3ESJA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MLEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 50
structure length 162
sequence length 162
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3esjA00
3EORA 3JVHA 5B8FA 2AMTA 1H47A 3F0FA 3B6NA 3F0EA 3FBAA 4C8GA 1GX1A 1IV1A 4C8EA 1U43A 1IV3A 3ELCA 3F0GA 3K2XA 3P10A 1H48A 3ESJA 3T80A 4C8IA 3IKFA 3KE1A 1YQNA 4C81A 1JY8A 1W55A 3QHDA 3RE3A 3MBMA 1IV4A 1W57A 3GHZA 3IEQA 1IV2A 1T0AA 3P0ZA 3F0DA 1U3LA 3ERNA 1JN1A 1KNKA 1KNJA 2GZLA 3Q8HA 2UZHA 3FPIA 4C82A 1U3PA 1U40A 1VH8A 2PMPA 1VHAA 3IKEA 3IEWA 3F6MA 3K14A
chains in the Genus database with same CATH superfamily
1SA0B 1VQ9F 4ZHWA 2R6R1 3F0EA 3FBAA 1W5BA 3ON1A 2CHSA 4G4VA 3VMFB 5MN6A 2CHTA 3D00A 1UFYA 1U43A 2F9ZC 4C8EA 3LWVC 3CCJF 5GAPK 4X1IB 3V3TA 4NWOB 4G4ZA 3RYCB 3V4DA 1W2BF 2RB9A 5A2QM 5JVDA 3VYSC 3JALA 3JATA 2ALEA 1KNJA 3JALB 4DRXA 1FFXA 3K0TA 3QTYA 4G4XA 3IEWA 3RYFB 2Z01A 3K12A 2BTQB 2UYKA 1FSZA 5BMVA 2OTJF 1W5FA 3S0YA 2QTPA 3K2XA 2QI2A 1SA0A 3J80M 2CWJA 2HQSC 3J81M 1YI2F 1W42A 1QU9A 3E22B 3CG6A 2NMUA 3LYBA 2LBTA 4M8IA 3F6MA 1QD9A 3HKDA 1W41A 4X1YB 1JFFB 3MCAB 2VAPA 2VGMA 3F0FA 3CYQA 1KQSF 3I7TA 3PAFA 3S06A 4X20B 4BVRA 2GLZA 3ZP7A 4U3JB 3WPXA 4BT2A 3SIVA 3VO8A 4ZHVA 4I55B 5JQGB 3S03A 3NK7A 2HVYD 5MN4A 3CCQF 4X1KA 1OFUA 3E20B 5BMVB 3LWQC 4XCQA 5EZYB 3HJWC 5B8FA 5HY2A 3N2KA 4B62A 5HP7A 3LWPC 3CC7F 1Q81H 5HWEA 3F0GA 1RQ2A 3LDTA 4ZOLB 3VIUA 1ZWZA 5GIOC 3IKFA 3C9SA 5EZYA 3HWUA 1IV4A 3WGKA 2IAFA 3CPQA 3O85A 4O4IB 1GO0A 2AIFA 4I50A 3V7EA 5HY1A 3WGLA 1XV2A 3RA6A 2UYPA 1S72F 2N48A 2EWCA 4U3JA 3VYTC 4BY9D 3MCQA 3R0PA 3WGMA 4TZZA 2LBXA 3HTNA 3TD3A 5HXUA 3CCRF 5GANK 5JCOA 3KIZA 4ZI7A 3HKDB 5JCOC 1W55A 5FJ4C 1E7KA 3WJPA 4G4WA 3J7AR 3E22A 4HNAA 1JD1A 1VQMF 3CCMF 5JH7B 4TV9B 2LCAA 3FPIA 1R1MA 1YJ9F 5EYPA 4BVQA 1YHQF 3K14A 5J2UA 3DC2A 3TD5A 1IPAA 1N8RH 3NMUC 2AMTA 2RHJA 4BT5A 3OW2F 2BTOA 2OTMA 3S0HA 2CW4A 4FFBB 5LYJA 4O4LA 3D01A 3WGJA 4O4JA 3RYFA 4O2AB 1X7PA 2KTVA 1OAPA 1FFXB 4DRXB 2UYNB 5EIBC 3LWOC 4NQ3A 4BVTA 1YJWF 5EO3A 3CCVF 5LA6B 3VOBA 3KHNA 4U39A 5JVDB 5J2TA 2UYJA 3PLAC 1VQ4F 2BTUA 2PMPA 5EB0A 5LP6C 4WBNB 1Q7YH 2I6RA 1VQVA 3JASA 4NUTA 5EAZA 5C8YB 3NVKE 5IJ9B 2CVLA 1IV3A 2Z1FA 1W5EA 3CC2F 1QVGF 4B46A 4ZHYB 3RE3A 2YXZA 1VQPF 4LNUA 3GHZA 2KGWA 3HKEA 4ZHQB 2HRUA 3M1XA 4E6EA 2B33A 3RYIB 3RYHA 5IYZA 3JVHA 2Q1YA 1JJ2F 3TD4A 1K8AH 1TUBA 1COMA 2QEXF 1SDSA 3JAMM 4EI9A 2H8EA 1XHOA 1Q82H 1QVFF 1JY8A 3QHDA 4TUYA 3MBMA 2GVIA 3VI6A 1W57A 5ITZA 2RHOA 3P0ZA 5LXTB 3F0DA 3GYQA 3ERNA 3JAKA 4B45A 4C82A 2G9IA 5EB1B 5CB4A 1YITF 3JAWA 5FNVA 1TVKA 5HY0A 3D54A 3JARB 2VAMA 3V7QA 2ZODA 4O2BA 2ZVYA 5IYZB 4EI8A 3RYHB 2MQEA 3KJJA 2VGNA 1M90H 1W3EX 3HKBB 2VAWA 1YQNA 4C4WC 4TV8B 5FLXM 2W8BC 5CA1A 2OHWA 2CSLA 2GZLA 3IKEA 3VYUC 5IJ9A 3N2GA 2HRYA 2FGYA 4ZK7A 1X25A 5C8YA 4PWTA 5LP6A 1K9MH 2ZVZA 3JASB 5LOVA 1RLUA 4IHJA 5KMGA 2OTLF 2ZF8A 3UT5A 3G4SF 5J2TB 2BO1A 3HKCB 1GO1A 4I4TA 2P6YA 1PXWA 1W40A 1XBIA 3CXCF 3P10A 2IQQA 5GONA 1YIJF 2UYNA 4O2BB 4RHAA 5CA0A 4EB6A 3JCMM 2H8CA 5EWRA 5FNVB 3IR9A 5EIBD 5CB4B 3C8LA 2RHLA 3WPWA 1M1KH 4FFBA 2HP3A 4F6RB 2CZWA 3FFMA 1U3PA 4YJ3B 3QUWA 5LXTA 3CB2A 1DBFA 4YJ2B 3CC4F 3I56F 5J2UB 4YJ3A 4ERHA 3CCSF 1X7OA 2HS0A 1W5AA 1VQLF 1VQKF 1TUBB 1W59A 4RQOA 2PHNA 2Q1XA 4EB6B 1VQ7F 1CN7A 5DCVA 4O4HA 5GONB 4ZI7B 4BT7A 4I4TB 3VCZA 3HKCA 2ZOVA 5IJ0A 1ODEA 3C9UA 2AIZP 2ZAUA 2KTUA 3UT5B 3FD6A 3WJRA 5KMGB 4ZHQA 1VHAA 5LOVB 1K73H 4LNUB 3M84A 1YGYA 5LP6B 1VK3A 3CMAF 3N2GB 3MQWA 3LWRC 3CMEF 3N4YA 4IIJA 4G4YA 5GINC 4BT6A 4I50B 1VQOF 4IIJB 1XRGA 4R40B 3ELCA 3S0WA 2QA4F 4O4IA 1NJIH 4WBNA 1NMUB 2WALA 1IV2A 5IJ0B 3GTZA 4ZOLA 4BVSA 5LA6A 1KNKA 5HP8A 4O4HB 1U40A 1VH8A 3N2KB 3JARA 5G4UC 3IMPA 1TVKB 4O2AA 4BT3A 3NK6A 3JAWB 3B6NA 3SIUA 4LCKA 4C8GA 1KD1H 1GX1A 5LYJB 3P4EA 2HS4A 3OBWA 3WGNA 4X1KB 3WJQA 4YJ2A 2HX0A 2Z1EA 3AGKA 4C8IA 1GZ0A 3U0OA 2FC3A 3OONA 1Q8RA 5MN5A 5EYPB 4F6RA 3C9TA 4TV9A 3HAXD 3OBYA 2K1SA 3S02A 2UZHA 4HNAB 3VTIC 1DT9A 1W581 3DDNA 4X20A 5GIPC 3E1YA 5IT9M 4EI7A 1RQ7A 5HXZA 2RHHA 3BYQA 5CA0B 1T0KB 1Z5VA 2IG8A 1QAHA 4X1YA 2OZBA 2DT4A 3M4SA 2L26A 1CLIA 1VQNF 2KG4A 1UI9A 4IHJB 2VXYA 1H48A 3ESJA 3HKEB 1RA4A 3L7QA 2JNBA 5G4VC 1FNJA 4BW0B 1J7HA 3VOAA 1VQ8F 3ZO8A 5AVMA 5CA1B 1JN1A 2DYYA 2YYEA 4TV8A 4BT4A 1VQ5F 2V9YA 1NQ3A 3I55F 4G88A 3EORA 3HKBA 3MDOA 2Z1UA 1H47A 2H6LA 1VQ6F 2I6DA 2HS3A 1ONIA 3JATB 3C9RA 3T80A 3CCUF 3ZOPA 3I3FA 3G6EF 4O4JB 2R751 3RYCA 1T0AA 4O4LB 3JAKB 4X1IA 3CPWF 3FD5A 1YJNF 3Q8HA 5ITZB 4TUYB 3LMEA 2LBWA 4X3MA 4I55A 5JQGA 2HP0B 3N4ZA 4KWEA 3NVIB 1X52A 3KJKA 2Z1TA 5HY4A 1SZQA 5JH7A 3WXMB 3CCLF 1IV1A 1Q86H 1FNKA 5KX5B 3KE1A 1H7MA 1JFFA 4C81A 3CYPB 3CD6F 3RA5A 3IEQA 3G71F 4X3LA 3CCEF 3RYIA 5KX5A 1U3LA 3ZP4A 1Z5WA 1RLGA 4DXDA 1CK2A 3LFOA 1PF5A 1KC8H 2HP0A 4B5CA
chains in the Genus database with same CATH topology
3EORA 3JVHA 5B8FA 2AMTA 1H47A 3F0FA 3B6NA 3F0EA 3FBAA 4C8GA 1GX1A 1IV1A 4C8EA 1U43A 1IV3A 3ELCA 3F0GA 3K2XA 3P10A 1H48A 3ESJA 3T80A 4C8IA 3IKFA 3KE1A 1YQNA 4C81A 1JY8A 1W55A 3QHDA 3RE3A 3MBMA 1IV4A 1W57A 3GHZA 3IEQA 1IV2A 1T0AA 3P0ZA 3F0DA 1U3LA 3ERNA 1JN1A 1KNKA 1KNJA 2GZLA 3Q8HA 2UZHA 3FPIA 4C82A 1U3PA 1U40A 1VH8A 2PMPA 1VHAA 3IKEA 3IEWA 3F6MA 3K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  3JVH A;  5B8F A;  2AMT A;  1H47 A;  3F0F A;  3B6N A;  3F0E A;  3FBA A;  4C8G A;  1GX1 A;  1IV1 A;  4C8E A;  1U43 A;  1IV3 A;  3ELC A;  3F0G A;  3K2X A;  3P10 A;  1H48 A;  3ESJ A;  3T80 A;  4C8I A;  3IKF A;  3KE1 A;  1YQN A;  4C81 A;  1JY8 A;  1W55 A;  3QHD A;  3RE3 A;  3MBM A;  1IV4 A;  1W57 A;  3GHZ A;  3IEQ A;  1IV2 A;  1T0A A;  3P0Z A;  3F0D A;  1U3L A;  3ERN A;  1JN1 A;  1KNK A;  1KNJ A;  2GZL A;  3Q8H A;  2UZH A;  3FPI A;  4C82 A;  1U3P A;  1U40 A;  1VH8 A;  2PMP A;  1VHA A;  3IKE A;  3IEW A;  3F6M A;  3K14 A; 
#chains in the Genus database with same CATH topology
 1SA0 B;  1VQ9 F;  4ZHW A;  2R6R 1;  3F0E A;  3FBA A;  1W5B A;  3ON1 A;  2CHS A;  4G4V A;  3VMF B;  5MN6 A;  2CHT A;  3D00 A;  1UFY A;  1U43 A;  2F9Z C;  4C8E A;  3LWV C;  3CCJ F;  5GAP K;  4X1I B;  3V3T A;  4NWO B;  4G4Z A;  3RYC B;  3V4D A;  1W2B F;  2RB9 A;  5A2Q M;  5JVD A;  3VYS C;  3JAL A;  3JAT A;  2ALE A;  1KNJ A;  3JAL B;  4DRX A;  1FFX A;  3K0T A;  3QTY A;  4G4X A;  3IEW A;  3RYF B;  2Z01 A;  3K12 A;  2BTQ B;  2UYK A;  1FSZ A;  5BMV A;  2OTJ F;  1W5F A;  3S0Y A;  2QTP A;  3K2X A;  2QI2 A;  1SA0 A;  3J80 M;  2CWJ A;  2HQS C;  3J81 M;  1YI2 F;  1W42 A;  1QU9 A;  3E22 B;  3CG6 A;  2NMU A;  3LYB A;  2LBT A;  4M8I A;  3F6M A;  1QD9 A;  3HKD A;  1W41 A;  4X1Y B;  1JFF B;  3MCA B;  2VAP A;  2VGM A;  3F0F A;  3CYQ A;  1KQS F;  3I7T A;  3PAF A;  3S06 A;  4X20 B;  4BVR A;  2GLZ A;  3ZP7 A;  4U3J B;  3WPX A;  4BT2 A;  3SIV A;  3VO8 A;  4ZHV A;  4I55 B;  5JQG B;  3S03 A;  3NK7 A;  2HVY D;  5MN4 A;  3CCQ F;  4X1K A;  1OFU A;  3E20 B;  5BMV B;  3LWQ C;  4XCQ A;  5EZY B;  3HJW C;  5B8F A;  5HY2 A;  3N2K A;  4B62 A;  5HP7 A;  3LWP C;  3CC7 F;  1Q81 H;  5HWE A;  3F0G A;  1RQ2 A;  3LDT A;  4ZOL B;  3VIU A;  1ZWZ A;  5GIO C;  3IKF A;  3C9S A;  5EZY A;  3HWU A;  1IV4 A;  3WGK A;  2IAF A;  3CPQ A;  3O85 A;  4O4I B;  1GO0 A;  2AIF A;  4I50 A;  3V7E A;  5HY1 A;  3WGL A;  1XV2 A;  3RA6 A;  2UYP A;  1S72 F;  2N48 A;  2EWC A;  4U3J A;  3VYT C;  4BY9 D;  3MCQ A;  3R0P A;  3WGM A;  4TZZ A;  2LBX A;  3HTN A;  3TD3 A;  5HXU A;  3CCR F;  5GAN K;  5JCO A;  3KIZ A;  4ZI7 A;  3HKD B;  5JCO C;  1W55 A;  5FJ4 C;  1E7K A;  3WJP A;  4G4W A;  3J7A R;  3E22 A;  4HNA A;  1JD1 A;  1VQM F;  3CCM F;  5JH7 B;  4TV9 B;  2LCA A;  3FPI A;  1R1M A;  1YJ9 F;  5EYP A;  4BVQ A;  1YHQ F;  3K14 A;  5J2U A;  3DC2 A;  3TD5 A;  1IPA A;  1N8R H;  3NMU C;  2AMT A;  2RHJ A;  4BT5 A;  3OW2 F;  2BTO A;  2OTM A;  3S0H A;  2CW4 A;  4FFB B;  5LYJ A;  4O4L A;  3D01 A;  3WGJ A;  4O4J A;  3RYF A;  4O2A B;  1X7P A;  2KTV A;  1OAP A;  1FFX B;  4DRX B;  2UYN B;  5EIB C;  3LWO C;  4NQ3 A;  4BVT A;  1YJW F;  5EO3 A;  3CCV F;  5LA6 B;  3VOB A;  3KHN A;  4U39 A;  5JVD B;  5J2T A;  2UYJ A;  3PLA C;  1VQ4 F;  2BTU A;  2PMP A;  5EB0 A;  5LP6 C;  4WBN B;  1Q7Y H;  2I6R A;  1VQV A;  3JAS A;  4NUT A;  5EAZ A;  5C8Y B;  3NVK E;  5IJ9 B;  2CVL A;  1IV3 A;  2Z1F A;  1W5E A;  3CC2 F;  1QVG F;  4B46 A;  4ZHY B;  3RE3 A;  2YXZ A;  1VQP F;  4LNU A;  3GHZ A;  2KGW A;  3HKE A;  4ZHQ B;  2HRU A;  3M1X A;  4E6E A;  2B33 A;  3RYI B;  3RYH A;  5IYZ A;  3JVH A;  2Q1Y A;  1JJ2 F;  3TD4 A;  1K8A H;  1TUB A;  1COM A;  2QEX F;  1SDS A;  3JAM M;  4EI9 A;  2H8E A;  1XHO A;  1Q82 H;  1QVF F;  1JY8 A;  3QHD A;  4TUY A;  3MBM A;  2GVI A;  3VI6 A;  1W57 A;  5ITZ A;  2RHO A;  3P0Z A;  5LXT B;  3F0D A;  3GYQ A;  3ERN A;  3JAK A;  4B45 A;  4C82 A;  2G9I A;  5EB1 B;  5CB4 A;  1YIT F;  3JAW A;  5FNV A;  1TVK A;  5HY0 A;  3D54 A;  3JAR B;  2VAM A;  3V7Q A;  2ZOD A;  4O2B A;  2ZVY A;  5IYZ B;  4EI8 A;  3RYH B;  2MQE A;  3KJJ A;  2VGN A;  1M90 H;  1W3E X;  3HKB B;  2VAW A;  1YQN A;  4C4W C;  4TV8 B;  5FLX M;  2W8B C;  5CA1 A;  2OHW A;  2CSL A;  2GZL A;  3IKE A;  3VYU C;  5IJ9 A;  3N2G A;  2HRY A;  2FGY A;  4ZK7 A;  1X25 A;  5C8Y A;  4PWT A;  5LP6 A;  1K9M H;  2ZVZ A;  3JAS B;  5LOV A;  1RLU A;  4IHJ A;  5KMG A;  2OTL F;  2ZF8 A;  3UT5 A;  3G4S F;  5J2T B;  2BO1 A;  3HKC B;  1GO1 A;  4I4T A;  2P6Y A;  1PXW A;  1W40 A;  1XBI A;  3CXC F;  3P10 A;  2IQQ A;  5GON A;  1YIJ F;  2UYN A;  4O2B B;  4RHA A;  5CA0 A;  4EB6 A;  3JCM M;  2H8C A;  5EWR A;  5FNV B;  3IR9 A;  5EIB D;  5CB4 B;  3C8L A;  2RHL A;  3WPW A;  1M1K H;  4FFB A;  2HP3 A;  4F6R B;  2CZW A;  3FFM A;  1U3P A;  4YJ3 B;  3QUW A;  5LXT A;  3CB2 A;  1DBF A;  4YJ2 B;  3CC4 F;  3I56 F;  5J2U B;  4YJ3 A;  4ERH A;  3CCS F;  1X7O A;  2HS0 A;  1W5A A;  1VQL F;  1VQK F;  1TUB B;  1W59 A;  4RQO A;  2PHN A;  2Q1X A;  4EB6 B;  1VQ7 F;  1CN7 A;  5DCV A;  4O4H A;  5GON B;  4ZI7 B;  4BT7 A;  4I4T B;  3VCZ A;  3HKC A;  2ZOV A;  5IJ0 A;  1ODE A;  3C9U A;  2AIZ P;  2ZAU A;  2KTU A;  3UT5 B;  3FD6 A;  3WJR A;  5KMG B;  4ZHQ A;  1VHA A;  5LOV B;  1K73 H;  4LNU B;  3M84 A;  1YGY A;  5LP6 B;  1VK3 A;  3CMA F;  3N2G B;  3MQW A;  3LWR C;  3CME F;  3N4Y A;  4IIJ A;  4G4Y A;  5GIN C;  4BT6 A;  4I50 B;  1VQO F;  4IIJ B;  1XRG A;  4R40 B;  3ELC A;  3S0W A;  2QA4 F;  4O4I A;  1NJI H;  4WBN A;  1NMU B;  2WAL A;  1IV2 A;  5IJ0 B;  3GTZ A;  4ZOL A;  4BVS A;  5LA6 A;  1KNK A;  5HP8 A;  4O4H B;  1U40 A;  1VH8 A;  3N2K B;  3JAR A;  5G4U C;  3IMP A;  1TVK B;  4O2A A;  4BT3 A;  3NK6 A;  3JAW B;  3B6N A;  3SIU A;  4LCK A;  4C8G A;  1KD1 H;  1GX1 A;  5LYJ B;  3P4E A;  2HS4 A;  3OBW A;  3WGN A;  4X1K B;  3WJQ A;  4YJ2 A;  2HX0 A;  2Z1E A;  3AGK A;  4C8I A;  1GZ0 A;  3U0O A;  2FC3 A;  3OON A;  1Q8R A;  5MN5 A;  5EYP B;  4F6R A;  3C9T A;  4TV9 A;  3HAX D;  3OBY A;  2K1S A;  3S02 A;  2UZH A;  4HNA B;  3VTI C;  1DT9 A;  1W58 1;  3DDN A;  4X20 A;  5GIP C;  3E1Y A;  5IT9 M;  4EI7 A;  1RQ7 A;  5HXZ A;  2RHH A;  3BYQ A;  5CA0 B;  1T0K B;  1Z5V A;  2IG8 A;  1QAH A;  4X1Y A;  2OZB A;  2DT4 A;  3M4S A;  2L26 A;  1CLI A;  1VQN F;  2KG4 A;  1UI9 A;  4IHJ B;  2VXY A;  1H48 A;  3ESJ A;  3HKE B;  1RA4 A;  3L7Q A;  2JNB A;  5G4V C;  1FNJ A;  4BW0 B;  1J7H A;  3VOA A;  1VQ8 F;  3ZO8 A;  5AVM A;  5CA1 B;  1JN1 A;  2DYY A;  2YYE A;  4TV8 A;  4BT4 A;  1VQ5 F;  2V9Y A;  1NQ3 A;  3I55 F;  4G88 A;  3EOR A;  3HKB A;  3MDO A;  2Z1U A;  1H47 A;  2H6L A;  1VQ6 F;  2I6D A;  2HS3 A;  1ONI A;  3JAT B;  3C9R A;  3T80 A;  3CCU F;  3ZOP A;  3I3F A;  3G6E F;  4O4J B;  2R75 1;  3RYC A;  1T0A A;  4O4L B;  3JAK B;  4X1I A;  3CPW F;  3FD5 A;  1YJN F;  3Q8H A;  5ITZ B;  4TUY B;  3LME A;  2LBW A;  4X3M A;  4I55 A;  5JQG A;  2HP0 B;  3N4Z A;  4KWE A;  3NVI B;  1X52 A;  3KJK A;  2Z1T A;  5HY4 A;  1SZQ A;  5JH7 A;  3WXM B;  3CCL F;  1IV1 A;  1Q86 H;  1FNK A;  5KX5 B;  3KE1 A;  1H7M A;  1JFF A;  4C81 A;  3CYP B;  3CD6 F;  3RA5 A;  3IEQ A;  3G71 F;  4X3L A;  3CCE F;  3RYI A;  5KX5 A;  1U3L A;  3ZP4 A;  1Z5W A;  1RLG A;  4DXD A;  1CK2 A;  3LFO A;  1PF5 A;  1KC8 H;  2HP0 A;  4B5C A; 
#chains in the Genus database with same CATH homology
 3EOR A;  3JVH A;  5B8F A;  2AMT A;  1H47 A;  3F0F A;  3B6N A;  3F0E A;  3FBA A;  4C8G A;  1GX1 A;  1IV1 A;  4C8E A;  1U43 A;  1IV3 A;  3ELC A;  3F0G A;  3K2X A;  3P10 A;  1H48 A;  3ESJ A;  3T80 A;  4C8I A;  3IKF A;  3KE1 A;  1YQN A;  4C81 A;  1JY8 A;  1W55 A;  3QHD A;  3RE3 A;  3MBM A;  1IV4 A;  1W57 A;  3GHZ A;  3IEQ A;  1IV2 A;  1T0A A;  3P0Z A;  3F0D A;  1U3L A;  3ERN A;  1JN1 A;  1KNK A;  1KNJ A;  2GZL A;  3Q8H A;  2UZH A;  3FPI A;  4C82 A;  1U3P A;  1U40 A;  1VH8 A;  2PMP A;  1VHA A;  3IKE A;  3IEW A;  3F6M A;  3K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...