV2A 1H48A 1W57A 3K14A 3MBMA 4C8GA 3QHDA 3FPIA 1H47A 3ERNA 3T80A 3IKFA 3ELCA 1JN1A 1IV4A 1IV3A 3F0FA 4C82A 1U40A 3P0ZA 1U3PA 1VHAA 1YQNA 4C8IA 1W55A 5B8FA 1JY8A 3GHZA 3B6NA 3KE1A 3FBAA 1IV1A 1GX1A 3RE3A 1VH8A 1T0AA 3F6MA 3F0EA 4C81A 3IEWA 3JVHA 2UZHA 3IEQA
chains in the Genus database with same CATH superfamily
1QVFF 1W42A 2VAPA 2Z01A 3D54A 3I56F 1N8RH 3CPWF 2CSLA 3GTZA 2AIFA 4YJ2A 2PMPA 3C9RA 5GIPC 1W5BA 4I50B 4U3JB 3WPWA 5BMVA 1H48A 5JH7A 2BTOA 5HY2A 3ELCA 1JN1A 2H8CA 1DBFA 1VQKF 4C82A 3NMUC 2GVIA 3JALB 4BVSA 3JAWA 2W8BC 3M4SA 3KE1A 5EYPB 1RLGA 3JASB 3OW2F 2P6YA 1VH8A 4I4TA 1VQMF 3N2KB 3JAMM 1TVKA 2I6DA 5GONB 4LNUB 2HVYD 3ZOPA 4F6RB 1FNJA 3VOAA 4O4IB 1KNJA 4TUYB 1RLUA 5FNVB 1YHQF 1KC8H 2OTMA 3JARA 3N4YA 3WJPA 3FPIA 2VGMA 3RYIB 5JQGB 4G4ZA 3JALA 4IHJB 3HKCB 2CW4A 3V7EA 5EYPA 3JASA 4R40B 2Z1EA 3RYHA 5GIOC 4I55B 3HKEB 1ODEA 3N2KA 5G4UC 1VK3A 3NK6A 5GONA 1W5FA 2UYJA 4LNUA 5EAZA 3S0HA 4X1IB 1T0KB 3CYPB 4O4IA 5HY0A 5FNVA 1R1MA 3LYBA 5JCOA 3N4ZA 1IV2A 4C8GA 3VTIC 1M90H 1H47A 4IHJA 5G4VC 4EB6B 1KQSF 1VQ6F 2V9YA 3BYQA 1U3PA 5LP6C 5LXTB 3JAKB 3DDNA 5EIBC 3RYFB 4I55A 1PF5A 3HKEA 5KMGB 1KD1H 3FFMA 3RYCB 3CMAF 3ZP4A 3WGMA 2LBWA 4FFBA 2MQEA 3S0YA 1SZQA 2BO1A 3IEWA 2HP3A 3HKDB 3HKBB 3ESJA 2ZF8A 4U39A 4X1YB 2BTUA 3AGKA 3CCVF 4YJ3B 5IYZB 3OBYA 5EZYB 5LXTA 1VQNF 3F0FA 1U40A 2RHLA 3E1YA 3RYFA 5KMGA 1ONIA 3GHZA 3HWUA 3S03A 3MCAB 2PHNA 4BW0B 5EWRA 1YI2F 4ZHQA 3VCZA 4EI9A 2H8EA 3FD6A 1X52A 2AMTA 4M8IA 2HQSC 4O4LB 3K2XA 4X1KB 1W5EA 4RQOA 3N2GA 2OZBA 1FSZA 2YYEA 4X20A 4O2BB 1XBIA 5EB0A 4O4HA 3CCJF 1UI9A 3TD3A 3LWOC 5AVMA 5GANK 1NQ3A 2OTLF 3KHNA 2CZWA 3E22B 4IIJB 5MN5A 3VYTC 1VQ8F 1VQ4F 3V7QA 4G4VA 4E6EA 2N48A 1E7KA 1Q8RA 4ZOLB 2R6R1 4LCKA 3E20B 3SIVA 5LYJB 4O2BA 3I3FA 2HP0B 4G4WA 3MBMA 2NMUA 2Q1YA 3IMPA 3E22A 5HY1A 2GLZA 3VMFB 1GZ0A 1YQNA 2UYNB 1CK2A 2Z1FA 2KGWA 2VXYA 2OHWA 5MN4A 1DT9A 2CVLA 4X3MA 1Z5VA 5LOVB 3CCUF 2HS3A 5LYJA 2HP0A 4U3JA 4I50A 5EIBD 5LP6B 3Q8HA 1Z5WA 3P4EA 3LWRC 1JFFB 3IKFA 3U0OA 5CA0B 4X3LA 2VAMA 3S06A 4DXDA 3CCRF 3PLAC 2KG4A 1JY8A 3SIUA 3RA5A 1UFYA 3WJQA 3HJWC 3KJJA 2IQQA 3CCLF 3F0EA 4G4YA 3UT5B 3KIZA 5LOVA 1RA4A 2WALA 3OONA 5HP8A 5CB4B 1Q86H 4C4WC 1U3LA 3LFOA 1QVGF 3CPQA 5JVDB 4BT4A 1Q81H 4F6RA 5LP6A 2QTPA 4WBNB 3ON1A 3P10A 4TUYA 5HY4A 1YIJF 1JFFA 2IG8A 5CA0A 3RYIA 4ZHYB 4BT2A 5JQGA 4TV8B 2OTJF 3HKCA 1VQOF 1OAPA 2AIZP 4HNAB 4B46A 3PAFA 4C8IA 4TZZA 3NVIB 2H6LA 1SA0B 3V4DA 3C8LA 2VGNA 3CCSF 5CA1B 4O4JB 4DRXB 3UT5A 5IJ0B 2DYYA 3F6MA 4G4XA 2B33A 4C81A 4ZI7B 2L26A 4RHAA 4B62A 3I7TA 4X1IA 3MQWA 4WBNA 1YJWF 3D00A 4C8EA 3G71F 2K1SA 3WJRA 2HS0A 2RB9A 4HNAA 4EB6A 1VQ5F 3CCQF 1SA0A 2ZOVA 3JAKA 2ZVYA 3QUWA 5CA1A 4O4JA 3GYQA 3LWPC 4DRXA 3RYCA 3J80M 1QU9A 2Q1XA 3WGKA 2ZVZA 2G9IA 4B5CA 4O2AB 3M1XA 3R0PA 2IAFA 3HKBA 3HKDA 3JVHA 2UZHA 3C9UA 3J81M 3S02A 3EORA 2KTUA 3IKEA 3CG6A 3CC4F 5EB1B 4X1YA 4NQ3A 2ZAUA 4YJ3A 5FLXM 1CN7A 4NUTA 5IYZA 5EZYA 5A2QM 2UYPA 3NVKE 3G4SF 1IV3A 2Z1UA 1OFUA 3ZP7A 2HRUA 3C9SA 2ALEA 4O2AA 5C8YB 1XHOA 2DT4A 3VI6A 1GX1A 2YXZA 1X7OA 3VIUA 3M84A 1CLIA 3K12A 3WGNA 4BT3A 3F0GA 1JJ2F 4X1KA 1PXWA 4O4LA 5FJ4C 4BT5A 3VYSC 1W581 5DCVA 3K14A 1VQ9F 3QHDA 5JH7B 3IR9A 1M1KH 4BVQA 4IIJA 2FGYA 3P0ZA 3TD4A 1Q7YH 3VO8A 2R751 5C8YA 3CXCF 2ZODA 3B6NA 1JD1A 1IV1A 2CWJA 3WGJA 3IEQA 4ZOLA 1TVKB 1KNKA 5IJ9B 4ERHA 2F9ZC 4BT6A 1W3EX 1FNKA 1YGYA 3CYQA 1XV2A 5HWEA 3LDTA 3VOBA 1QAHA 3JARB 3T80A 3CCEF 3CD6F 1X7PA 2HX0A 4BY9D 2UYNA 2QEXF 3NK7A 1VQVA 2LBTA 2I6RA 1W41A 5IT9M 3RYHB 1RQ2A 1GO0A 2KTVA 5IJ9A 1K9MH 5GINC 4BVTA 1Q82H 1K73H 5J2TB 5EO3A 4TV9B 3HTNA 1IPAA 4BVRA 3CC7F 3HAXD 2EWCA 1K8AH 1YJNF 3VYUC 3ZO8A 3D01A 3L7QA 2BTQB 3G6EF 1YJ9F 5MN6A 1XRGA 2LCAA 3V3TA 1FFXB 1X25A 3KJKA 3RE3A 4BT7A 4FFBB 3O85A 5CB4A 3LWQC 5J2TA 1TUBB 4TV9A 5JVDA 3C9TA 3DC2A 3QTYA 5HXZA 1ZWZA 2LBXA 5GAPK 3WPXA 2QI2A 4ZK7A 1VQPF 1W59A 3JATB 3S0WA 4TV8A 3J7AR 1W2BF 3TD5A 2VAWA 1COMA 1FFXA 1H7MA 1NMUB 1VHAA 1W55A 5JCOC 5IJ0A 3LMEA 5ITZB 3CC2F 1TUBA 4ZI7A 1NJIH 5LA6B 3CMEF 2QA4F 3WGLA 3LWVC 2UYKA 4ZHQB 2RHOA 3WXMB 1RQ7A 2HS4A 4XCQA 2GZLA 2RHJA 3JATA 3F0DA 3CB2A 4G88A 1W57A 3N2GB 4KWEA 5HP7A 1W5AA 4X20B 4EI8A 1IV4A 4O4HB 3I55F 2HRYA 1VQLF 3RA6A 5B8FA 5HXUA 4ZHWA 4PWTA 3CCMF 5ITZA 4NWOB 3JCMM 2Z1TA 1T0AA 5LA6A 2CHSA 5J2UB 1YITF 4EI7A 5KX5B 1GO1A 3MCQA 1J7HA 1U43A 1QD9A 1W40A 4YJ2B 1SDSA 3K0TA 3ERNA 5BMVB 2FC3A 4B45A 1VQ7F 1S72F 2JNBA 3JAWB 3FD5A 2RHHA 3FBAA 2CHTA 3OBWA 5J2UA 4ZHVA 5KX5A 4I4TB 3MDOA
chains in the Genus database with same CATH topology
1U3LA 3EORA 3ESJA 3F0GA 3IKEA 1KNKA 1U43A 2AMTA 2PMPA 3P10A 4C8EA 2GZLA 3K2XA 3F0DA 1KNJA 3Q8HA 1IV2A 1H48A 1W57A 3K14A 3MBMA 4C8GA 3QHDA 3FPIA 1H47A 3ERNA 3T80A 3IKFA 3ELCA 1JN1A 1IV4A 1IV3A 3F0FA 4C82A 1U40A 3P0ZA 1U3PA 1VHAA 1YQNA 4C8IA 1W55A 5B8FA 1JY8A 3GHZA 3B6NA 3KE1A 3FBAA 1IV1A 1GX1A 3RE3A 1VH8A 1T0AA 3F6MA 3F0EA 4C81A 3IEWA 3JVHA 2UZHA 3IEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  3EOR A;  3ESJ A;  3F0G A;  3IKE A;  1KNK A;  1U43 A;  2AMT A;  2PMP A;  3P10 A;  4C8E A;  2GZL A;  3K2X A;  3F0D A;  1KNJ A;  3Q8H A;  1IV2 A;  1H48 A;  1W57 A;  3K14 A;  3MBM A;  4C8G A;  3QHD A;  3FPI A;  1H47 A;  3ERN A;  3T80 A;  3IKF A;  3ELC A;  1JN1 A;  1IV4 A;  1IV3 A;  3F0F A;  4C82 A;  1U40 A;  3P0Z A;  1U3P A;  1VHA A;  1YQN A;  4C8I A;  1W55 A;  5B8F A;  1JY8 A;  3GHZ A;  3B6N A;  3KE1 A;  3FBA A;  1IV1 A;  1GX1 A;  3RE3 A;  1VH8 A;  1T0A A;  3F6M A;  3F0E A;  4C81 A;  3IEW A;  3JVH A;  2UZH A;  3IEQ A; 
#chains in the Genus database with same CATH topology
 1QVF F;  1W42 A;  2VAP A;  2Z01 A;  3D54 A;  3I56 F;  1N8R H;  3CPW F;  2CSL A;  3GTZ A;  2AIF A;  4YJ2 A;  2PMP A;  3C9R A;  5GIP C;  1W5B A;  4I50 B;  4U3J B;  3WPW A;  5BMV A;  1H48 A;  5JH7 A;  2BTO A;  5HY2 A;  3ELC A;  1JN1 A;  2H8C A;  1DBF A;  1VQK F;  4C82 A;  3NMU C;  2GVI A;  3JAL B;  4BVS A;  3JAW A;  2W8B C;  3M4S A;  3KE1 A;  5EYP B;  1RLG A;  3JAS B;  3OW2 F;  2P6Y A;  1VH8 A;  4I4T A;  1VQM F;  3N2K B;  3JAM M;  1TVK A;  2I6D A;  5GON B;  4LNU B;  2HVY D;  3ZOP A;  4F6R B;  1FNJ A;  3VOA A;  4O4I B;  1KNJ A;  4TUY B;  1RLU A;  5FNV B;  1YHQ F;  1KC8 H;  2OTM A;  3JAR A;  3N4Y A;  3WJP A;  3FPI A;  2VGM A;  3RYI B;  5JQG B;  4G4Z A;  3JAL A;  4IHJ B;  3HKC B;  2CW4 A;  3V7E A;  5EYP A;  3JAS A;  4R40 B;  2Z1E A;  3RYH A;  5GIO C;  4I55 B;  3HKE B;  1ODE A;  3N2K A;  5G4U C;  1VK3 A;  3NK6 A;  5GON A;  1W5F A;  2UYJ A;  4LNU A;  5EAZ A;  3S0H A;  4X1I B;  1T0K B;  3CYP B;  4O4I A;  5HY0 A;  5FNV A;  1R1M A;  3LYB A;  5JCO A;  3N4Z A;  1IV2 A;  4C8G A;  3VTI C;  1M90 H;  1H47 A;  4IHJ A;  5G4V C;  4EB6 B;  1KQS F;  1VQ6 F;  2V9Y A;  3BYQ A;  1U3P A;  5LP6 C;  5LXT B;  3JAK B;  3DDN A;  5EIB C;  3RYF B;  4I55 A;  1PF5 A;  3HKE A;  5KMG B;  1KD1 H;  3FFM A;  3RYC B;  3CMA F;  3ZP4 A;  3WGM A;  2LBW A;  4FFB A;  2MQE A;  3S0Y A;  1SZQ A;  2BO1 A;  3IEW A;  2HP3 A;  3HKD B;  3HKB B;  3ESJ A;  2ZF8 A;  4U39 A;  4X1Y B;  2BTU A;  3AGK A;  3CCV F;  4YJ3 B;  5IYZ B;  3OBY A;  5EZY B;  5LXT A;  1VQN F;  3F0F A;  1U40 A;  2RHL A;  3E1Y A;  3RYF A;  5KMG A;  1ONI A;  3GHZ A;  3HWU A;  3S03 A;  3MCA B;  2PHN A;  4BW0 B;  5EWR A;  1YI2 F;  4ZHQ A;  3VCZ A;  4EI9 A;  2H8E A;  3FD6 A;  1X52 A;  2AMT A;  4M8I A;  2HQS C;  4O4L B;  3K2X A;  4X1K B;  1W5E A;  4RQO A;  3N2G A;  2OZB A;  1FSZ A;  2YYE A;  4X20 A;  4O2B B;  1XBI A;  5EB0 A;  4O4H A;  3CCJ F;  1UI9 A;  3TD3 A;  3LWO C;  5AVM A;  5GAN K;  1NQ3 A;  2OTL F;  3KHN A;  2CZW A;  3E22 B;  4IIJ B;  5MN5 A;  3VYT C;  1VQ8 F;  1VQ4 F;  3V7Q A;  4G4V A;  4E6E A;  2N48 A;  1E7K A;  1Q8R A;  4ZOL B;  2R6R 1;  4LCK A;  3E20 B;  3SIV A;  5LYJ B;  4O2B A;  3I3F A;  2HP0 B;  4G4W A;  3MBM A;  2NMU A;  2Q1Y A;  3IMP A;  3E22 A;  5HY1 A;  2GLZ A;  3VMF B;  1GZ0 A;  1YQN A;  2UYN B;  1CK2 A;  2Z1F A;  2KGW A;  2VXY A;  2OHW A;  5MN4 A;  1DT9 A;  2CVL A;  4X3M A;  1Z5V A;  5LOV B;  3CCU F;  2HS3 A;  5LYJ A;  2HP0 A;  4U3J A;  4I50 A;  5EIB D;  5LP6 B;  3Q8H A;  1Z5W A;  3P4E A;  3LWR C;  1JFF B;  3IKF A;  3U0O A;  5CA0 B;  4X3L A;  2VAM A;  3S06 A;  4DXD A;  3CCR F;  3PLA C;  2KG4 A;  1JY8 A;  3SIU A;  3RA5 A;  1UFY A;  3WJQ A;  3HJW C;  3KJJ A;  2IQQ A;  3CCL F;  3F0E A;  4G4Y A;  3UT5 B;  3KIZ A;  5LOV A;  1RA4 A;  2WAL A;  3OON A;  5HP8 A;  5CB4 B;  1Q86 H;  4C4W C;  1U3L A;  3LFO A;  1QVG F;  3CPQ A;  5JVD B;  4BT4 A;  1Q81 H;  4F6R A;  5LP6 A;  2QTP A;  4WBN B;  3ON1 A;  3P10 A;  4TUY A;  5HY4 A;  1YIJ F;  1JFF A;  2IG8 A;  5CA0 A;  3RYI A;  4ZHY B;  4BT2 A;  5JQG A;  4TV8 B;  2OTJ F;  3HKC A;  1VQO F;  1OAP A;  2AIZ P;  4HNA B;  4B46 A;  3PAF A;  4C8I A;  4TZZ A;  3NVI B;  2H6L A;  1SA0 B;  3V4D A;  3C8L A;  2VGN A;  3CCS F;  5CA1 B;  4O4J B;  4DRX B;  3UT5 A;  5IJ0 B;  2DYY A;  3F6M A;  4G4X A;  2B33 A;  4C81 A;  4ZI7 B;  2L26 A;  4RHA A;  4B62 A;  3I7T A;  4X1I A;  3MQW A;  4WBN A;  1YJW F;  3D00 A;  4C8E A;  3G71 F;  2K1S A;  3WJR A;  2HS0 A;  2RB9 A;  4HNA A;  4EB6 A;  1VQ5 F;  3CCQ F;  1SA0 A;  2ZOV A;  3JAK A;  2ZVY A;  3QUW A;  5CA1 A;  4O4J A;  3GYQ A;  3LWP C;  4DRX A;  3RYC A;  3J80 M;  1QU9 A;  2Q1X A;  3WGK A;  2ZVZ A;  2G9I A;  4B5C A;  4O2A B;  3M1X A;  3R0P A;  2IAF A;  3HKB A;  3HKD A;  3JVH A;  2UZH A;  3C9U A;  3J81 M;  3S02 A;  3EOR A;  2KTU A;  3IKE A;  3CG6 A;  3CC4 F;  5EB1 B;  4X1Y A;  4NQ3 A;  2ZAU A;  4YJ3 A;  5FLX M;  1CN7 A;  4NUT A;  5IYZ A;  5EZY A;  5A2Q M;  2UYP A;  3NVK E;  3G4S F;  1IV3 A;  2Z1U A;  1OFU A;  3ZP7 A;  2HRU A;  3C9S A;  2ALE A;  4O2A A;  5C8Y B;  1XHO A;  2DT4 A;  3VI6 A;  1GX1 A;  2YXZ A;  1X7O A;  3VIU A;  3M84 A;  1CLI A;  3K12 A;  3WGN A;  4BT3 A;  3F0G A;  1JJ2 F;  4X1K A;  1PXW A;  4O4L A;  5FJ4 C;  4BT5 A;  3VYS C;  1W58 1;  5DCV A;  3K14 A;  1VQ9 F;  3QHD A;  5JH7 B;  3IR9 A;  1M1K H;  4BVQ A;  4IIJ A;  2FGY A;  3P0Z A;  3TD4 A;  1Q7Y H;  3VO8 A;  2R75 1;  5C8Y A;  3CXC F;  2ZOD A;  3B6N A;  1JD1 A;  1IV1 A;  2CWJ A;  3WGJ A;  3IEQ A;  4ZOL A;  1TVK B;  1KNK A;  5IJ9 B;  4ERH A;  2F9Z C;  4BT6 A;  1W3E X;  1FNK A;  1YGY A;  3CYQ A;  1XV2 A;  5HWE A;  3LDT A;  3VOB A;  1QAH A;  3JAR B;  3T80 A;  3CCE F;  3CD6 F;  1X7P A;  2HX0 A;  4BY9 D;  2UYN A;  2QEX F;  3NK7 A;  1VQV A;  2LBT A;  2I6R A;  1W41 A;  5IT9 M;  3RYH B;  1RQ2 A;  1GO0 A;  2KTV A;  5IJ9 A;  1K9M H;  5GIN C;  4BVT A;  1Q82 H;  1K73 H;  5J2T B;  5EO3 A;  4TV9 B;  3HTN A;  1IPA A;  4BVR A;  3CC7 F;  3HAX D;  2EWC A;  1K8A H;  1YJN F;  3VYU C;  3ZO8 A;  3D01 A;  3L7Q A;  2BTQ B;  3G6E F;  1YJ9 F;  5MN6 A;  1XRG A;  2LCA A;  3V3T A;  1FFX B;  1X25 A;  3KJK A;  3RE3 A;  4BT7 A;  4FFB B;  3O85 A;  5CB4 A;  3LWQ C;  5J2T A;  1TUB B;  4TV9 A;  5JVD A;  3C9T A;  3DC2 A;  3QTY A;  5HXZ A;  1ZWZ A;  2LBX A;  5GAP K;  3WPX A;  2QI2 A;  4ZK7 A;  1VQP F;  1W59 A;  3JAT B;  3S0W A;  4TV8 A;  3J7A R;  1W2B F;  3TD5 A;  2VAW A;  1COM A;  1FFX A;  1H7M A;  1NMU B;  1VHA A;  1W55 A;  5JCO C;  5IJ0 A;  3LME A;  5ITZ B;  3CC2 F;  1TUB A;  4ZI7 A;  1NJI H;  5LA6 B;  3CME F;  2QA4 F;  3WGL A;  3LWV C;  2UYK A;  4ZHQ B;  2RHO A;  3WXM B;  1RQ7 A;  2HS4 A;  4XCQ A;  2GZL A;  2RHJ A;  3JAT A;  3F0D A;  3CB2 A;  4G88 A;  1W57 A;  3N2G B;  4KWE A;  5HP7 A;  1W5A A;  4X20 B;  4EI8 A;  1IV4 A;  4O4H B;  3I55 F;  2HRY A;  1VQL F;  3RA6 A;  5B8F A;  5HXU A;  4ZHW A;  4PWT A;  3CCM F;  5ITZ A;  4NWO B;  3JCM M;  2Z1T A;  1T0A A;  5LA6 A;  2CHS A;  5J2U B;  1YIT F;  4EI7 A;  5KX5 B;  1GO1 A;  3MCQ A;  1J7H A;  1U43 A;  1QD9 A;  1W40 A;  4YJ2 B;  1SDS A;  3K0T A;  3ERN A;  5BMV B;  2FC3 A;  4B45 A;  1VQ7 F;  1S72 F;  2JNB A;  3JAW B;  3FD5 A;  2RHH A;  3FBA A;  2CHT A;  3OBW A;  5J2U A;  4ZHV A;  5KX5 A;  4I4T B;  3MDO A; 
#chains in the Genus database with same CATH homology
 1U3L A;  3EOR A;  3ESJ A;  3F0G A;  3IKE A;  1KNK A;  1U43 A;  2AMT A;  2PMP A;  3P10 A;  4C8E A;  2GZL A;  3K2X A;  3F0D A;  1KNJ A;  3Q8H A;  1IV2 A;  1H48 A;  1W57 A;  3K14 A;  3MBM A;  4C8G A;  3QHD A;  3FPI A;  1H47 A;  3ERN A;  3T80 A;  3IKF A;  3ELC A;  1JN1 A;  1IV4 A;  1IV3 A;  3F0F A;  4C82 A;  1U40 A;  3P0Z A;  1U3P A;  1VHA A;  1YQN A;  4C8I A;  1W55 A;  5B8F A;  1JY8 A;  3GHZ A;  3B6N A;  3KE1 A;  3FBA A;  1IV1 A;  1GX1 A;  3RE3 A;  1VH8 A;  1T0A A;  3F6M A;  3F0E A;  4C81 A;  3IEW A;  3JVH A;  2UZH A;  3IEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...