3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
5J2UA 4I50B 5LXTA 4M8IA 1Z5VA 3HKEA 4U39A 5BMVA 5IJ0B 1OFUA 2VXYA 5LOVB 4ZHQA 2R6R1 4EI8A 4DRXB 1FSZA 5EIBD 1TUBA 3JARB 5J2TA 1TVKA 4O2BB 4TV8A 4EB6A 5CA0B 4HNAA 5GONA 3WGKA 3RYIB 5EIBC 5MN6A 3VO9A 4TV9B 3ZBQA 4EI7A 4YJ3B 5LP6A 3M8KA 2RHOA 2VAWA 5JH7A 4U3JA 1RQ7A 5BMVB 4LNUA 4ZI7B 2RHLA 5JQGB 5CB4B 5IYZA 2RHHA 4O2AA 5IJ9A 4YJ3A 3HKDB 5LP6B 4O2BA 5CA0A 1FFXB 2GVIA 5JH7B 4TUYB 2BTQB 5GONB 4ZOLA 4DXDA 3ZBPA 3WGLA 4B45A 3WGJA 5MN5A 4I55A 4FFBA 4WBNA 5KX5B 4YJ2A 4O4HB 4I4TB 3HKDA 4ZHQB 3JAWB 3RYHA 3M89A 3JAKA 5LYJB 1Z5WA 4B46A 3JASB 4I55B 4FFBB 4WBNB 4HNAB 3E22A 3N2GA 3JATB 4ZOLB 3N2KB 4I50A 3JAKB 5LP6C 5LXTB 2R751 1W5AA 5C8YA 3UT5A 5ITZB 1JFFA 4O4HA 5CA1B 4X1YB 3HKBB 4IIJA 5CB4A 4E6EA 3R4VA 5J2UB 5FNVB 5JCOA 5JVDA 1TUBB 3JARA 5J2TB 1FFXA 3UT5B 4X1IA 4F6RB 5EYPB 5C8YB 2RHJA 3WGMA 3RB8A 3RYIA 3JATA 5KX5A 2XKBA 3RYFA 1W5BA 5JVDB 5EZYA 4U3JB 1TVKB 3HKCB 1JFFB 4IHJB 5CA1A 3JAWA 1SA0B 3RYHB 4X1IB 3HKBA 4IIJB 4F6RA 5LYJA 4O4IA 5M7EA 5FNVA 3VPAA 5IJ9B 4X20A 5LA6B 3E22B 1W5FA 5EZYB 1W5EA 4TUYA 3HKEB 3RYCB 2VAMA 4LNUB 4ZI7A 3WGNA 1W59A 4O4IB 4O4LB 2Q1XA 4O2AB 4YJ2B 5ITZA 3RYFB 5KMGA 4X20B 3HKCA 4X1KA 4IHJA 5LA6A 2Q1YA 3VOAA 3ZIDA 2BTQA 4KWEA 3JASA 3VOBA 2VAPA 4TV9A 4O4LA 4O4JA 5EYPA 2XKAA 1RLUA 5KMGB 3JALA 4I4TA 5LOVA 3RYCA 3V3TA 3N2KA 5MN4A 5JQGA 5IYZB 4DRXA 4XCQA 3CB2A 5JCOC 4EI9A 4TV8B 4EB6B 1SA0A 2BTOA 4X1YA 4O4JB 5IJ0A 3VO8A 4X1KB 1W581 3C8LA 1RQ2A 3JALB 3N2GB
chains in the Genus database with same CATH superfamily
1FOEB 4DLYA 3IMFA 1V55C 3GLUA 4JLAA 2F1HA 1W25A 3EF3A 1ZGZA 1RLIA 1XQWA 3SPJA 3AF1A 3PFHA 4RLSA 5DGCA 3LWZA 5UKDA 1ZTEA 5HP8A 5AM4A 1R6AA 4OHOA 1XU7A 4B3CA 2OHXA 2ZYGA 4QICA 4C6SA 4LE2A 4JI0B 1KGSA 4HEHA 2GTSA 3N4ZA 4OO3A 4L51A 3GLVA 3OLCX 4U7DA 1EE2A 1PNRA 4I2VA 4D3YA 1P3JA 3HXQA 2QL9A 1B06A 1WW2A 1ZIDA 3TPZA 5AG2A 1VCMA 2KG7A 1VOTA 5K3BA 3NAZA 5G4VC 3N5KA 4NMWA 2EJCA 1KKLA 4DPLA 4EKGA 1C30B 3X1XA 1W2HA 1DZ3A 2Y68A 3FMVA 4G41A 3TG2A 2HPVA 5D5QA 4ZVSA 1NLZA 2Q45A 5J5VA 4X88A 1Q6UA 1DIBA 2PZGA 4D4MA 1SUCA 4N7MA 3IKTA 3I9LA 4EPYA 2CTRA 2IIBA 2C83A 2BM1A 4XWAA 4DLXA 2BF4A 1V8DA 2DUWA 3DO5A 1ZK0A 3GLHA 3QO8A 3K57A 1AGNA 1CZRA 4HQ6A 4L3WA 3HLYA 1OJHA 1VZ2A 2BD0A 1ID1A 4NYJR 2GJKA 1P7ZA 2HGSA 2P0EA 3LV8A 3VIUA 3Q4GA 5ALTA 1MTZA 5H4GA 5AM5A 1YMUA 3FPSA 1E9FA 1AHPA 3MIZA 1PJ8A 4N3GA 3NHKA 3CCVF 4XPZA 4ZVKA 3HM9A 4U00A 2D3OW 4B87A 3EW9A 4D9HA 5EZ6B 1L3IA 4KK4A 1O77A 1VFPA 4N0MA 3BK7A 5LQUA 1UJWB 1RM1C 2QM3A 4Z8XA 4TRRA 5CDSA 3IKJA 2G4VA 4YBRA 3E89A 1VL2A 3P8ZA 4DV6O 3E8GA 2J67A 3L77A 4Y0AA 3NFYA 1UMBA 1KRXA 5FBVB 4X1IA 2XCLA 2Y1EA 3DVAA 1WD7A 2I2CA 4OHRA 1I3MA 3K15A 4CZ2A 1KI6A 2JFGA 4JJGA 2M6SA 1RAEA 3BIWA 2A0UA 2RK6A 4HNVA 5KB3A 4C4WC 1T5HX 1U81A 1YUMA 2IUEA 3W6ZA 3PDIB 1A7AA 3ZXXA 4RULA 1ZQ9A 1JTVA 5CIWA 1RU3A 2X9LA 5ALEA 3WAJA 2XNDG 4IF6A 3ELYA 1SB9A 2GHIA 4UVIA 2JCXA 2VNAA 1UPCA 2YVKA 3Q8XB 4OU5A 4X9XA 4W5TA 5D8DA 2XUJA 4YR9A 1RZUA 3DT8A 3PQ8A 3HCAA 3G6KA 3W7AA 2QRKA 2VBIA 3OQIB 1NLYA 2Q6TA 3D6FA 1W35A 4O4IB 3QYAA 2HYDA 3KT8A 2Q1SA 4JLPA 1JB1A 2HN9A 3JSNA 4JMLA 1D04A 3ZQKA 1GVNB 1AQYA 4F11A 2YMPA 1PL0A 3ZTTA 1JU4A 2OV8A 1JS1X 2GZLA 3GEIA 1HLFA 3HBJA 4MWOA 3ROZA 2ZIAA 4BVAA 5L3VA 3VKUA 2H59A 2R4UA 3H8WA 2QJTA 2CSXA 5NULA 4ZWNA 3VDQA 5EFOA 1DTOA 4MQBA 2X8AA 1QVFU 2DCUA 1EK5A 2F3TA 1P2SA 2EWVA 2G08A 4PM4A 3TOSA 4RFVA 4JASB 2HSJA 3PFFA 1R18A 3N28A 4N3NA 3WJQA 5IPFA 2FPIB 1FJGB 4BVHA 1JLLB 2R87A 2Y0IA 4UJ3A 5LR6A 3KVVA 4C7OA 1GR1A 4ES6A 1UBKS 1Y7LA 1GUZA 2NV0A 1H0KA 1R8JA 4L5IA 4DQVA 5KWEA 1GZSA 4RDIA 1RC0A 3DWIA 2WTNA 3C7AA 5CEEA 3K6SA 2CUZA 2OY0A 4ZHQA 3PD7A 1DO8A 3RVQA 5ITSA 3FRJA 3U37A 2RC6A 1UPUA 4DYDA 4MDFA 1Y63A 4WFFA 1A4IA 3PAFA 2W0XA 4IMPA 4ZZ3A 2WHQA 5BYBA 2XI4A 3M4XA 4IXTA 4RJ2A 4FGKA 4Y6RA 2JGFA 2VC2B 1UKAA 4X0EA 4MHSA 3A26A 3GZTB 3UKJA 3R40A 2PU5A 1N7GA 3CTPA 1K73W 1UFVA 2Q6OA 1LQ2A 1GTSA 2G9RA 4ZMRA 2F1KA 4L27A 2VNJA 1Q3EA 1ZK3A 2HJRA 3H8SA 5KJEA 1RPTA 1M2OA 1OFTA 3NJ8A 3ZU2A 5CBHA 2J0UA 2WLLB 2Y1CA 3EIUA 2QM7A 2EP7A 4G9GA 3UVEA 4YV1A 2GXAA 5JC1A 4QBGB 3RSOA 4MEAA 2JLAA 2ZB4A 2CWJA 4PYQA 1G3IA 4DO2A 1V71A 4CTJA 4YP9A 2JHCA 3OP1A 4WBNA 1EJ0A 3PZBA 1LBTA 4GP9A 1GH6A 4JQZA 4INJA 5F5LA 4DUPA 1TIPA 2ZREA 2X0EA 3OPMA 1I4EB 4B7KA 4YIOA 3OCXA 2ZR0A 1NH2B 3C43A 5KC9A 1QGZA 1BWQA 4E07A 4QTZA 5CNIA 2KBFA 4YQZA 4I0XA 5EJ5A 1Q6IA 2OE2A 4G0UA 2I4IA 4CL0A 2QYSA 3PGKA 1N5KA 1OASA 4K9DA 2GKSA 4WF9V 3ENZA 1EN4A 1XALA 2RH9B 4HUQA 3AP3A 4IV5A 3M6UA 4TL8A 5IC5A 3AVWA 1KNKA 4X1OA 4F3KA 4Z4CA 1E8DA 4Y2VA 3QFSA 3V7NA 2X14A 4Y2HA 3IXMA 1U9ZA 1U02A 4MUBA 3PCTA 1P73A 2D5AA 2Z2IA 3QP9A 2MDTA 1H6BA 4I50F 3BCRA 1W4CA 2FWBA 2HI0A 3IV6A 4PSDA 5U4QA 1G2QA 3BIJA 1JAXA 5IUKC 2BBWA 1MN6A 2GVZC 2OV1A 3H1HH 3QLTA 3BPSA 2QMHA 4UBJA 1AUVA 1UDRA 4KI0A 4DCTA 1LWNA 1JR3A 1Z25A 3HDQA 2VQEO 3L0ZA 4IM7A 3DTNA 4D3SA 4YP5A 3GDGA 3OZUA 3Q0EA 5B1NA 2XUMA 1SCNE 4F97A 3C3AA 3R2JA 1Z6YA 3AEKA 5DNAA 3DXRA 4CM8A 4GD3Q 2VIIA 2ODEA 1W5EA 3L2OB 5CRIA 1JD1A 3HSSA 2PL5A 3KWLA 3FRHA 5AXAA 1I7SB 3P20A 1QHIA 4KMOA 2JCGA 3DDZX 3VQWA 3DPIA 9ATCA 3UG6A 4GI2A 3CWCA 3ABLC 4W9MC 4UHKA 5JRDS 1KUQA 2LE0A 3HVJA 3F7MA 5LQKA 5CJ2A 2H4YA 2V6BA 7MDHA 1TI7A 1U3UA 2Q1UA 4ZVTA 3OZCA 3CV3A 3Q2IA 3RT7A 1DCMA 1L4HA 1XSEA 3BWEA 1VI2A 1JVSA 4D96A 2QWQB 5IJXA 1EDDA 5JDCA 1Q1GA 4FDAA 1HKUA 3PIRA 4G0PA 1W6UA 3C87A 1Z8HA 2YN4A 3H2JA 3M6XA 3OMWA 3PDHA 1I94O 3FUWA 3B4SA 4ZCSA 4XE5A 1A77A 1VL0A 3OBBA 4R9NA 4FSDA 4BMOB 5KWVA 4UHBA 3V46A 1FTNA 1GTMA 2JVJA 4WKPA 1XBIA 2AJCA 2IDKA 4HDKB 1U0HC 1SIWA 1KI9A 2FSHA 2JASA 4MRMB 4AM8A 4BO1A 4TZZA 1BX0A 2RARA 4QOHA 5DVZA 4BRUA 1Y48E 3I30X 4BY9D 3F98A 3ICOA 3Q4HA 5KUKA 2G9NA 3RVOA 3VZSA 1M2NA 3HJWC 2NYRA 4A16A 1ZIOA 4HQ0A 4LBZA 4KQ1A 5FNVF 3AM4A 4BW9A 1HTWA 1E79A 1N5MA 3WNBA 4AG3A 2JS7A 5AVSA 1PJ4A 4NBLA 1SZJG 3MGBA 4Y9SA 4DREA 5BXYA 5ESWA 1QR6A 3VO9A 1XMOB 1KERA 2H5IA 4Q21A 5B6JA 9MHTA 3ABSB 2X2OA 3K5PA 3RN4A 2XH8A 4FXOA 1T6YA 3L46A 4HQLA 1X92A 2I3AA 5JXHA 5B3LA 1L4YA 1JQ3A 1RYZA 2Y4OA 4M8NE 4L6IA 2WA1A 3DZGA 1PTJC 3ILVA 1KA9H 2GCGA 3ZW8A 4D9EA 1P5FA 2B8JA 2BEUA 3KYCB 5AW2A 3HYSA 2HV8A 3NNSA 5B1HA 1OI7A 4TUYB 4QD3A 1UJ6A 1ZD3A 4WY8A 4BQNA 4F06A 3SF8A 1VG0B 1JDVA 3N0VA 4AWBA 3LFOA 3IP5A 2Z30A 4L7QA 1Y4SA 2GF9A 4Q0MA 4N41A 1T5EA 1KR5A 2NTYC 2WU3A 1B74A 2ZI4A 5DRYA 5F12A 5HRUA 4Z4GA 1T0KB 3CBQA 3OU2A 4INAA 4JJ8A 4MAMA 5FF9A 2R7MA 3HJRA 3VX4A 3KWMA 4CF6A 1L4MA 1RE1A 3IX7A 3LY9A 1EJ6A 4LHYA 5AR1A 1VGVA 3T3PB 7GPBA 2PCLA 5IYBO 4KJZA 1NI4B 1TGVA 4IKOA 3OZBA 4MUGA 3RVSA 3S6JA 3IHWA 5L3SA 3BB4A 1OFVA 4ZP1A 1XLUA 2ZULA 4UM9B 5LXTB 2EFDB 2JJ8A 3CISA 5HF5A 4Q7JB 3WAKA 4DCVA 5BWCA 2FMKA 5KSOA 4F3CA 3BGIA 4MLPA 4IIJF 3PQDA 3DE7X 2H94A 1DHTA 1NBIA 4B76A 3GH3A 3INYA 4DGQA 4MS1A 2C3PA 3PE3A 4UCUA 1HNXB 3O85A 1SMKA 1U8UA 3AVOA 2MTBA 4PR0A 3GGOA 1CQIB 4EHAA 4HNUA 4HB0A 1M0TA 1E1QA 3TECE 3DL2A 1F4MA 1Q0LA 3GGDA 4E2WA 3ICPA 4S24A 3BD9A 4AN0A 1AI5A 1U7ZA 2RBEA 4B47A 5CYPA 2Q4PA 5JVDB 1Q21A 5AW6A 1DC6A 5JAPA 1NKSA 1ZRSA 4ZIRA 4QOEA 1YTLA 2ZI6A 4FYXA 4F3RA 4F6RA 1KVRA 1TC2A 2RHMA 3I0ZA 2FN4A 3AX6A 4IH4A 5ECDA 4JLOA 3TLBA 4O8CA 4EB0A 1XNQO 1PFGA 2RB5A 4R7TA 1V7CA 4C9BA 4DILA 2JS3A 4ZHSA 3JD0A 5A03A 5F98A 4JTCB 4AS3A 1KO8A 1UBGA 2GM3A 3K2BA 4L0DA 2IYNA 2C54A 2A59A 4MDHA 2WY2D 4NU6A 5BT9A 2B0JA 2QUKA 2ID4A 3AETA 2PGNA 3FNFA 3LUBA 4HUQB 1M56B 4GMKA 3ZBUA 4KREA 1ZJWA 1G9SA 2JKYA 5J9FA 2ZODA 5EPEA 2OZLA 4CN9A 3JRWA 5BSHA 4YUYA 3R3WA 4ETIA 1TM4E 4BJ1A 3U1VA 3CJRA 3WSWA 1WP9A 5CFNA 2V8BA 2NVBA 2XA2A 2EX0A 4IFBA 2BMEA 3MWJA 3INGA 3FNEA 1ZNYA 3I83A 2CJXA 3KZOA 4RELA 5DN6A 5EQDA 3ROGA 1K0FA 1VCNA 2N46A 2JFFA 3USZA 5KTKA 3OAAA 1QNMA 3TVYA 4G37A 3OR7C 4MZDA 3C45A 3JQFA 2GCOB 3SZ3A 4YCMA 1FYJA 4ZREA 4ZJUA 3MS2A 1MG1A 3Q7TA 4BT6A 5AJWA 4JYZA 2DWCA 4JA2A 3JZAA 2HIGA 1QMPA 4BQOA 1PSZA 4EFMA 1VIYA 4FBLA 3LKVA 2UZIR 1Q3KA 3U7EB 4KKXB 5FLYA 3WL6A 3T4XA 4HFNA 3GLFE 4DCGA 2NT4A 5E3JA 4LH6A 1HLPA 3E3MA 2A7QA 2EBUA 5ALDA 3Q7EA 3RODA 3THRA 4DIFA 3JWPA 5HNKA 3WL8A 3DLAA 2H2FA 1U0NA 2VDMB 1U3WA 3NWBA 2JEXA 1ESNA 1HMYA 3O1IC 4UDXX 3W77A 3B7GA 3KEQA 2P6JA 4ZVMA 2ODTX 2LIVA 5CXXA 3HY6A 5SZHB 3UICA 2BFWA 3IQEA 3P45A 3MWKA 3NEYA 4RS4A 4DCNA 5ER9A 4RETA 3GD7A 5H68A 2PKCA 3H97A 1DNPA 3D3KA 3HXLA 1ZKDA 2IXFA 3TQRA 1NURA 4Q6WA 3U4QA 3D59A 4GOOD 3Q5GA 4LOJA 2CCGA 4O5OA 3LQQA 4EARA 4GKJO 1V48A 3CSSA 3FKQA 4N54A 3CCRV 3C5HA 4X00A 4YCDA 3ZIAD 2QYHA 2OXFA 3AKCA 3PGMA 4D9IA 2X6TA 2GM4A 2R8ZA 1YDGA 5TVKA 1ESEA 5DWQA 5FPSA 3AKZA 3VCZA 3K1AB 1MNQA 4F5EA 1LCIA 2G80A 4DV2O 2BFEA 4HNQA 1WL8A 1SC3A 2NLOA 2EZOA 1MJNA 3D7MA 1IEXA 4UXJA 3HKDA 3RYHA 1XRPA 1DXQA 1P7PA 2GKOA 1BQ0A 1W0KA 3N07A 4I3GA 5L51A 5JTUA 4F2PA 4BNVA 3AG4C 3LNCA 2OO7A 3W7TA 1D8AA 1RJDA 2AI1A 3KXKA 4D45A 4EAQA 1L3BA 4EG5A 3VMMA 4C14A 2JF0A 1L2TA 1C3VA 1PWHA 4TTQA 3CF6R 1GEGA 1P81A 3L0CA 4ZAFA 4DDUA 4IXNA 4KR0A 1EXWA 5KSWB 1V6AA 5B5SA 2HWYA 3E2IA 5KQSA 2Y2UA 4DE5A 2C2KA 1I1NA 1UKYA 1ISMA 1IZZA 3M34A 3ONNA 2P4QA 1ZK4A 3GRZA 2ATKC 1QTIA 2WPDA 3PFKA 3PNKA 3Q87B 3SPXA 1NYTA 3M6VA 5K2OA 1LXCA 4IJMA 2G9IA 1M57C 4JI8O 1F5SA 1ADJA 1V8PA 3C6YA 1CS0B 5C5EA 4J2HA 4K6OA 4Z9AA 4Q03A 2OG2A 2XXAB 2KX7A 4ER5A 3UMYA 2GETA 4L8GA 3CEIA 1F6WA 2AOVA 4KOAA 4RSHA 4AJHA 1MZFA 1RXSA 5DMHA 5ANRB 5K01A 5CDGA 3KU1A 2NO0A 4LISA 1YIJV 5HHTA 4Q00A 5I47A 3ADKA 3DM9B 2VJOA 4RQEA 3V7YA 4G0MA 3V2GA 3K3WA 1XNJA 5ALLA 1RPAA 2DFLA 2QS9A 4JBWA 4RD0A 2P11A 3KQSA 1JIIA 2Y05A 3MAAC 4X20A 1EZZA 3HWRA 3N7TA 4OKIA 4MI3A 5ETJA 1DFIA 2GFQA 3ZS8C 7REQA 1FS0G 2A9QA 1FNJA 4PZ0A 4L08A 2GS9A 3PFIA 1S7GA 1D1SA 2WWFA 4QXRA 5F3WB 1AJEA 3ZCSA 2NXCA 4ER6A 4B7CA 2J3DA 1TLTA 2JK0A 5HIJA 1WHSA 3ESZA 2PU7A 3QYFA 2PTGA 4TXHA 4W4LA 1VMKA 1NN0A 3B5JA 4C30A 5FAKA 4Q93A 3FTEA 3GAZA 2XQVA 4CETA 1OTYA 4R54A 1N0VC 1OTXA 5JCXA 1J8YF 2XWBF 1FU8A 3GRAA 3MINB 1PD1A 2DUUA 3TIXB 1D2NA 1F8FA 2BE9A 1GAQA 3C7KA 5A9TA 5KQMA 4HX9A 2EILC 2KHZA 2UYNB 3IQWA 1M1KH 2W8ZA 5KHIA 3K1TA 1YZYA 3KLPX 2BHSA 1GAEO 5IH3A 4CF7A 3K0EA 2HLDD 5BW5A 3TBKA 1ZM2A 2OCPA 2POQX 3GMSA 3HNRA 4GFDA 1ADCA 4Y6LA 2AR0A 1PDVA 1XV2A 4DCJA 4DIKA 4DYVA 3GF4A 2JBAB 3ZGZA 2HUPA 1PP9H 4JWTA 2BHLA 5JYCA 1SBZA 3B8HA 1CUJA 4P38A 4OQFA 5ABPA 3KETA 4ER3A 4E31A 3DL7A 4XUDA 5I9TA 1ZZEA 5HBGA 4BTEA 1EWYA 4V0QA 5TS2A 3L04A 2ITCC 1QFJA 5FOTA 1E79G 1RZRD 3TLEA 2WP0A 4EF6A 4CL2A 1PBTA 4BY9E 4MS3A 3REQB 1OBOA 2ODPA 5LQRA 3QEAZ 4ZAGA 5IW8A 1XRLA 5HZGA 1RPZA 1RZVA 3CZ5A 1OBHA 3EVNA 5I7UA 3ZBQA 1SKAA 4A0FA 5BPHA 3ANLA 1ZUIA 1N2CE 2AA3A 2H1HA 1P4HA 3EVFA 5EJ9A 3ASYA 4UDYX 1Q77A 4P83A 4WOBA 4NXNB 1AF4A 2EKDA 3GBVA 4GSYA 4AYWA 4DR6O 4JJ7A 2H8GA 3FKJA 3GDWA 2XOKG 4YJ3A 2XCIA 1JQEA 1UJ5A 1MQ9A 4HPXB 1WY5A 4E22A 1V6SA 3EC1A 1JG1A 1GWNA 3FJOA 3ZRVA 1H47A 1MUUA 1H38A 5IWAO 2H1FA 2PH3A 2K1EA 4FFBA 3RT3C 4M0EA 3LPAA 4YJGA 3K08A 1NVPD 1KIFA 1C41A 3T0IA 1K34A 3A58B 4JAVA 5DI9A 5TEWA 3AV3A 4CR6A 5ARBA 1NU8A 5DYIA 4B6EA 5H9WA 5D1NA 1ZH2A 1NXOA 4PRKA 2OM2A 4H7FA 2V96A 4MYRA 4DA8A 1LDEA 4R1PA 5ITWA 1U80A 3CLTC 3U16A 1UQUA 5GW7A 3OUTA 3I7TA 3UOAB 4ERHA 4RJKA 3THOA 3RHZA 3ZDAA 2XECA 3KPVA 1FXWF 4JQCA 1NJFA 1VQOF 4UQLA 2N0SA 2OL4A 3UCEA 2OEPA 1F0KA 3C4QA 1J7KA 3DR3A 1EFTA 3NBZC 1VQ4V 1XCMA 3TAUA 4DXHA 1RHRA 2QZZA 4G8BA 2GVDC 4QDKA 3A9UA 2RHRA 3UT6A 4GX2A 1P80A 1RHKA 3ZGVA 1SHTX 2XQFA 3UQ8A 4R1MA 1S5HC 3LZDA 4IMIB 1C3OA 2FPUA 2X2PA 3QE4A 4EENA 3RYIA 3G3EA 1VLZA 3RJZA 1XTIA 4HBZA 1H2KA 3MERA 4EY8A 1NIJA 2YVAA 4AG5A 1DUIA 3KCNA 3L8YA 3JAWA 1NVAA 2ODAA 4K6HA 4DV4B 2L6LA 3B1YA 3N6VA 5GVRA 3R7FA 3R7NA 3SQNA 3LD9A 2BKEA 1JY8A 1EXMA 2Q5OA 3BVPA 4WECA 5JRZA 5LD2C 4OP1A 5FTWA 3C9SA 3VPAA 4H44B 3ZXIA 3NUQA 2WNIA 3L41A 2LQTA 4NPAA 4OP3A 3WLSA 3C14C 4HDMA 5I7AA 2A1UA 4KQEA 1U2SA 2VS0A 1IE3A 4MVRA 2WBLC 4JHXA 5HCUA 5DDIP 5B1BC 1BXRB 2NTNA 2VHVA 5TQ0B 3EHDA 3QW2A 4BNKA 3X1MA 1VKZA 4HKTA 4OJYA 5JMPA 3TM4A 3TF5A 4TN5A 4AY4A 2Q0HA 1SHKA 4OFBA 1KB9F 4HTFA 1OFHA 5AXCA 2FSGA 4ZZ2A 2ORWA 4R31A 1A8PA 1IPHA 4NENB 2ZVDA 3LCRA 3UFXB 2GK4A 1E3LA 2WV9A 4OHCA 3QG1A 3LWNA 2FZLA 1QS0A 4MGYR 1C50A 3DKPA 4N49A 1JTEA 3FFTA 2X4IA 4BAGA 2ZXEA 5CVVA 2VF5X 5FKJA 4DKXA 3UM7A 1G17A 1ZLXA 2Z8YA 4MQ6A 1MIHA 1W2WB 4D9BA 5EBLC 4EB6B 2FMUA 3GZNA 3ZLJA 3P97A 4JI5B 1XOUA 4O4JB 4UCXA 3IOEA 3DE5X 2VEOA 1FQJA 5TV2A 5A4IS 3GGCA 4X45A 2B98A 1AJQA 4B3TB 4RW0A 1CU1A 1Z0DA 2PRZA 2HU7A 4F6LA 4JBLA 3UAGA 3M6IA 3WZMA 3X2EA 2UYHA 5IJ0B 3R3XA 4FBGA 4NYKA 1EGVB 3GCWA 4M53A 4FVMA 4EI8A 1W4RA 1VCHA 2FZVA 1GPMA 1KVQA 2VUIB 1T3SA 2FEPA 4RLQA 3T9DA 3ZGOA 2WQ7A 3JQ7B 2YY7A 1Q5OA 2HBYA 3WIUA 5JMTA 1CLEA 4G3XA 3KP1A 1C3JA 2EKPA 5IUJC 1R5NA 3ZDRA 4OLBA 3DOEA 2LNDA 4URFA 4FPPA 2FA9A 1KBOA 4COOA 3HTXA 2DPMA 1EUDA 2N3ZA 3PA8A 4CC6A 3CCQF 2OQRA 2AZ2A 1Z56C 4DV6B 4BNUA 4DV5B 1QC5A 2EFEB 3CUUA 1X13A 2CHUA 1C1XB 1R0BA 4LC9A 3L7OA 1U2RA 2JI8A 4AC9A 1CRWG 5L6LB 4A03A 1Q7CA 1E0JA 1G3MA 1D8TA 1NXTA 1HT2E 4W1QA 2AIRA 5HYVA 4IDCA 4LDZA 4DLBA 1E1DA 1MX9A 4D4LA 2QWXA 1AZTA 2UZ3A 2X5JO 2P3QA 4BGUA 4UTRA 1HE1C 3FCEA 3LUFA 2LCAA 2CNKA 1S2NA 1IBCA 4ISBA 1Y4AE 2OOSA 5EE0A 5EJAA 1KVTA 1E3JA 1UQRA 1U7DA 1WDTA 4B81A 1OLOA 1VCIA 1UFYA 4JZ2A 3KV3O 5H5NA 1GPNA 3DAYA 4A8JB 3GNTA 4V3BA 1UFRA 2OQIA 2OWOA 1DBFA 4ZOCA 3U1BA 2E0IA 3N53A 3PIDA 3OMXA 3FUCA 2B20A 3KB2A 3W78A 2NUTA 2Q3BA 1OYVA 3PA6A 4Y2XA 3EARA 2Y77A 2EX4A 4MQEB 3N8HA 4S1VA 2DYSB 4P4SB 3EQ2A 1XRNA 4WQMA 4NOMA 3VAAA 4CJXA 4S2EA 1T0JB 4I7ZB 1G7SA 2FPLA 2VPIA 1NVWQ 4WIAA 1ARZA 3QFRA 4FYJA 4IVPA 3I09A 2PMEA 3VNBA 1GGEA 4TL6A 3PXCX 3JATA 4B08A 2UYGA 1FKAO 2QVGA 1ZEJA 3H3FA 3IAM6 4UE3S 5KYGA 2UZ4A 3ELBA 4I5IA 3GBSA 3NDIA 3TEJA 2J4CA 621PA 1XQ9A 1KYXA 1LV7A 2CLSA 2HQOA 2XTAA 2JGMA 3GGJA 3PDCA 4MKFA 5ICCA 1WSDA 3KVNA 4QZVA 5FX2A 2R9AA 5B1AB 2YC0A 3U26A 2G5PA 3O47A 3EASA 3CRAA 3QVJA 4UREA 3F6PA 3RC1A 2VT7A 4MKRA 5B7NA 2LZ0A 2FWJA 1FMLA 2Q0SA 2ZAOA 4J7AA 4PZLA 2ACKA 3C3MA 2D2IA 2RK3A 5GANK 4DV2B 4XVCA 1N2CB 1X4TA 5GIPC 3WKDA 4CL3A 4ENQA 3RI3A 5CAEA 1AHIA 5KOJB 2J7KA 3ID6C 4X64O 1OWLA 2PX4A 4MEJA 3ZVLA 1JTFA 3AF6A 2AFIB 1WEKA 3CHXA 4X6UA 3ZPXA 3U6KA 4QUKA 1ZCAA 3PUXA 3WO1A 4JLBA 4P4NA 4LKRA 1QB8A 4N23A 3K5LA 1QIIA 1TJ4A 1R66A 1DWQA 1YASA 2I03A 3D5EA 3NO4A 4P34A 3S68A 1U8YA 4QQKA 2OIEA 3U9SA 1ZJJA 1P91A 1Y74B 1VKJA 4CMAA 1RKUA 2GSWA 5ARDA 1AMUA 1R2QA 3QH4A 3DEHA 3SIVA 3TBHA 1WZEA 3LL7A 3PL1A 2IS4A 5TF0A 1IAVA 2V0NA 3G1UA 1WR8A 1U8CB 2MR6A 5IDYA 5KREA 1LBEA 1OLUB 4IY1A 3U49A 4F71A 3KJEA 4B75A 5B3KA 2IE0A 4EYGA 2OCGA 5LBIA 4IEIA 4WN9A 4C8EA 3N70A 1YS6A 1TA9A 3A1CA 3DW1X 5KHGA 1N6PA 2VWJA 1HZZA 2I34A 1JH8A 1H94A 1NBMA 1V47A 2GBCA 5JMOA 2RHWA 4X90A 2ZYHA 5IX8A 3B09A 1Y4UA 2IYSA 4OAOA 5DBFA 2FVYA 3UWSA 2PD4A 3WP0A 5FUMA 1YS4A 2YJTD 1LLCA 4PO9A 4QAJA 3LWRC 4G0QA 4RKWA 1M34B 3JSXA 3W04A 3WL3A 1E0DA 4LZPA 2G28A 1FYFA 2WZDA 1Z28A 2XDWA 1CHDA 3T4EA 3T7KA 4IVNA 5C7LO 2J6IA 3PSHA 1OV4A 5IYZF 1D7AA 2INGX 2QP9X 4PBSA 3HG7A 3EDYA 1KEEA 1IBKB 1E3WA 4NNPA 3CMAF 2VDOB 3CKLA 3E9QA 4DBZA 1GPWB 4ZAWA 4KP7A 4FI3C 4AIRA 1S8OA 3KPWA 4EHHA 1EUDB 2JANA 4YXFA 6GPBA 1EHIA 1CR1A 1MEEA 1W5TA 2BZGA 3SDLA 2IE8A 3R6TA 3K0SA 1GNPA 5ALNA 2KW5A 1Z7GA 2PT6A 3F0FA 1P7YA 5H80A 1YOVB 2O2DA 1P0CA 2WF6A 2X3YA 5KTPA 2XA1A 4A2QA 1K6IA 3VPCA 3AVXA 2JVDA 1MGOA 2H18A 2YCBA 4C7VA 1UBJS 4RHEA 4NICA 3ELUA 4I6JA 1JFFA 2Y1FA 4LY3A 2ZNJA 1TUGA 1NQVA 2GB4A 4KXMA 4O59O 5A71A 1THZA 3PICA 3I3OA 1W0JD 4KQJA 4UHDA 1BDMA 1ZSNA 3K5WA 2RMKA 5A3QA 2I2BA 4FYMA 4N3AA 4Y30A 1QAQA 2FLWA 3KYBA 4QSHA 1ZH0A 4IVQA 3ZRWB 5AKZA 3E7DA 5DTQA 3LNTA 5IZCC 4WEQA 3D8CA 3AK4A 4GL2A 3CLTD 4TM7A 3K71B 1EFRD 1GZ5A 2O1SA 2F1RA 2W9XA 1ZGAA 3FFWA 4O4IA 3I3SR 3MLAA 4KN6A 4Z86A 4HFMA 2CLMB 4NBKA 4DR3B 5L3SB 3DCYA 1PDWA 1R9GA 4DAOA 3W4IA 4H7EA 4YJHA 4NYIR 5HKAA 4J7ZA 1JFLA 3KTOA 4MV4A 4CLEA 3P0FA 2WE8A 4DV1O 4DBLC 1TA8A 2OUKA 2CMHA 3CG6A 2X0NA 2H07A 2GZ3A 4KAAA 4A73A 1NS1A 3BREA 2IG8A 2NUPA 1PHRA 4BCCA 4CQMB 1U0SY 3L8EA 3GB9A 4UE6A 4CM1A 2PUEA 5EKUA 3PX7A 1ZX3A 4WEOA 1LJLA 2QMYA 3ANXA 4ZC8A 4I4TA 1KI3A 4OJNA 1YA4A 3OM3B 2AN1A 4CMIA 3RVMA 2IH1C 4IGKA 4IIDA 1YI2V 8ADHA 2YHBA 3LMKA 2E4AA 3QX9A 4HD8A 1E2DA 2YXNA 2J4FA 2HO4A 1Q6YA 1R0YA 2I6FA 3ZHBA 1GJRA 5ALOA 1TL7C 2XUDA 4ZCIA 5K6TA 1NKDA 1RWQA 2FR8C 2VOJA 2XCQA 3BHIA 4HLDA 2F43B 2CLFB 4PC1A 1HSZA 4WINA 5H7XA 4D6YA 3PPXA 1NQAO 1VJ5A 2Z4TA 2BISA 1O95D 3QY0A 2FN8A 2V7TA 3A4MA 4IIVA 3L8FA 3GUCA 4NBVA 2QD3A 2PI5A 1BRTA 3KUUA 3OFVA 4PTLA 2NAPA 4GNKA 1NNUA 4L5YA 4ZVRA 2JGKA 3G8YA 4L4UA 4R1UA 3QPAA 1VF7A 5FOSA 4LSZA 2B36A 2W37A 4KFSA 3U3JA 3MBMA 1UMCA 1HG1A 2AYYA 2XDYA 2QVBA 3AEQA 3PGLA 4IUCS 3QWFA 1NXPA 3HA2A 3NM6B 4BAZA 5LVAA 5M3BA 1EFAA 3G23A 3ZDXB 3KHSA 4TOIA 3UXYA 3U4DA 4DMHA 4JT2A 4BT5A 3C7TA 4CLRB 2W48A 1L7XA 3EWSA 2YIJA 4C8IA 3HAXD 1HF3A 3O9MA 4QGAA 5LP6B 3WMXA 4BMCA 5CA0A 5CBKA 5IULC 3U7JA 3WKAA 5AOAA 2BSKA 1K7XB 1HSOA 1DFHA 2FNAA 3NIGB 4JD5A 4NZZA 2C5AA 2V03A 5IAGA 2V7EA 3CC4F 4ZQHA 3CZAA 4BDTA 3DOIA 2WTAA 3IDAA 2HWKA 4UMDA 1GP2A 4M0KA 2JIZG 4F4UA 4DK1A 1YJQA 4ECEA 4UARA 5EMMA 1X59A 2WLLA 5EZYF 1EX6A 3ESQA 1SXJC 3QKRA 3OZTA 5FUVA 1ULUA 3DNFA 5CH3A 5EKTA 3SBDA 3ZY6A 4J49A 1E0AA 1H5QA 4BWAA 3DAOA 3OZ7A 3HVHA 4DAEA 2R5WA 1R6BX 4Q12A 1NFFA 2A5JA 2X5NA 1Q12A 4URHA 1HNXO 2CF5A 3L7CA 5H16A 4CKXA 4F45A 4AU1A 3BAFA 4MUMA 1UPGA 4M6WA 4QRHA 3EGIA 3OTFA 1XEFA 4YAWA 1XELA 5K99A 4JBNA 2A5GA 4JXZA 4C3ZA 3GFFA 1YZBA 4TQDA 1TB4A 1F23A 5ALUA 4RF3A 4CBCA 3WGMA 1H6AA 4RWUA 1JGTA 1O3YA 1OXMA 1VE1A 3MC1A 2BCEA 3QM1A 2J31A 1T25A 1PPJH 1T3GA 1FQOA 1WKBA 2PWAA 1DX4A 1QB7A 1ODKA 4IR7A 1W4ZA 3HGQA 4P4TA 3V4VB 1PS8A 3L1JA 2A8YA 2OAP1 3VPFA 1P7CA 2BOVA 1MTOA 3DLPX 3F5DA 5HUJA 1WPBA 3T3HA 3DLHA 1V5GA 1GCAA 2ODNA 1F2VA 1JLMA 3UM9A 2IS1A 1GA6A 3L5OA 2XMBA 2O8DA 1DAIA 3A06A 1PR5A 3LK7A 4G5FA 4R9VA 4GYJA 4F6CA 3ET4A 2VZLA 3APQA 3ZN2A 4DV7O 2HMVA 3O4IA 5EWRA 3RVPA 4ZI7F 1HETA 5EQFA 1IM5A 1ISFA 1M90H 1C3LA 1E3DA 1EFVA 2FVXA 3B38A 3FJ1A 4FGJA 4MITA 4MTLA 3VH3A 4A10A 1TFRA 3AEKB 1R4NA 3AXSA 4KQKA 4ODIA 3G71F 3UATA 1PCXA 4F4DA 1P7VA 1BVYF 3T7SA 3NBQA 5LSAA 2PZ8A 2RGAA 3HB0A 4BNFA 1MG5A 4LRXA 2W83A 5B53A 3VHRA 2JLYA 4B09A 2WHXA 1XL1A 1KMMA 5IM4A 2O7NA 3BXFA 3VI3B 3IULA 4UASA 2FPPA 3NVMB 1V9CA 3HDJA 1F1BA 2HNAA 3WXMB 1OJLA 1MENA 5J4LA 4REMA 1QH1A 1YIDA 1WSWA 5YASA 2A1TS 4POAA 3W6NA 2O5EA 2B3DA 1QHHA 5ALVA 2YYZA 1YB4A 2ZVJA 1FPMA 3QEKA 4RORA 4TS3A 1GV1A 2H1IA 4V38A 1DBWA 4QPPA 4YNBA 3JQRA 1REQA 3KUDA 4JJFA 5T8KC 3EQ9A 1FIUA 1VEWA 1XF1A 2O0HA 5TF4A 3TW8B 3RAGA 1XV5A 1C9EA 2XWPA 3DG9A 4CFZA 3EIOA 2JFZA 4YLGA 3C5VA 2FK7A 4M83A 5AM2A 1XWWA 3LTEA 4CS2A 1SO8A 1LTHR 3KS9A 3T1HB 4F86A 4ZEMA 2QPAA 3JZMA 4YROA 4ZA2A 2XSZA 5JJNB 3SDBA 3ZH9B 3T7TA 1Z0SA 3GEBA 2NMVA 2R6JA 3I53A 3QITA 2ZPAA 4FDVA 1PJAA 4LNHA 3TLZA 2OZPA 3P9CA 3FMOB 1HC7A 3NHWA 1BE1A 4DR7B 1E6WA 2EF1A 3DCNA 1IDN1 3E5RA 5EINA 5A4KA 3ET5A 4O3MA 4RJTA 3HZZA 1ZUNB 4LNAA 1EM8B 3AHEA 4V0KA 2OTJV 1XVTA 1Y3AA 2LFRA 1GNRA 3SG0A 4O0MA 5BR7A 1N2EA 2EZ9A 1EWQA 1YJBA 3RYTC 4DYLA 2XT0A 1L5FA 2R6DA 2XYHA 3R3HA 3AEIA 4JI5O 2QRVA 3GJYA 3UK0A 1OH8A 3N27A 2YZKA 4Q01A 3LOQA 1X3LA 1UZUA 1X7YB 2AJBA 3AH8A 5IM5A 3UFXA 1KZ4A 3G2OA 4K6CA 4NCAA 3BJZA 3IR9A 5B3SC 1JIXA 1QLWA 2ZM6O 2OPBA 2QL5A 1WPGA 5EO3A 1AK1A 3HDVA 2AOWA 5DGHA 1XL4A 2HK6A 3HHEA 3LUJA 1OCRB 1D5WA 1Y7IA 5AUQA 1AF7A 3EF0A 4P58A 4AO6A 1DOHA 1KEPA 1T9GR 1V5IA 2XUOA 2ZRFA 4CV1A 5KQLA 1MIOB 1YZ3A 3CD6F 5TGTA 2QMUA 5BN5A 1EKXA 1E60A 3DDHA 3G89A 4S0ZA 2WT8A 3JATB 3TAXA 4UPEA 4CGYA 2PY5A 1JWAB 1YJ5A 4FFLA 4BMVA 2O5CA 1E92A 1Y9ZA 1SRYA 2PMWB 1BVUA 2BAGA 2X6BA 4AHCA 3P32A 2ZDIA 2VDLB 2J5BA 3S1LA 4FZ3A 2P06A 4MQ4A 4GOJA 4KCGA 5DCWA 4CCYA 3FYCA 4HBNA 3PNOA 2WF9A 2DHQA 5FL7D 4PLGA 4XWTA 3SP1A 1SETA 1FSSA 4FW8A 4M1SA 3IEWA 2O2JA 4RD3A 1Q57A 4OFXA 2LW7A 3IILA 3CCUF 4FN5A 3I6BA 3IPCA 4DARA 4OQNA 2C92A 3VGPA 3FF1A 4WLUA 2JFOA 4LJKA 3WGIA 5EP3A 2D5IA 2YWFA 5DTIA 3RYFA 3VI4B 3CPJB 4X8MA 1L5NA 3YASA 1TVKB 1IJFA 2B3TA 1U7WA 2GRJA 1YITV 4J3JA 5AKGA 4BB5A 5K3OA 5IT9N 3B85A 1T5SA 2ICAA 3HNOA 3GARA 4DBVO 1P44A 4W8HA 4W9RA 3ZEDA 1M2OB 5C5CA 2NZVG 3ME5A 4PX5A 4EG7A 2E5FA 4RWZA 2OZLB 5DHFA 3NFRA 1QZTA 1Y3BE 4IJUA 3EW7A 2R3SA 3U39A 3MAQA 2YYEA 1P0IA 3R1IA 2AH5A 2AR7A 1Z4LA 1QU9A 1OHHA 1VBMA 1ZS9A 4NK5A 3RU9A 2HPAA 3M5DA 4JR0A 2ONJA 2VP0A 4WJLA 3WLAA 5EJGA 4TYWA 2WJ3A 4HQNA 3A9VA 4I66A 4KZKA 3FFBA 4QPNA 3DHEA 3MTQA 2GOYA 2YXEA 5IBQA 2F7SA 4JF3A 3OZRA 4RD4A 4QUAA 4BN0A 3KQOA 1YUBA 1JFVA 2W2NA 3IDFA 3DUFA 4L74A 2IPNA 2VP3A 3VU3A 1ZZGA 2PLAA 2UKDA 1DKNA 4A8JA 3CJHB 3R9WA 1Z06A 4CTKA 3LE8A 4EO4A 1G6UA 3PSAA 5E1OA 3SNKA 1BIFA 4KPYA 3DWEX 1S72V 4HNHA 3UJDA 2H8CA 4XUEA 3JYOA 3B52X 1CB7A 1Q7BA 3K20A 4X24A 3BK1A 4DVGA 2FSPA 3CCQV 2GXUA 3C8MA 3EY4A 4NOLA 2OV2A 4RIFA 5JZ9A 5HKOA 3OMAB 1D2MA 1MRZA 3LY7A 1GO0A 1KJNA 3NOOA 4Z3OA 1I2AA 2QVCA 3SEFA 3BXPA 5HMMA 1KSHA 3P9RA 2G5CA 5EE5B 2M2IA 4EFNA 2QR4A 2E4WA 5I4BA 2XVAA 5I7FA 1DV2A 3RQSA 5K2MA 5FWNA 5JWRA 3KSMA 4HH3C 3HVKA 4KB5A 4ZZ1A 4OK3A 2WJAA 5AUOB 5HWSA 4QECA 2CH7A 1K63A 1B6RA 4YWHA 3USES 5F9FA 3NK6A 4ND6A 3IVMA 5FBKA 3RRYA 3E3AA 4LAFA 3UPUA 3LT1A 5KYUB 1RAHA 4CQLB 4HYEA 3I2KA 2FG7C 3MIIA 3BDIA 3EVCA 4FX2A 2IYOA 4Y6SA 4HUTA 2WM8A 2NO6A 1JALA 1ZGBA 3BMNA 4MCIA 2ZE6A 2BONA 4FFMA 3RKSA 3T61A 1IIBA 2G9UA 2R00C 2Q2WA 5EL0A 3TLYA 2JAPA 1PK9A 1VMGA 1QGDA 5DWDA 4O2AA 3R3VA 2AKEA 3D8RA 2PBRA 1C9MA 2JIOA 1D2DA 3PTLA 4PC2A 3CU5A 2BN4A 4M8LA 1HDIA 1RFLA 1ML3A 4MW5A 4N03A 1IQPA 3EGWA 4WZAE 1XDBA 3G4SV 1AUPA 4JC8A 4LJ6A 3AB8A 4RZIA 4UV9A 1H93A 1RYEA 5L7WA 1KZYC 2NOAA 2X8JB 4IOLA 1WVIA 2W2XA 3EIHA 4N0PA 1FFBA 1RKVA 5BQ5A 2V1UA 2AFIA 2DLNA 3IVRA 3KSDO 3SBEA 5M29A 1PZEA 1SEPA 1ZK2A 2JI9A 4JYMA 1K9SA 1URFA 1A88A 2ZR7A 4KR9A 1PL6A 2RMKB 3DO6A 5CVEA 5E8JA 3A9WA 3FMIA 1QYCA 3LFTA 4HI0E 3VYSC 1ZN8A 2GTIA 3OE1A 1A5TA 4R7CA 2PVCA 1YDWA 3MWDA 5C8YA 3UT5A 2ZBGA 4TZTA 4R7GA 1D07A 3I9V1 4E1AA 1MSWD 2PUFA 4CH5A 4X1YB 1PNVA 1K75A 1Z2PX 2CZCA 3M4JA 4P98A 3TN7A 1M54A 1A76A 2BM0A 3E18A 1IV3A 1K3EA 3U6BA 1TUBB 3EEIA 2YV5A 5IBRA 3ZW7A 4BVTA 5CPFA 1U0LA 4AJEA 4ALIA 3S0HA 4OBEA 5EGNA 4LC0A 2W2LD 3JZDA 4CXMA 4LRQA 1LBHA 3C6BA 1RPNA 3ADBA 5AT1A 1VQ5V 2GLZA 3OMNB 4ZV9A 1VLVA 2HA4A 3PCXA 3TSWA 6YASA 1Q8RA 3VYUC 3EFFK 2EHJA 3FWYA 2F8LA 3H84A 4QLOA 5KYVA 3F49S 2DT8A 3K53A 2XVZA 4FDTA 4PCVA 4JH0A 5A3SA 2XQIA 5AKYA 3CRCA 4GM4A 4IEEA 3SM9A 4HH4A 3TIVA 1FMFA 1UBSB 2YW9A 1PZMA 1J0EA 2GPJA 3GUYA 4K1LA 4KN9S 5FA6A 3URKA 3UG7A 1X2BA 3EXG1 3K12A 1R3KC 1EP1B 4H3VA 2E82A 1U28A 2HCFA 2R70A 2X0LA 1U5CA 3LDEA 1MA0A 2XADA 3AINA 3QVSA 4QWMA 2WALA 3VR2A 3I5UA 4QC2A 1HURA 1KMIY 1YAHA 1KO7A 5DYWA 5I7OA 3W8NA 2WJGA 3RFTA 2WWHA 1RMTA 1QOQB 4LJ7A 2RCNA 3LKDA 5HIAA 2YMLA 5JQGF 1DUVG 3BOSA 2KSQA 1N1DA 1YR8A 2LP4Y 4DQ0A 4DB2A 3RSHA 1XZGA 3WJ1A 5EE9A 3TLGA 2C5FA 5K0ZA 3VAYA 3ZI7A 3C5CA 1FUEA 1KJWA 4EJSC 4G84A 4GKKB 1U1IA 2DZDA 3AI2A 3EXHB 3G9TA 3FPIA 5COQA 1XZ8A 1NG9A 1NW8A 1YDXA 3OW2U 2HAEA 2QR5A 3W7BA 4LF8B 3D81A 3WXBA 3RAFC 1USGA 2I9PA 4V39A 1C7EA 4RY8A 3FMFA 4WNYA 1WBJB 3VSDA 4IJ6A 1DIRA 3OZVA 3DWGA 4WACA 3B89A 2QTMA 5IT4A 1DG3A 2W6ZA 4R98A 3MJCA 1YV9A 3THXB 1QMGA 4X3CA 5E6UB 1N7JA 5KVCA 3V1TC 4KBFA 3MRXA 3RRJA 1QHSA 3P10A 1Q91A 2W0SA 4ZRDA 4Y1FA 5ECYA 2W6IG 4YRRA 3C6KA 1C80A 3ZIAG 1MNGA 3NUGA 3WDSA 4RPKA 4LDRA 2R4TA 3JTMA 4J9ZB 4FGZA 1GGMA 4ZZIA 1GK9A 4QEZA 2FDCA 1JHUA 4G6ZA 5BVGA 4ROTA 2XAHA 4LF4B 1G38A 3U2QA 4JI6B 2GBGA 3PGXA 1RNLA 5BNWA 2QZSA 4J0KA 1R3JC 5E7JA 3UGKA 4BB6A 4I1RA 3CZCA 1PUIA 1TT5B 2WSSD 4Q3LA 4V0OA 1IXYA 2IH3C 3HS3A 1Q2UA 3Q3VA 1SXPA 4K8ZA 3HWX1 2E5LO 4FWBA 3CEJA 2IYZA 3IA2A 4J43A 2UYOA 1FXKB 1LTKA 4MUIA 5B3JA 4IJQA 1C0IA 3N8NA 3SZLA 1D0SA 1FW8A 3O2JA 2DR0A 4OB8A 5BOSB 3HDTA 3N87A 4NZPA 1VLLA 5CXSA 5BOVA 2VHQA 1V3QE 1ZINA 3S55A 4XRGA 4C2TA 1EZ1A 1OZAA 3K5MA 5BV2P 1L1FA 2VHZA 2VNHA 2ZI9A 3QUAA 1BHBA 1EK6A 2FR8A 3HUEA 1NVKA 1KPIA 3V7QA 5AI8A 1YBHA 5ALJA 1JFTA 3L0YA 3BDVA 4M9UA 5FP0A 3IURA 3PYXA 4MVXA 4K2AA 2AG8A 3TJMA 3JAKB 2AZ4A 2F23A 4D4KA 1XMQB 3B77A 1AN9A 4P7KA 3WQBA 5IKXA 2V7GA 2FFJA 3BILA 1ILEA 1SPXA 1EQUA 1YZNA 1QRDA 4CHTA 1WRBA 3EVAA 1B93A 4K0KO 2ZXUA 2PZAA 2HQRA 4OSPA 1T6NA 2L69A 5BR4A 2LUOA 3OLYA 3QELA 3CZPA 5THQA 4EZIA 2YJNA 3K8YA 5FWAA 3WYEA 1J2TA 2BP7B 1Z17A 4YY3B 1C0LA 1J0DA 3F9CA 2WZQA 3LPCA 2B5OA 3UB4A 3PEFA 4DJDC 2Q8NA 2YJ3A 1ZK1A 4NESA 3LVFO 3AUFA 2YINC 3DFMA 2FG6C 1ISHA 3O8OB 1EVJA 1H42A 1B6QA 3MTBA 1J22A 2EXXA 2H63A 4PNHA 3THWB 4M99A 2WLKA 4Z9XA 3X1WA 5FNVA 3GCZA 3DQQA 1P4SA 5FI1B 3R5HA 4ZEVA 2W0FC 2DKFA 3CLVA 1IXKA 3H9VA 2BSKB 3G6EV 4L75A 2QVZX 4RVNA 5LKRA 1CZKA 1V95A 3FSGA 1H2FA 2QDOA 3B6KA 3WXMA 1RDFA 2AQ8A 5MF6A 2JIDA 4WWHA 1W0CA 1BKYA 4ZYWA 2JFBA 4BKMA 2ZATA 3GY0A 4BN4A 1AI4A 4OLHA 1XMJA 3GFPA 4L78A 2X9GA 4P1ZA 4HF7A 4IHQA 2WM3A 1KI1A 4GYYA 4KAJA 3R09A 4X94A 4DR5B 3HYLA 2F9LA 4NABA 4XDLA 1ENYA 1S1CA 1BKSB 3IPRA 2H8KA 1S5LZ 3S2IA 3ABTA 1FFCA 4GZLA 4E7PA 4R5HA 4MSWC 1YRLA 3MCAA 5C37A 4OLAA 4F4LA 4LV5B 5IK2A 4ZGBA 1E79D 5AKIA 2UYJA 1AC5A 1G8AA 2QP3A 5J2UA 4UEKA 4B4UA 3BE5A 4GUNA 3IAS6 3ESXA 3PD1A 5H8WA 1ACMA 3KEOA 2A33A 2AV6A 1Q1AA 2EIJC 4M36A 1DIGA 1N77A 3V8RA 2XNCA 4FOTA 2I7XA 1K8QA 1R4ZA 2QNBA 4PYLA 2O8VA 5CT8A 3DA8A 5GM1A 4AULA 4CV0A 2DFNA 3ZDCA 4DRXB 1XMOO 1RFGE 3QVLA 3C6XA 1SXGA 1X1BA 1O97C 4NMHA 5B36A 4P7GA 3PR3A 3ULKA 2F9MA 3A6DA 4TTTS 4B3SB 4EHNA 3FYTA 4JT8A 2MK3A 2PLNA 5EJ4A 4HQRA 3L4EA 3CP1A 2PZKA 1R73A 1E2JA 1EDEA 1MHPA 3D6HA 4HEQA 7REQB 3UJCA 4CEIB 2G8LA 5K3CA 5C1BA 2NU8A 1D2AA 4BC0A 3MILA 5GZ3A 1JNXX 5HY2A 3BJMA 1QFXA 4NZ9A 5JARA 3H9GA 3UV3A 1WPXA 5G0SA 3RGWS 3HR8A 4EY3A 1FYDA 5A7GA 2QB5A 3ZWKA 3C4VA 4FYPA 3WDLA 1PGNA 2WP8J 3ZBPA 3VKWA 1Z33A 4TLDA 3KTAB 1M8GA 3DNMA 4BECA 3I04A 2Z6VA 3OQHA 3QYJA 4J0GA 4QVGA 4LA4A 4Y18A 4ASUD 4J7JA 4C7JA 1KI2A 1VL6A 5CFMA 3NVDA 4YXWG 1GGJA 2O0MA 1LU9A 2WFLB 4OJQA 4DW0A 5AXBA 2BGTA 1O5IA 4GLLA 2JNBA 3S5UA 1I14A 4UW9A 4WBNB 4AD8A 1DKMA 2TMGA 3AGPA 3QA9A 1KPHA 3L05A 1OT3A 4NF2A 2J41A 1IV4A 4E15A 5DEIA 5M2QA 2Q2QA 4Q3BA 3ESJA 3VQXA 1KR2A 2JCBA 3UO8B 1E2BA 1W8DA 1N5IA 1ZNZA 3ZE2B 1BW9A 1I6MA 3QBTA 2AX3A 2CLIB 2P27A 3UK2A 3T1TA 3F7YC 1ZN9A 4LG1A 1EK1A 1QCYA 2V6IA 4B3FX 1HYBA 2P8JA 4UVHA 3OIUA 4UCVA 1T3TA 1FUUA 2IS6A 2WA4A 4TXNA 4CNBA 3AJDA 1NPDA 3F47A 2PMPA 4FE7A 5CYOA 3DE0X 4EDFA 3EJWA 2YQ4A 1S9HA 3HR0A 1M1YB 4FLUA 3OU7A 2H5EA 1BQEA 4MLDA 4ZALA 2YW2A 2RAUA 1W9HA 2Y1WA 3QFCA 2RGEA 4HDCA 2JIBA 2QENA 3K94A 4R8RA 3JQAD 4JC4A 1D4OA 1FFHA 3HJUA 1C7ZA 1FP4B 1RLTA 1UEIA 3ZWPA 1IIRA 2LGQA 4GKAA 4RK7A 3WA6A 4YRKA 4ND5A 1FS5A 2HRZA 4K9RA 4M9QA 1H9AA 5JOQA 3PQ6A 3CGWA 2QMZA 1D4AA 2R7KA 3GLFA 2G0TA 3IC9A 4G2KA 1CY2A 2J3KA 2O3SA 3G1TA 3KTFA 3R0ZA 5CIQA 1JILA 4NZYA 3DTUB 5DK4A 5JTTA 4MVYA 2D1QA 3GUZA 2BV3A 2YXPX 3AP1A 3MRSA 4OM7A 4PSUA 4TMXA 3AWDA 3L7AA 3NHZA 3OZAA 3AKEA 3SR4A 1OOEA 3BJRA 5L4LA 2ZTLA 4MO2A 2WSLA 3OZIA 1E2IA 5KA6A 2RAPA 5EXSA 5F7XA 5KPDA 2OO3A 1DBRA 3CT6A 4AB1A 1Z74A 1DJLA 2O06A 1XNGA 3AG2B 3QBVA 1XB2A 1NVUQ 2D1YA 4NWIA 2PZBA 3N9IA 5D87A 4BV2A 1DAFA 1GUFA 3O26A 1ENPA 1QAOA 4PYNA 3AEUB 3GQBB 5SY9A 3HUUA 2J46A 1ZDMA 4IFTA 2FCAA 4LRUA 4J9VA 4L8JA 6ADHA 2NVOA 4E03A 2J0SA 3C4JA 4LMAA 1TM1E 2C5GA 4AICA 5J43A 3C7DB 4DY6A 4MWZA 1OCOB 4LRSB 4QYXA 7YASA 3TL3A 3G82C 1SUPA 2KB0A 2TYSB 3D0QA 1NLMA 3R9XB 4JI3O 4UCWA 2IOFK 4EA6A 4JITA 3IDSA 1MDFA 4EKIA 1XGKA 2R7NA 3EXEA 1H23A 4CM9A 4RGQA 1NDHA 4J80A 1G21E 1IWPB 1XUOA 1T91A 1DCKA 2X8WA 3L1UA 3LP6A 4EI7A 1C7JA 2X8LA 4FX5A 1LNSA 4JT4A 4QUJA 1IATA 4TVKA 1AE1A 3GP5A 3WTBA 2G36A 4GOXA 1Z4IA 3KAQA 1V11A 4P9OA 3IR5A 4Q7EA 4A6PA 1IBRA 1OYYA 4AP5A 3ETCA 3U62A 4ZAZA 2MYUA 3B6EA 2BJVA 2NADA 4EFLA 1TF7A 4CMKA 4D41A 2AGAA 5FWXA 4G67A 3SJZA 4PDVA 3H16A 3WB9A 2J3IA 1N92A 1VJRA 3FYSA 2EINC 2Q5EA 4BLQA 3A6HA 5SY4A 2Q9UA 1NTOA 3I1IA 3PU6A 5CX1B 5E1BA 1TVMA 4ZICA 1N5RA 2F43A 2X9QA 4RQTA 3N8DA 1E2KA 1QYIA 4IGFA 4LR3A 1QKKA 3KEGA 5A7HA 1JYSA 3TDNA 1Y8CA 5AW3A 1MG0A 1NY6A 3LO8A 4BJ5A 1RIFA 4RPGA 4ZCQA 2DHDA 1WLYA 2WJ4A 3MHSC 1V1RA 2NT3A 4RSMA 4UMFA 3BFVA 2I4OA 2J3HA 2O2GA 3BERA 4FNMA 4YJFB 1T3HA 3AVYA 3WK8A 3HSYA 3N2KB 1KHTA 4JL5A 5I7VA 5K3DA 1YQ9A 5KAFZ 4M1OA 2EIKC 4JI8B 3TTVA 2VP9A 1KBQA 3GVCA 1KECA 1QCCA 5F1YA 5E6RA 3TQSA 4ZDKA 3IA7A 1DC4A 5L3QA 1S1MA 4DJEC 1D3AA 2JFHA 1CKEA 2H31A 4OHXA 5A9SB 3U7FB 2DW4A 3QJYA 4K81B 4OHYA 3MMXA 5IVPA 3UWMA 3QUBA 3O8CA 3AUAA 1TW3A 4GSLA 1M1NA 3B6MA 3HCDA 1XYVA 4NEGA 1PR3A 3C9UA 4NCHA 1FRQA 1G7TA 4CM4A 1QV6A 3EEQA 5DGIA 1U2TA 2ECKA 4D44A 3FLAA 1MVLA 3H5AA 2AG5A 3CLRD 4E70A 2K9PA 2QTAA 3ORSA 3ABOB 5J63A 4JC0A 3I2IA 2VDNB 1RHQA 1CUHA 1RRFA 4BMZA 4F2HA 2PA0A 2Y69C 3TQQA 2KG7B 2A88A 2K4MA 2PFGA 5JY1A 2IYAA 5JO9A 1OJ7A 2P7TC 2EU8A 1EP2B 4JSTA 1HOXA 4JY7A 2BI7A 2HW8A 4ESOA 2P67A 4Q4AA 1FYXA 2O2XA 4X7MA 4KPFC 3VHQA 2YZ2A 1S3JA 3G0BA 3H2YA 2FTKA 1OX4B 1N0IA 2GCIA 2B34A 3QLVC 4JFRA 2IV7A 3BCSA 2A92A 2QRJA 5ILGA 3H5VA 3BHPA 1ZGGA 3K30A 4BKUA 4R7ZA 4OHWA 3UHAA 4JLWA 3D5QA 1TYEB 1DEXA 2CDCA 4BE9A 1R8QA 1QO9A 1EE1A 3IKEA 1YBMA 4WY5A 1GGKA 1C8LA 1UDCA 3V8BA 3KXIA 1YS7A 3GL9A 1KI4A 1J0XO 5DT2A 5K0NA 3QNMA 3EZ2A 1UFQA 3WSTA 1FDOA 5BY1A 2IEBA 2Q27A 1RADA 4ALLA 4BEWA 3A2MA 5HF6A 5FO1A 4UM7A 4Z53A 2CFCA 1T4DA 1P2DA 2C59A 4QJ5A 3JRNA 3K79A 4I46A 4YUXA 3J80M 1OUMA 1YA8A 3CRMA 4BO3A 1DBIA 3FI0A 1TNDA 1U4SA 2VGNA 1X1DA 4TKZA 5JY6A 1QP8A 1L0LH 3E9RA 3NWPA 5EHGA 3O5AA 5JAMA 5WRFA 1CEQA 1MRNA 1VL5A 2FK8A 2IJKA 5TISZ 4B3MB 1PLJA 1SVNA 2Y8EA 4P22A 3SFZA 1IB6A 1GLNA 4MW7A 3BIFA 4MKIA 1U65A 1WDWB 3HFRA 3AEUA 3GQBA 2C0QA 4UU7A 1U8ZA 4UU1A 1QLNA 1K9MH 1IX9A 4EUHA 4OMCA 4XTRA 1VQLF 1DRVA 2JAQA 2J5RA 3A1EA 4RIIA 2NV2B 1GEEA 4JUIA 2IYRA 5ESDA 1Z3CA 2C42A 4N9QA 3O3NB 4Q3EA 3UNXA 5IF3A 3VJRA 2NSYA 1C4WA 2A67A 2XNSA 2ZTHA 5AVVA 3EN0A 2ZF8A 1BROA 2IEZA 5HDQA 3MQWA 1LV8A 4LNUA 2C2ZA 3VTFA 3GWKC 3ZV3A 2JI4A 1Z0KA 3RRNA 1I7DA 2CL5A 2GNAA 2R86A 3T8YA 3S7ZA 1JXOA 4LFAB 4TMFA 3JQ9A 4EGSA 2IXGA 3ETEA 4JP3A 2ZIUB 4KDEA 2HIMA 4GR4A 1X1EA 3JQAA 4MHTA 1AURA 2D1FA 3OQIA 4X84A 1IRXA 3M2TA 5H1YA 2GH1A 1COWD 5JDCC 1DKLA 3JCZA 3GQVA 2ROQA 2WZCA 3FIUA 4J3FA 3R7WB 5KOJA 4UCTA 3ZMTA 1MNAA 3B70A 3VR4A 4QU8A 2Q9LA 3PC6A 3HUDA 1LPNA 4YJKA 5KUTA 5K3FA 1XJWA 4ZN6A 2G06A 4FZ1A 1GRVA 3H4MA 3LNNA 1KAOA 3PQEA 4HN9A 5BN4A 5CFOA 3EJ6A 5ICSA 4OF4A 3AUXA 1QYRA 2WTXA 4GUAA 2G04A 1F8YA 3UHFA 3EAGA 4BFSA 5HRAA 1YA6A 1RCUA 2GJAA 2QWRB 5I9SA 4EQ6A 5J4KA 3AETB 3RADC 3LWVC 3PLAE 3DBHA 4YIHA 2J07A 1Z5ZA 5JSZA 1PHPA 4QIWF 4WCFB 1N5JA 4CQJA 5JI2E 2C00A 2FOIA 1QO0A 3OAAG 1NT2B 1PVVA 3LBAA 3R24A 5K8JB 1JQJC 1DK1A 4F46A 1OW3B 3ZV5A 3DTVD 1XDZA 2ZBEA 3PD0A 3ZZ1A 2X1MA 4DM3A 1M67A 3A7DA 4QOGA 5P8WA 3O93A 4XFDA 2E74B 2J9RA 2ZJ0A 3WFZA 4QE7A 1NXXA 2GN6A 2I2DA 3OHSX 5T57A 3V1KA 2QMOA 2C2WA 3OIGA 2C9OA 3Q2KA 2WC1A 1OH6A 5E4YA 5HCIA 4J76A 4PLHA 1PNLA 1VSUA 2M6RA 2WOOA 1F8UA 1OKKD 2PYLA 3CPWF 1Z38A 1V3VA 5IT9A 2ATXA 2NTJA 4RE6A 2VJNA 4F9TA 1HL3A 3M6FA 1KFJB 4LMRA 2C2GA 5L3RA 5KTNA 1QC5B 5HP7A 1Z6TA 2B8NA 2CJWA 2D7CA 3H04A 4GWLA 1N4CA 2UZ1B 4DLWA 3ADDA 2F8MA 4XPIB 3RG2A 3B3JA 1CWUA 3B6IA 2ZSUA 4FMBB 4AF7A 5LCXA 3KHTA 1PT6A 1QGAA 4QFCA 4E3WA 3OFNG 3GJSA 4XCVA 5DCLA 2X3UA 2P6YA 1XD8A 4ZMSA 2YIVX 3FKSA 3H5RA 1E8NA 1J0AA 3GRFA 4W6QA 4LWPA 4HAVA 3H1LH 3Q3IA 4JYAO 1UBNA 3W5SA 2BI4A 1C9DB 1WZUA 2ZIOA 4JB2A 5ALQA 1SA0A 2I80A 1D6JA 4U6QA 3TXXA 2PD6A 5L3ZA 1KRWA 2G4CA 2DXIA 2P4KA 3WYFA 3WWZA 4Q1DA 1NONA 2F3PA 1H2BA 4MVQA 4WNCA 4KUGA 3ZHUA 3RSLA 1K4KA 1JDUA 3U7QA 1ZOIA 2HR1A 1JSRA 5LDGA 3I64A 3CCMV 2IXTA 5LOVB 2IEGA 2EAUA 3A0UA 3PRYA 5LDHA 2L35A 1NE2A 2HIAA 1OZFA 4LHWA 3OQNA 7MHTA 3K9LA 4GPTA 2VTKA 5IN5A 1WO8A 3VU1A 3WDMA 4I9NA 4F7WA 2FMLA 1AN0A 1L5YA 1QXSA 3KZ1E 3I1JA 2C2MA 4A0SA 4G1BA 4DLLA 4M0CA 1ULAA 1RWVA 1X7XB 1IV2A 1QO7A 1Z0AA 2GYWA 3DT6A 3L0BA 4MJ7A 3X1DA 4CLOA 1GZ7A 2PTMA 2YV3A 2E21A 5AVOA 5JHHB 1TQDA 4PPQA 2OZVA 4YJHB 1TX4B 3ASUA 4BIUA 4WXEA 3SI7A 2R9VA 2QBYB 2WKPA 3OFJA 2JIZD 2WFLA 1RTKA 2HRQA 2I76A 3DEJA 1DEAA 3C5WP 3Q5EA 3I37X 2OTCA 3NK7A 3COYA 3TYXA 3T7AA 3K06A 3P0ZA 1MMFB 3F6RA 4NJOA 4EJMA 2JFNA 1FNNA 1WG8A 4QPZA 1MAHA 1KAHA 3FPFA 3LXUX 5IUNC 2PR7A 4LHZA 3IQXA 4KVZA 1K27A 1XG5A 4BEJA 1UAAA 3ZDFA 3LY8A 3TINA 2CV1A 5A2QM 4WMLA 1WV1A 3GH1A 4JLKA 3WIOA 1K73H 2AJDA 4L28A 4RV9A 1OILA 4WBSA 3SXPA 4HRXA 5C8XA 3PJRA 1O8CA 2WMYA 3FWZA 4MUYA 3FD9A 3HLTA 4E0BA 4J0EA 4O33A 3M6WA 3BF8A 4FFBB 4HADA 4TKMA 3E22A 4QXMA 4QXOA 1FYVA 1DDOA 1TQ4A 3RTDA 3TZKA 1QP0A 2ZVYA 1T6ZA 1I3LA 1N6LA 1ZM4A 2AG0A 1DGQA 1UWLA 5KSPA 4X7BA 3RS3A 3KOMA 1W9MA 2AFRA 2FWRA 3KKLA 1J2UA 4O29A 1CBUA 3T5TA 2CL6X 2IYFA 4XR9A 4KI7A 5KS2A 2WKQA 1V9PA 4X64B 3H1GA 3H01A 1C7IA 1R8YA 2E49A 2EKZA 2AW5A 4Y67A 1BEEA 2VHXA 1I5RA 3E05A 2L26A 1IQUA 4CV2A 3D36A 4RVDA 4BMSA 3GCXA 2JLRA 1YKGA 2F4VO 1KJJA 2NUAA 3HLKA 3NI2A 4GC5A 4QU9A 2F1MA 3OLQA 1GADO 3SYKA 3R7WA 1UXKA 2AFHB 1N3BA 2DUNA 4K87A 2J0EA 3B9RA 2DUMA 2XZPA 2FPSA 1OC4A 1DKQA 2UUAO 2R1VB 3R66A 1PDOA 3GJ3A 1BE0A 3MUEA 4LE1A 1YCFA 4LJ9A 3L6BA 3L7YA 4N0QA 4TXLA 4B9AA 2GD2A 3WC4A 4RIEA 5DBGA 2HCJB 1E5LA 2FZWA 3G2LA 4ICIA 3TX2A 4OPAA 4GGPA 2FLKA 2Q6KA 4GQBA 3UA3A 2WKWA 3MJSA 4RVUA 1FRFS 4TVBA 2UZHA 1HNZB 1VZ3A 3L6UA 4HRAA 5DE3A 5J5AA 4Q1AA 1J06A 4FBMA 2X13A 2XITA 5H6RA 3I6YA 3L1IA 3IEVA 2BTQA 4AJ1A 5DWVA 3JASA 3VBEA 2P0YA 3QHQA 1AO3A 2YVUA 3TR6A 4Q7LA 4PYJA 5LBTA 1CRLA 1H5NA 1LX6A 4I1SA 1ZH4A 4LSGA 3B3AA 4X8OA 3QSGA 4XVHA 4U6SA 1QG6A 3GRUA 5L8VA 2EIJB 3OT4A 3QTCA 4NENA 2ZJ7A 2R9RB 1WMSA 2JRLA 3D6JA 1TAUA 2BJHA 3OJXA 2OLEA 4RAIA 4IO0A 3ZCPA 1X8KA 2KLBA 2VZ8A 1E9CA 1T43A 3EGDB 3PUWA 4RZUA 1GLVA 1ODFA 4HDOB 4HX2A 3SZUA 2VPTA 1UC8A 5TJHA 3Q7RA 3WQHA 5AXDA 2W6QA 2X22A 4EGAA 1NBMD 1YRQA 2VJKA 5KC8A 3OQ1A 1VYUA 4BO0A 2XNDD 2DTEA 1V11B 3OIFA 3SSNA 1B76A 1LF5A 3CNLA 4FI3F 4DUZO 3NBMA 2DE0X 2HHAA 2PANA 4NJMA 5BYAA 2BM8A 5CU7A 1GAXA 1G21B 2Z3WA 3MTAA 5A4MS 3PC2A 4KXNA 2ZRLA 1SQXH 5JJIA 1EFUA 2JIRA 3C1OA 2H2DA 3R0QA 1H3NA 3NBFA 1E7SA 3EODA 3LBNA 1E6LA 1EFDN 1N6NA 2NZXA 3BGVA 4H6PA 5JXWA 4MP8A 2PFKA 4C4YA 3NDPA 1O6GA 2QAJA 3GYQA 1XO1A 4Q1FA 2Y4TA 1NV8A 3TNLA 4KSYA 3WLJA 1G7CA 2E4UA 1DEHA 3HE3A 3D3QA 3DDNA 2GZHA 1CNMA 3LFUA 1Q82W 1ETHA 4BRWA 1FFXB 3V6LA 3P0HA 3AG3C 2BKVA 1CF9A 3C41J 3JSAA 5G3ZA 1H5UA 1BHAA 3GHYA 1G4UR 2ECFA 1MCZA 1M74A 1JMKC 2BTUA 2XRFA 1HEIA 2IHZA 2UV8A 4LY0A 4LYFA 3MYRA 4M0LA 3WL4A 5D3MB 4AP9A 3E03A 4EHFA 3MS7A 5K8CA 5KDOA 1NKTA 2OB2A 3NIDB 1UBMS 3GLGA 2EW2A 3ZE8A 4P3OA 1L7QA 3AG6A 2PJRA 3PJSK 1ECCA 2GF2A 2JARA 2W6ID 4UUPA 5CNKA 4CQMA 2DWUA 3VPSA 4XQCA 1M7BA 3NCHA 4WERA 1H4QA 1ZMRA 1JE0A 1S7CA 2DKOA 1H2HA 1OCZC 1P2VA 3RRFA 5C1PA 4X85A 2OTJF 1UT6A 1U31A 2DPLA 2R1TB 3GT3A 3DMTC 4RFSB 4QM6A 1YZTA 1WXEA 3EMKA 3G79A 3OHPA 4DC0A 5L3DA 2AXEA 1ZVJA 3ETHA 1LDYA 4HGQA 5E0KB 5HQTA 5E1AC 3QHPA 1SQ0A 2OCBA 2ZSHA 4PPGA 4HB2A 4HQOA 1JQAA 2O8EA 4QBTA 3W5JA 3HZRA 3MWDB 5JFGA 3WG7C 2ANCA 2IIPA 1O57A 2I2AA 3AZQA 2HWUA 4PV7A 3DJYA 1HEYA 3I45A 1UBLS 3IUPA 3MTEA 3OF5A 4KIUA 2X4GA 5ELMA 4XVQA 3A1TA 1UBTS 3IAFA 3OOWA 3OQJA 1BGWA 3W9SA 5LP6F 4CM9D 3HXTA 1EFPB 1W85B 2KI5A 1XPOA 4QQRA 4TWBA 5T64A 5I3CA 2IZ0A 2FX3A 3N0RA 1YHQF 4N21A 1Y76A 2FW8A 3CRZA 4EP1A 1MH9A 1Y6FA 2BM9A 3RNOA 1G0OA 3IVGA 2CLEB 3EMVA 3NAQA 3OPYB 4PICA 4W4KA 3E22B 1J56A 2E4YA 1T0UA 1ZAUA 4WOJA 4XX0B 4W9NC 1AZSC 4N7BA 4KFTA 1X7GA 5CBGA 1Y81A 5KMGA 3R7DA 3GJ0A 1KD1W 2F3RA 4X1KA 1CVRA 2ZUCA 4D4HA 2QEXV 1IBLB 3NTOA 2DHCA 4QJ4A 2RKWA 3A4TA 1TM3E 4I4LA 4D5GA 2FP3A 2DG2A 3UXHA 2F3SA 1ZN7A 1G2IA 1M3SA 1RXEA 1FDRA 3OKCA 1OROA 3PDWA 2QY9A 3F8WA 4FKMA 4I5EA 2HU2A 4IWYA 4UZEA 4A82A 3E7XA 4MTOA 1NC3A 3QRWA 4IPTA 1J9ZA 3UUFA 1Z63A 4ZTBA 2FG5A 4KPUA 5IYZB 1J2YA 4IFEA 5F1KA 2FOLA 1E9AA 4RF4A 2OC9A 5HF8A 1ECJA 4AL4A 1BE6A 4AMZA 2P68A 3DOOA 3O9VA 1BGYH 2QQ0A 4IL5A 1G8JA 2XZOA 1E4EB 3NATA 1XUQA 1NQTA 1XZPA 3ZE7A 4TT3D 1LB1B 1ZNQO 2ZP1A 4YWJA 1TDJA 1X7ZB 1VRCA 5JV5A 3E61A 1NX6A 3T5DA 2OCCC 2IW5A 2WFMA 4UBOA 3BBLA 2F1OA 8GPBA 1LJUA 3CC2F 5EUMA 1P3DA 2NMUA 1U96A 3CH5A 4IX9A 1U3PA 4HDRA 4FLYA 2POCA 4CIXA 1QG0A 1FFGA 1BMFD 4FFRA 1B8OA 5BP7A 2CVPA 4UEQA 2M7WA 3CX4A 1PUJA 3FNQA 3LT5A 4A6DA 4LF9O 1HQKA 1SQ5A 3E9MA 5LC1A 4GVXA 4U2DA 2WLHA 2XR1A 2ASVA 4F5ZA 1SG6A 1IDOA 2H16A 4UOEA 1ZNWA 1UZLA 1EBOA 3JYNA 1GXSB 3HACA 2A35A 1WQ4A 1XN1A 3EOAI 5M04A 3H42B 2Q1WA 2Q28A 3B8EA 3FDXA 3F78A 4TZKA 3QEOA 1NV9A 4ZCTA 3CVUA 4QGFA 4FP9A 3LUKA 1COWA 5MN5A 2HS3A 1XJQA 3IPLA 4P92A 3O3OB 2LJ2A 1FNCA 4O4HB 4FGUA 4DRZA 5CM2Z 2KGWA 4J7UA 2IV2X 2PXXA 3PDUA 5L6MB 1LJ8A 3AJ8A 3WIEA 1CEEA 3KJQA 4E88A 2QSAA 4E2XA 1EVYA 2ZEJA 4JROA 4RPCA 4B3HA 3DHWC 3K5IA 5FBWB 4B2PA 3FDIA 1UKEA 1Y5MA 2HMWA 3DXRB 3DFFA 1XZHA 1YXBA 4DMFA 5JS7A 4MV7A 1W88B 4RWEA 3MT7A 2AOTB 1RM1B 2X1HA 4RQOA 2CZGA 1CUGA 1QVAA 1T5TA 3RHSA 4AZSA 4C43A 2IS2A 1NJ5A 3JWJA 1T9ZA 4M87A 3HKBB 2IP1A 1UFOA 4KN5A 4UPDA 1BJTA 5F1PA 3W4JA 5G4UC 2P2YA 3W6PA 5EEGA 4RZ2A 5CDHA 1M6VB 3ZCXA 3KJXA 1NT4A 5F77A 1TLLA 1U0GA 3PXBA 2VJMA 3OU6A 4Q18A 3V3KA 3VR6H 3LSTA 3LDGA 2JDIG 4EPWA 3IAS1 6NULA 2CMKA 2CW5A 3TOCA 1MO5A 1OX5A 3A1VA 2XRZA 1JIKA 6AT1A 1PT9A 3VC3A 3C3WA 4HAMA 3NHAA 1ST2A 5A4JA 3E3NA 4G01B 3AU8A 1RI4A 1VBNA 4IOJA 4XPIA 4C21A 4FM2A 1FXUA 3H87A 3U0ZA 1UK9A 2DFPA 3DUWA 4LQCA 4MWCA 1WVGA 4TL9A 3DAHA 4Y2JA 4C06A 3K70C 4DPKA 1AA9A 2PGOA 4MWSA 2R5FA 2IFTA 1V8ZA 1Y33E 4FEYA 3RFCA 3PGJA 4MRMA 3T99A 1W19A 1W41A 4RVGA 4BIMA 3HKEB 3NS7A 3L40A 3P0IA 1QVGF 2Y67A 4LYDA 4B8WA 4W5RA 2XXAA 3IQIX 3CCLF 1GD1O 2QK4A 5IFLA 3QJGA 4QEKA 3QVGB 4R9RA 2PRSA 3VI6A 3VFDA 4FB5A 3TEMA 3WLIA 2Q2NA 2V45A 5C4GB 1WVMA 1SVWA 2X0JA 3PR2B 1B8PA 4KNVA 4EM6A 3ZK8A 4KWEA 3LUDA 3QTLA 4L5BA 5FBHA 3OT1B 5D7NA 1E61A 3S8YA 4BX9A 2QAGA 4N4AA 3JS5A 4Y1EA 1JWLA 3HHPA 2FUKA 2ONYA 3OM0A 4LBVA 2QDKA 2OYQA 4HG2A 5JD4A 5FYDA 3WNQA 5KWSA 1V16B 5IC4A 3INRA 4HGRA 4FLXA 2C3YA 1WB6A 1G63A 4HYTA 1ZVQA 2OLJA 3MS4A 4WH0A 4U63A 1FMCA 1IHYA 3RBZA 1C0KA 2C88A 2VDVE 5GJVC 2BCGY 4BFZA 1ONPA 1RYBA 5TQJA 4FHZA 3W2FA 4Z9FA 1XZCA 2ZAMA 2E1PA 3ODGA 3B3GA 4R16A 1GO3F 3S3XA 1O58A 1PR4A 2XOXA 4XTCS 3I52A 4P0QB 2JFXA 3IT3A 3NBAA 1BKDR 1MX1A 1EYZA 2BFMA 3QTTA 4NXNO 2JHPA 2XHZA 2EZPA 1USKA 2FPRA 3EZYA 3PKZA 1IG3A 1JVNA 2Y9PB 1HR0O 2ZR2A 1G8GA 1SH7A 3D7NA 1G8MA 2BFPA 2C5SA 2W6PA 3LUGA 5GONA 1JHRA 1PN3A 2ECQA 1NR1A 2YXLA 1OAOA 2P9EA 2PGJA 2GTAA 2WWTA 1O4VA 2AHRA 3TNFA 3SQMA 3CYQA 4D9GA 3FOAA 3H2KA 1YQGA 4UATA 5JUWA 5TPZD 4YONB 4JEIA 3K6JA 1E6KA 1CVLA 5LMNO 1JX6A 2EW8A 2HLDA 1O08A 4P82A 3ICCA 4HJRA 4QLAA 5I9NA 3WAGA 1JU3A 1YH3A 3DR5A 2R1ZA 2UZ1A 4IXMA 2E37A 4Q6BA 2HLPA 4W7IA 2GVIA 2RSLA 5SYMA 4CM7A 1NYLA 5CJJA 1J8QA 1LW6E 1ORVA 2BZ0A 2GAAA 4JBXA 1I36A 3T4ZA 3AO0B 3AIMA 4PTYA 2GK7A 3W1VA 1H66A 1JEDA 3TLJA 5C18A 4XYMA 5TQ0A 1PR9A 1NVTA 1F1JA 1HA3A 1SBNE 3AM5A 3ANSA 3GGPA 1QANA 4XJSA 5F33A 1L0NH 1HRDA 3D5TA 5EZ5A 3UK1A 3W05A 4WGFA 4OK6A 1DJOA 5JJEB 1KEUA 4X66B 4KLNA 3E4CA 3VYRB 5A4DA 1PV1A 2EILB 2PX8A 3CX3A 3FBAA 4MTCA 3HB4X 4NPCA 3T7JA 1B0ZA 5DV9A 4DK0A 2HIHA 4OB7A 1P62B 5HGJA 1IBSA 1G19A 1VKRA 1K8ZB 4K8OA 2Z1UA 2GV9A 2C8VA 3H19A 3M82A 3PC8C 3V1UA 3FTQA 1NC1A 4O4HA 4PAWA 2WWGA 4JVNA 1CUYA 2NGRA 2RIRA 1WW8A 4Z1MD 1PEDA 4G07A 4RDCA 2QTRA 3V1LA 1QF6A 2Q5IA 4RL6A 2OAEA 1P4JA 4PRYA 4P6VF 4XAQA 5LZ9A 1KI7A 1MA1A 2C7BA 1NMQA 1A7JA 2FGKA 4M0PA 1VRVA 2ZCVA 4UMVA 1XK7A 3SXUB 4PF1A 5K0SA 5E4JA 2ZWPA 3IUJA 1JYEA 3ZMVA 2ZIMA 2PMCA 2AS0A 2OFFA 1W0KG 2JRIA 3WQSB 1SF9A 3MVEA 4QULA 3WRYA 4RHXA 1H2WA 3UGTA 5EKXA 2UXCB 1EH5A 4F38A 3C85A 7AT1A 1QUFA 1GTZA 2R2GA 2XODA 5HFNA 3L71H 1N9GA 3DC5A 2GERA 5HFAA 3MDSA 2Z09A 1YVEI 3F7NA 4RKYA 3Q6NA 4NV0A 1GU0A 3P5SA 2VDWA 4GMDA 3OZEA 1C14A 3ZMUA 2RE8A 4HDAA 2GCOA 3L7LA 1WMAA 3MOSA 1AZLA 1XZNA 4MGEA 3TI9A 1NBWB 5B12A 3ROFA 5KOHA 3RSSA 3P96A 3TNDA 3GRCA 4O63O 3TJTA 2B33A 2O0JA 1FP1D 2HA3A 1ADGA 1H05A 3DVAB 1VQMF 2CD7A 4QNNA 3SZMA 3W8RA 3I34X 4OGFA 5HFLA 4OQEA 2ZYWX 2QT0A 1TCAA 2F90A 5A5FA 2AZXA 4LOKA 3LQKA 4IGGA 4FM1A 4R1QA 5E3HA 1C9NA 5GGYA 2QTTA 3G17A 2J59A 1XXHE 3UJ7A 3U60B 5AW9A 3SJCC 2IDMA 3C3CA 4PGMA 1FLAA 3FZGA 4RSRA 3GLKA 1QKIA 4HHEA 1Z73A 4ZQGA 4EBFA 4CMCA 1WCYA 1JHOA 1AM4D 3VR5D 2XUZA 3FWNA 1XU4A 2NSLA 3SPGA 3QI2A 1YJ9V 1HQYE 4X8AA 1QF7A 1T4BA 5JFOA 1LPSA 5FTKA 4F4HA 1HNZO 2CFRA 3HUFA 3L7DA 3OKAA 3QBDA 3PRHA 1Q7GA 5A9GA 4BFTA 2QG9A 2WUFA 2HT1A 2HPZA 2IY8A 2VT6A 2FEWB 3MRVA 4RTNA 2XCRB 2YJ4A 3TM5A 5BSRA 2Z08A 2CW4A 1DAMA 1QIFA 3DB2A 4WXPA 3OQMA 5BMVB 3CW9A 121PA 2GCNA 2IODA 5CK4A 3E0XA 3FTDA 3IAUA 5AI0A 3TLAA 1YHZA 1L4EA 1WUIS 1UBHS 4JGIA 5HE8A 2OECA 2YFYA 2Z5GA 4V0SA 1XMSA 4PQGA 4DABA 4MIKA 3DAPA 4DV3O 3GAFA 1II8B 4FK5C 4ZOLA 5GONB 4YJDA 2YIAA 4OH7A 3U9TA 4C07A 3WGJA 2F64A