3ESJA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MLEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 50
structure length 162
sequence length 162
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3esjA00
1H48A 3F0EA 3KE1A 2GZLA 1GX1A 3ELCA 1VH8A 3ESJA 3ERNA 3IKEA 4C82A 3FBAA 4C8EA 4C8IA 1T0AA 3RE3A 1IV3A 3F0FA 1IV1A 1U43A 3EORA 3T80A 3JVHA 4C8GA 1KNJA 3F6MA 3P0ZA 1IV4A 1VHAA 3IEWA 1KNKA 1U3PA 5B8FA 3IKFA 2AMTA 3GHZA 1W55A 3IEQA 3QHDA 3MBMA 1IV2A 2UZHA 3P10A 1W57A 1JN1A 3K2XA 1JY8A 1H47A 3F0GA 3F0DA 3FPIA 1U3LA 3K14A 4C81A 1U40A 2PMPA 3Q8HA 3B6NA 1YQNA
chains in the Genus database with same CATH superfamily
3TD4A 3JASA 3FFMA 3V3TA 4EB6B 5FNVA 1Z5VA 2LBWA 3N4YA 4WBNA 5BMVA 2Q1XA 5J2TA 2F9ZC 5MN6A 1COMA 1VQLF 4HNAB 5CB4B 4X1KB 1FFXB 5CA0B 3S03A 3CYQA 3WGKA 3CCLF 4BT2A 3JATB 3J7AR 3N2GB 2Z01A 4ZHYB 1VQ6F 1NMUB 2W8BC 3V7QA 3N2KA 3RYIB 5GIPC 1JJ2F 3S0HA 3WGJA 3UT5B 3QTYA 5EIBC 5J2UB 2CHSA 4B62A 3EORA 1VQ5F 3HKCB 5IYZB 3CCEF 4I50B 1W59A 4U3JA 3VYTC 2BTUA 4X3LA 4BT3A 3OONA 4G4VA 4X20B 2RHLA 3V7EA 1KD1H 4NQ3A 1VK3A 4G4YA 1VQKF 1H48A 1PF5A 5IJ9A 3S0YA 3MCQA 4LNUA 3CCSF 1W40A 3JASB 2OTJF 4DRXA 1IV3A 1W581 4IHJA 3E20B 5FNVB 3LYBA 3CCMF 3M1XA 1TVKA 3G4SF 1FNJA 2K1SA 4BVRA 5JQGA 2ZVYA 5J2TB 2RB9A 3WPXA 2N48A 4B46A 3ZOPA 4EI9A 3LFOA 2UYKA 1RA4A 2KG4A 5EAZA 4G4XA 5EO3A 3DC2A 1QVFF 3N4ZA 1M1KH 3KE1A 3G71F 1RQ2A 3N2KB 3NVIB 4TUYA 4NUTA 5IJ0A 2Z1UA 4KWEA 1SDSA 3CD6F 1IV4A 4U3JB 4I55A 4YJ2A 2Q1YA 3RA6A 3RYCA 3D00A 5ITZA 3O85A 4C81A 3K14A 1QU9A 3D01A 2IAFA 3ERNA 5IJ9B 3HTNA 4LNUB 3J81M 5LA6A 1W42A 5HP7A 2DYYA 3D54A 4DRXB 4IHJB 3RYHA 2ZF8A 3JVHA 5HWEA 1RQ7A 3F6MA 2HP0A 1TVKB 4EI8A 2RHOA 3ZO8A 5JQGB 3MBMA 1YI2F 1JD1A 2BTQB 2LCAA 4O4IA 5FJ4C 2BO1A 2CZWA 3HKBA 2OTLF 3RA5A 1YJ9F 2YYEA 3M84A 1ODEA 2QTPA 4ZI7A 3LWPC 2JNBA 2Z1TA 5IT9M 4XCQA 3LWVC 3M4SA 1IPAA 3VTIC 4YJ3B 4BY9D 2ZVZA 4TUYB 1K73H 1CK2A 3K12A 4BT4A 1W5FA 2HX0A 5IJ0B 4EI7A 1J7HA 3RYFA 4G4WA 3IEQA 3QHDA 3P10A 3VYSC 3HAXD 4YJ2B 2ZODA 1QD9A 3RYCB 1OAPA 3F0DA 3CMEF 5EYPA 5ITZB 3F0GA 1SA0A 1W3EX 1OFUA 4O2BB 3CCJF 1K8AH 3RE3A 1RLGA 2HRUA 2YXZA 1K9MH 3C9SA 3HJWC 5LA6B 3RYHB 3NK6A 4RHAA 1KNKA 2HP0B 3KHNA 1SZQA 2ALEA 5KX5A 1JN1A 2P6YA 3HWUA 4BVSA 3J80M 2OTMA 4O4IB 1R1MA 1JY8A 4G4ZA 1GO0A 5HY2A 3HKBB 3CC2F 5CA1A 3WXMB 5HP8A 4O4HA 1XRGA 3JARA 4TV9A 5EB1B 3S0WA 4ZHVA 1VH8A 3C9UA 4ZI7B 5GAPK 2HQSC 4X1YA 3CCRF 1W41A 5LOVA 3V4DA 1U43A 3CC4F 3GYQA 4WBNB 1Q82H 3P0ZA 5BMVB 4FFBA 5HXZA 5B8FA 2G9IA 3I56F 2Z1EA 3RYFB 5GINC 1VQOF 3KIZA 3MCAB 4TZZA 3E1YA 2CVLA 3K2XA 1S72F 3HKDA 1VQMF 1UI9A 2VAMA 3I7TA 1YQNA 5EYPB 4F6RA 3I3FA 1GO1A 2PHNA 3WGLA 1VQPF 2HVYD 1Z5WA 1M90H 4X1IA 3LMEA 4B5CA 2VAPA 4U39A 3PAFA 3C8LA 2QA4F 1QVGF 4X3MA 3ZP7A 3IR9A 2AMTA 4BW0B 1W55A 2AIZP 2H8CA 2L26A 3S02A 1KQSF 5LP6C 1FSZA 2I6RA 3VMFB 5KX5B 5LP6A 3CMAF 1VQ4F 5CA1B 2HS4A 1YJWF 1DT9A 2KTUA 3IKEA 4O4HB 3U0OA 5LXTA 3JARB 4TV9B 3CCVF 5G4UC 2KGWA 1VQNF 1W5BA 3F0FA 4X1YB 1YJNF 1H7MA 1N8RH 5LOVB 3FD6A 2CSLA 4NWOB 1VHAA 3KJKA 5LYJA 1CLIA 2OHWA 5CA0A 3OBYA 4FFBB 1DBFA 2VAWA 1T0KB 3GTZA 1XBIA 3E22A 3WJQA 2VGNA 2PMPA 3HKDB 5EZYA 4ZK7A 3F0EA 4F6RB 3LWOC 1GX1A 3ELCA 4C82A 2ZAUA 1QAHA 3JAMM 3MDOA 1T0AA 3NVKE 2QEXF 3JAKA 1X25A 1JFFA 2UYNA 2RHJA 1FNKA 3TD3A 2UZHA 4O4JA 1W5AA 4I55B 2UYPA 3VYUC 2FC3A 1NJIH 1W57A 5JCOC 5JCOA 3FPIA 1U3LA 3FD5A 5LP6B 2UYJA 3VO8A 3CG6A 3CYPB 2LBTA 5GONA 4C4WC 4C8IA 5HY4A 5LXTB 3LWQC 4ZOLA 3OW2F 3T80A 4C8GA 3AGKA 4M8IA 3BYQA 2HS3A 3KJJA 1VQ8F 2DT4A 3VIUA 2IG8A 5LYJB 3HKEA 1GZ0A 5MN5A 2CHTA 3E22B 4PWTA 3B6NA 5AVMA 2CWJA 2FGYA 2B33A 3CPWF 2OZBA 3K0TA 3SIUA 5EZYB 2EWCA 1Q81H 3OBWA 2HRYA 2R6R1 2IQQA 1W5EA 4IIJA 4ERHA 3JAKB 1JFFB 3L7QA 5JVDA 3P4EA 1X7OA 1XHOA 1VQVA 1YITF 1IV2A 2UYNB 4ZHWA 2RHHA 3PLAC 2VGMA 3CB2A 5C8YA 1XV2A 4O4JB 3WJPA 3I55F 1PXWA 3WGNA 3R0PA 3SIVA 1U40A 2BTOA 2H8EA 3TD5A 1X52A 2HP3A 3JALA 4O4LA 1ZWZA 3DDNA 1TUBA 2GVIA 1SA0B 4ZHQA 3ON1A 5GIOC 3VOBA 3WPWA 4TV8A 2ZOVA 5GONB 2GLZA 3ZP4A 5KMGA 3VI6A 1Q7YH 3CXCF 4ZOLB 4I4TA 1ONIA 2HS0A 4R40B 1U3PA 2AIFA 2LBXA 3IKFA 3MQWA 3NK7A 4BT6A 4E6EA 2H6LA 1YGYA 3CC7F 4RQOA 3LWRC 1YHQF 3VCZA 3JAWA 4O2AA 3JCMM 3HKEB 1H47A 3C9TA 5A2QM 5JH7A 1VQ7F 1UFYA 4DXDA 5EIBD 4EB6A 2KTVA 3LDTA 5HY0A 3ESJA 4YJ3A 4C8EA 4G88A 1NQ3A 1Q86H 1W2BF 1IV1A 2Z1FA 2CW4A 5HY1A 4IIJB 1KNJA 3S06A 1X7PA 5G4VC 3IEWA 2VXYA 5GANK 3GHZA 4HNAA 5JVDB 4X1KA 1FFXA 2R751 5CB4A 3NMUC 1VQ9F 3WGMA 3JATA 3CCUF 3N2GA 5C8YB 4O2BA 1RLUA 3Q8HA 5EWRA 3WJRA 2I6DA 3RYIA 3CPQA 4BT7A 2GZLA 3UT5A 4O4LB 3JALB 5J2UA 1TUBB 4BVQA 4ZHQB 5DCVA 3HKCA 5HXUA 3IMPA 4TV8B 5IYZA 1YIJF 4I50A 4X1IB 5KMGB 1E7KA 3VOAA 4B45A 1Q8RA 4I4TB 3G6EF 2QI2A 2MQEA 1CN7A 1KC8H 2WALA 3CCQF 4BVTA 3QUWA 4X20A 2V9YA 5FLXM 2NMUA 3C9RA 4LCKA 5MN4A 5EB0A 3JAWB 4O2AB 3FBAA 5JH7B 4BT5A
chains in the Genus database with same CATH topology
1H48A 3F0EA 3KE1A 2GZLA 1GX1A 3ELCA 1VH8A 3ESJA 3ERNA 3IKEA 4C82A 3FBAA 4C8EA 4C8IA 1T0AA 3RE3A 1IV3A 3F0FA 1IV1A 1U43A 3EORA 3T80A 3JVHA 4C8GA 1KNJA 3F6MA 3P0ZA 1IV4A 1VHAA 3IEWA 1KNKA 1U3PA 5B8FA 3IKFA 2AMTA 3GHZA 1W55A 3IEQA 3QHDA 3MBMA 1IV2A 2UZHA 3P10A 1W57A 1JN1A 3K2XA 1JY8A 1H47A 3F0GA 3F0DA 3FPIA 1U3LA 3K14A 4C81A 1U40A 2PMPA 3Q8HA 3B6NA 1YQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H48 A;  3F0E A;  3KE1 A;  2GZL A;  1GX1 A;  3ELC A;  1VH8 A;  3ESJ A;  3ERN A;  3IKE A;  4C82 A;  3FBA A;  4C8E A;  4C8I A;  1T0A A;  3RE3 A;  1IV3 A;  3F0F A;  1IV1 A;  1U43 A;  3EOR A;  3T80 A;  3JVH A;  4C8G A;  1KNJ A;  3F6M A;  3P0Z A;  1IV4 A;  1VHA A;  3IEW A;  1KNK A;  1U3P A;  5B8F A;  3IKF A;  2AMT A;  3GHZ A;  1W55 A;  3IEQ A;  3QHD A;  3MBM A;  1IV2 A;  2UZH A;  3P10 A;  1W57 A;  1JN1 A;  3K2X A;  1JY8 A;  1H47 A;  3F0G A;  3F0D A;  3FPI A;  1U3L A;  3K14 A;  4C81 A;  1U40 A;  2PMP A;  3Q8H A;  3B6N A;  1YQN A; 
#chains in the Genus database with same CATH topology
 3TD4 A;  3JAS A;  3FFM A;  3V3T A;  4EB6 B;  5FNV A;  1Z5V A;  2LBW A;  3N4Y A;  4WBN A;  5BMV A;  2Q1X A;  5J2T A;  2F9Z C;  5MN6 A;  1COM A;  1VQL F;  4HNA B;  5CB4 B;  4X1K B;  1FFX B;  5CA0 B;  3S03 A;  3CYQ A;  3WGK A;  3CCL F;  4BT2 A;  3JAT B;  3J7A R;  3N2G B;  2Z01 A;  4ZHY B;  1VQ6 F;  1NMU B;  2W8B C;  3V7Q A;  3N2K A;  3RYI B;  5GIP C;  1JJ2 F;  3S0H A;  3WGJ A;  3UT5 B;  3QTY A;  5EIB C;  5J2U B;  2CHS A;  4B62 A;  3EOR A;  1VQ5 F;  3HKC B;  5IYZ B;  3CCE F;  4I50 B;  1W59 A;  4U3J A;  3VYT C;  2BTU A;  4X3L A;  4BT3 A;  3OON A;  4G4V A;  4X20 B;  2RHL A;  3V7E A;  1KD1 H;  4NQ3 A;  1VK3 A;  4G4Y A;  1VQK F;  1H48 A;  1PF5 A;  5IJ9 A;  3S0Y A;  3MCQ A;  4LNU A;  3CCS F;  1W40 A;  3JAS B;  2OTJ F;  4DRX A;  1IV3 A;  1W58 1;  4IHJ A;  3E20 B;  5FNV B;  3LYB A;  3CCM F;  3M1X A;  1TVK A;  3G4S F;  1FNJ A;  2K1S A;  4BVR A;  5JQG A;  2ZVY A;  5J2T B;  2RB9 A;  3WPX A;  2N48 A;  4B46 A;  3ZOP A;  4EI9 A;  3LFO A;  2UYK A;  1RA4 A;  2KG4 A;  5EAZ A;  4G4X A;  5EO3 A;  3DC2 A;  1QVF F;  3N4Z A;  1M1K H;  3KE1 A;  3G71 F;  1RQ2 A;  3N2K B;  3NVI B;  4TUY A;  4NUT A;  5IJ0 A;  2Z1U A;  4KWE A;  1SDS A;  3CD6 F;  1IV4 A;  4U3J B;  4I55 A;  4YJ2 A;  2Q1Y A;  3RA6 A;  3RYC A;  3D00 A;  5ITZ A;  3O85 A;  4C81 A;  3K14 A;  1QU9 A;  3D01 A;  2IAF A;  3ERN A;  5IJ9 B;  3HTN A;  4LNU B;  3J81 M;  5LA6 A;  1W42 A;  5HP7 A;  2DYY A;  3D54 A;  4DRX B;  4IHJ B;  3RYH A;  2ZF8 A;  3JVH A;  5HWE A;  1RQ7 A;  3F6M A;  2HP0 A;  1TVK B;  4EI8 A;  2RHO A;  3ZO8 A;  5JQG B;  3MBM A;  1YI2 F;  1JD1 A;  2BTQ B;  2LCA A;  4O4I A;  5FJ4 C;  2BO1 A;  2CZW A;  3HKB A;  2OTL F;  3RA5 A;  1YJ9 F;  2YYE A;  3M84 A;  1ODE A;  2QTP A;  4ZI7 A;  3LWP C;  2JNB A;  2Z1T A;  5IT9 M;  4XCQ A;  3LWV C;  3M4S A;  1IPA A;  3VTI C;  4YJ3 B;  4BY9 D;  2ZVZ A;  4TUY B;  1K73 H;  1CK2 A;  3K12 A;  4BT4 A;  1W5F A;  2HX0 A;  5IJ0 B;  4EI7 A;  1J7H A;  3RYF A;  4G4W A;  3IEQ A;  3QHD A;  3P10 A;  3VYS C;  3HAX D;  4YJ2 B;  2ZOD A;  1QD9 A;  3RYC B;  1OAP A;  3F0D A;  3CME F;  5EYP A;  5ITZ B;  3F0G A;  1SA0 A;  1W3E X;  1OFU A;  4O2B B;  3CCJ F;  1K8A H;  3RE3 A;  1RLG A;  2HRU A;  2YXZ A;  1K9M H;  3C9S A;  3HJW C;  5LA6 B;  3RYH B;  3NK6 A;  4RHA A;  1KNK A;  2HP0 B;  3KHN A;  1SZQ A;  2ALE A;  5KX5 A;  1JN1 A;  2P6Y A;  3HWU A;  4BVS A;  3J80 M;  2OTM A;  4O4I B;  1R1M A;  1JY8 A;  4G4Z A;  1GO0 A;  5HY2 A;  3HKB B;  3CC2 F;  5CA1 A;  3WXM B;  5HP8 A;  4O4H A;  1XRG A;  3JAR A;  4TV9 A;  5EB1 B;  3S0W A;  4ZHV A;  1VH8 A;  3C9U A;  4ZI7 B;  5GAP K;  2HQS C;  4X1Y A;  3CCR F;  1W41 A;  5LOV A;  3V4D A;  1U43 A;  3CC4 F;  3GYQ A;  4WBN B;  1Q82 H;  3P0Z A;  5BMV B;  4FFB A;  5HXZ A;  5B8F A;  2G9I A;  3I56 F;  2Z1E A;  3RYF B;  5GIN C;  1VQO F;  3KIZ A;  3MCA B;  4TZZ A;  3E1Y A;  2CVL A;  3K2X A;  1S72 F;  3HKD A;  1VQM F;  1UI9 A;  2VAM A;  3I7T A;  1YQN A;  5EYP B;  4F6R A;  3I3F A;  1GO1 A;  2PHN A;  3WGL A;  1VQP F;  2HVY D;  1Z5W A;  1M90 H;  4X1I A;  3LME A;  4B5C A;  2VAP A;  4U39 A;  3PAF A;  3C8L A;  2QA4 F;  1QVG F;  4X3M A;  3ZP7 A;  3IR9 A;  2AMT A;  4BW0 B;  1W55 A;  2AIZ P;  2H8C A;  2L26 A;  3S02 A;  1KQS F;  5LP6 C;  1FSZ A;  2I6R A;  3VMF B;  5KX5 B;  5LP6 A;  3CMA F;  1VQ4 F;  5CA1 B;  2HS4 A;  1YJW F;  1DT9 A;  2KTU A;  3IKE A;  4O4H B;  3U0O A;  5LXT A;  3JAR B;  4TV9 B;  3CCV F;  5G4U C;  2KGW A;  1VQN F;  1W5B A;  3F0F A;  4X1Y B;  1YJN F;  1H7M A;  1N8R H;  5LOV B;  3FD6 A;  2CSL A;  4NWO B;  1VHA A;  3KJK A;  5LYJ A;  1CLI A;  2OHW A;  5CA0 A;  3OBY A;  4FFB B;  1DBF A;  2VAW A;  1T0K B;  3GTZ A;  1XBI A;  3E22 A;  3WJQ A;  2VGN A;  2PMP A;  3HKD B;  5EZY A;  4ZK7 A;  3F0E A;  4F6R B;  3LWO C;  1GX1 A;  3ELC A;  4C82 A;  2ZAU A;  1QAH A;  3JAM M;  3MDO A;  1T0A A;  3NVK E;  2QEX F;  3JAK A;  1X25 A;  1JFF A;  2UYN A;  2RHJ A;  1FNK A;  3TD3 A;  2UZH A;  4O4J A;  1W5A A;  4I55 B;  2UYP A;  3VYU C;  2FC3 A;  1NJI H;  1W57 A;  5JCO C;  5JCO A;  3FPI A;  1U3L A;  3FD5 A;  5LP6 B;  2UYJ A;  3VO8 A;  3CG6 A;  3CYP B;  2LBT A;  5GON A;  4C4W C;  4C8I A;  5HY4 A;  5LXT B;  3LWQ C;  4ZOL A;  3OW2 F;  3T80 A;  4C8G A;  3AGK A;  4M8I A;  3BYQ A;  2HS3 A;  3KJJ A;  1VQ8 F;  2DT4 A;  3VIU A;  2IG8 A;  5LYJ B;  3HKE A;  1GZ0 A;  5MN5 A;  2CHT A;  3E22 B;  4PWT A;  3B6N A;  5AVM A;  2CWJ A;  2FGY A;  2B33 A;  3CPW F;  2OZB A;  3K0T A;  3SIU A;  5EZY B;  2EWC A;  1Q81 H;  3OBW A;  2HRY A;  2R6R 1;  2IQQ A;  1W5E A;  4IIJ A;  4ERH A;  3JAK B;  1JFF B;  3L7Q A;  5JVD A;  3P4E A;  1X7O A;  1XHO A;  1VQV A;  1YIT F;  1IV2 A;  2UYN B;  4ZHW A;  2RHH A;  3PLA C;  2VGM A;  3CB2 A;  5C8Y A;  1XV2 A;  4O4J B;  3WJP A;  3I55 F;  1PXW A;  3WGN A;  3R0P A;  3SIV A;  1U40 A;  2BTO A;  2H8E A;  3TD5 A;  1X52 A;  2HP3 A;  3JAL A;  4O4L A;  1ZWZ A;  3DDN A;  1TUB A;  2GVI A;  1SA0 B;  4ZHQ A;  3ON1 A;  5GIO C;  3VOB A;  3WPW A;  4TV8 A;  2ZOV A;  5GON B;  2GLZ A;  3ZP4 A;  5KMG A;  3VI6 A;  1Q7Y H;  3CXC F;  4ZOL B;  4I4T A;  1ONI A;  2HS0 A;  4R40 B;  1U3P A;  2AIF A;  2LBX A;  3IKF A;  3MQW A;  3NK7 A;  4BT6 A;  4E6E A;  2H6L A;  1YGY A;  3CC7 F;  4RQO A;  3LWR C;  1YHQ F;  3VCZ A;  3JAW A;  4O2A A;  3JCM M;  3HKE B;  1H47 A;  3C9T A;  5A2Q M;  5JH7 A;  1VQ7 F;  1UFY A;  4DXD A;  5EIB D;  4EB6 A;  2KTV A;  3LDT A;  5HY0 A;  3ESJ A;  4YJ3 A;  4C8E A;  4G88 A;  1NQ3 A;  1Q86 H;  1W2B F;  1IV1 A;  2Z1F A;  2CW4 A;  5HY1 A;  4IIJ B;  1KNJ A;  3S06 A;  1X7P A;  5G4V C;  3IEW A;  2VXY A;  5GAN K;  3GHZ A;  4HNA A;  5JVD B;  4X1K A;  1FFX A;  2R75 1;  5CB4 A;  3NMU C;  1VQ9 F;  3WGM A;  3JAT A;  3CCU F;  3N2G A;  5C8Y B;  4O2B A;  1RLU A;  3Q8H A;  5EWR A;  3WJR A;  2I6D A;  3RYI A;  3CPQ A;  4BT7 A;  2GZL A;  3UT5 A;  4O4L B;  3JAL B;  5J2U A;  1TUB B;  4BVQ A;  4ZHQ B;  5DCV A;  3HKC A;  5HXU A;  3IMP A;  4TV8 B;  5IYZ A;  1YIJ F;  4I50 A;  4X1I B;  5KMG B;  1E7K A;  3VOA A;  4B45 A;  1Q8R A;  4I4T B;  3G6E F;  2QI2 A;  2MQE A;  1CN7 A;  1KC8 H;  2WAL A;  3CCQ F;  4BVT A;  3QUW A;  4X20 A;  2V9Y A;  5FLX M;  2NMU A;  3C9R A;  4LCK A;  5MN4 A;  5EB0 A;  3JAW B;  4O2A B;  3FBA A;  5JH7 B;  4BT5 A; 
#chains in the Genus database with same CATH homology
 1H48 A;  3F0E A;  3KE1 A;  2GZL A;  1GX1 A;  3ELC A;  1VH8 A;  3ESJ A;  3ERN A;  3IKE A;  4C82 A;  3FBA A;  4C8E A;  4C8I A;  1T0A A;  3RE3 A;  1IV3 A;  3F0F A;  1IV1 A;  1U43 A;  3EOR A;  3T80 A;  3JVH A;  4C8G A;  1KNJ A;  3F6M A;  3P0Z A;  1IV4 A;  1VHA A;  3IEW A;  1KNK A;  1U3P A;  5B8F A;  3IKF A;  2AMT A;  3GHZ A;  1W55 A;  3IEQ A;  3QHD A;  3MBM A;  1IV2 A;  2UZH A;  3P10 A;  1W57 A;  1JN1 A;  3K2X A;  1JY8 A;  1H47 A;  3F0G A;  3F0D A;  3FPI A;  1U3L A;  3K14 A;  4C81 A;  1U40 A;  2PMP A;  3Q8H A;  3B6N A;  1YQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...