3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
4TUYB 4LNUB 2BTOA 1OFUA 4O4JB 5LP6C 4ZHQB 4IHJA 3HKCA 5IJ9B 3RB8A 5IYZA 4ZI7B 3ZIDA 1W59A 5JVDA 4I4TA 4O2BA 5J2UB 1FFXA 4YJ2B 2VAPA 4F6RA 4DRXB 1W5FA 5EIBD 4TV9B 3RYFB 2RHJA 4TV8B 4YJ3A 5LYJB 3N2KA 5CB4A 3WGJA 4I55A 4I50A 4O4IA 3ZBQA 5EYPA 4U3JB 5JCOA 5EZYA 4M8IA 4O4HA 3WGKA 2XKAA 2VAWA 3JATB 5CA0A 4FFBA 5BMVB 4O2AB 5CA1B 3HKDB 5GONB 3RYHA 4O4LB 3N2GA 4X1IA 1RLUA 3VOBA 3UT5A 1Z5WA 5KX5A 1W581 3RYIB 3JAWB 5IJ0A 3E22A 2BTQB 4EI9A 2XKBA 2RHOA 4HNAA 5KMGA 3JAKA 5FNVB 4O4JA 1TVKB 3HKEB 4X1KA 4XCQA 5LOVA 5IJ9A 1JFFB 5EIBC 5J2TB 4ZI7A 3VOAA 4IIJB 4X1YA 2R6R1 2RHLA 4E6EA 4EB6A 5LP6A 3HKCB 2Q1YA 4TV9A 3RYFA 3JALB 5ITZA 4X20A 3WGNA 1SA0B 1FSZA 4B46A 5JVDB 3HKBA 4I4TB 4ZOLA 3JARA 1FFXB 1W5BA 5JH7A 4F6RB 5JCOC 3JASA 5LA6A 3JATA 3WGMA 4WBNA 5C8YB 2R751 5CA1A 3HKDA 4I55B 3V3TA 5GONA 4O4LA 1TUBB 5EYPB 5JQGA 5LXTB 4DXDA 4TUYA 4O4HB 4LNUA 3WGLA 5CA0B 3JAWA 3C8LA 5MN5A 4ZHQA 3RYCB 2Q1XA 2BTQA 4X1IB 3M8KA 1Z5VA 3UT5B 2RHHA 5FNVA 5J2UA 4U39A 4YJ2A 4IHJB 4DRXA 3E22B 5IYZB 4TV8A 5LYJA 1RQ2A 3ZBPA 4HNAB 5KMGB 3JAKB 4O2BB 4X1KB 5LOVB 2VAMA 4EI7A 4U3JA 2VXYA 3VO8A 1W5AA 3VO9A 3JALA 4YJ3B 3M89A 1SA0A 3N2KB 4X1YB 5BMVA 4O2AA 5CB4B 3VPAA 4I50B 3CB2A 4O4IB 3R4VA 4EB6B 5LP6B 4KWEA 5EZYB 5ITZB 4X20B 5C8YA 4FFBB 3RYIA 3HKBB 4ZOLB 3JARB 1W5EA 5MN4A 1TUBA 3N2GB 3RYHB 5JH7B 1RQ7A 5LXTA 3JASB 5LA6B 5KX5B 4B45A 4EI8A 4WBNB 1TVKA 3HKEA 5MN6A 5IJ0B 3RYCA 5JQGB 1JFFA 5M7EA 5J2TA 2GVIA 4IIJA
chains in the Genus database with same CATH superfamily
2IY7A 4C3UA 3H1IH 4EGAA 2J3JA 3OSZA 3CVWA 3DZJA 3MD9A 4BIIA 4JBHA 2Z04A 5ELLA 5H5NA 2VWJA 1VYVA 4U5QA 3RARA 2A1UB 3W0LB 3R7WB 4BMSA 1P7BA 1N5OX 3EVCA 5IMBA 2KJQA 5ITSA 5FUVA 1X8XA 2DTXA 4JUIA 4CXMA 4FFLA 1NX9A 1W76A 5CEEA 3I1JA 5C1BA 2UUBO 3E9MA 4BFCA 4LCJA 1YHNA 4NPHA 3GFBA 5AM2A 3UM7A 5DEOA 1G2IA 2C5HA 3OIUA 4WJKB 1RCFA 2OHOA 5GZ3A 1THZA 4YP7A 2VGMA 2WM3A 3BIWA 1ZUQA 2XEXA 3DE3X 1OFUX 1EFKA 3S2GA 2X5KO 2HPVA 1QF7A 3HVIA 4YEDA 4D82A 2Y48A 1YACA 3KXDA 2YV5A 2GAIA 3AMVA 5D85A 2J0VA 2GVIA 3A14A 1WUTA 3KQNA 2LW1A 1ZA1A 3FD6A 4MVJM 1E4EB 1UBSB 3KKKA 2FXIA 4OK6A 1AGRA 3B7WA 3VPFA 4I1SA 2HK7A 1L7MA 3ZXSA 4HMQA 4BFXA 4H0LB 1ABFA 4QE9A 1V5GA 3R9XA 3LECA 3EBLA 1I01A 2HA6A 4BW0B 3RSCA 3K5PA 1W94A 2XJ4A 4LHXA 1R5NA 2R6ZA 3LOUA 3T3PB 2YHAA 4Q6BA 2GCIA 1RJ9B 1NM5C 3EC7A 1UFIA 4OHRA 2MIIA 1F9AA 1SPXA 1JVSA 1R5JA 1TYEB 2O1SA 5EWJB 4ZHVA 1SOAA 4A8JA 1IZZA 3OUUA 5DP1A 1JS1X 1WZCA 2H6LA 1ZAUA 3NASA 2NU9B 2VRCD 2J4CA 2FGJA 1KZ4A 4LQCA 1T10A 4BVTA 4HLUA 4AK9A 2AJLI 2JFXA 1AR1B 2VQ6A 5GINC 1UT8A 3QTLA 4EZBA 1FP4B 2ZVDA 4RMGA 3RYHB 4WA7A 4A0FA 3S3XA 4YT4A 4PJ0Z 1M8JA 4NS4A 1FUYB 4QQFA 5B4VA 2Q0SA 3NV7A 4TLLB 2QN3A 3VI4B 3S3WA 1MF7A 1HLPA 4KIJA 5K6AA 4C2BA 4ZO9A 1TCAA 1V1MB 3V55A 3ON1A 4JP5A 5IWAB 1C30B 4MEJA 2IS4A 4ED9A 3NR7A 3TCKA 4UFOA 3DL2A 2X3UA 4MO2A 5LZ9A 4ZQCB 1H65A 1MZEA 5KPJA 3KU1A 2IYLD 4WFJA 3L4JA 2YXDA 1HNXO 2CMHA 2HX1A 2Q49A 5GIOC 5L51A 2ZB7A 1H22A 3VR3A 2QTCA 1KRHA 3AR8A 2DGDA 1BTOA 4KFUA 2AOVA 4PLCA 3PNBA 3I1IA 4KB5A 1QVZA 5CIWA 4TWKA 5L3CA 5A4MS 4K3VA 4NG5A 3VKWA 5ALOA 3DEJA 3X44A 5HQTA 1SM4A 2OV8A 3GJZA 3LCUA 3BGIA 3U0OA 3ZIAA 4DR4O 1G21E 2F62A 1PZMA 3W5SA 4D9MA 4IFBA 2P6NA 4HDRA 1RM1B 1KAMA 4DR6O 4HNGA 4L3OA 3WLFA 1ZRSA 4BXOB 4BNKA 2N1MA 3TW8A 3ZHBA 3UT5A 1J4AA 1I9GA 2RJZA 4E5KA 5ADWA 3KLNA 5HOEA 2V6IA 4KSCA 3HZZA 5B7NA 4ZI7A 3QGMA 3GI1A 2OGZA 5FUYA 1MH1A 3RQSA 2GHQA 3HB4X 3H1EA 3LC1O 2D3TA 2OBNA 3RV4A 2A2ZA 1U2DC 4AZ3B 3F7MA 2OO5C 3DZIA 1QG4A 4RGYA 3WP1B 4BO7A 4K9PA 4ND5A 5EJ6A 3L7JA 4OH1A 1EXMA 3WGIA 3PCRB 2G63A 4COKA 2F55A 1RYYA 5GMOA 4DR2O 5EMNA 1YA4A 1QRRA 1EFTA 3EA0A 4ICIA 1CETA 1J21A 4NZ9A 2H9AA 1EK1A 4HBGA 3AI2A 2QI2A 1Q2UA 2DBYA 4MGEA 3H13A 4JTCB 2XOEA 1D6NA 5KNBA 1P49A 4OGKA 3OZIA 2IFTA 1EINA 2YQ4A 3KPJA 4G1BA 3UT0A 4NDZA 4YCJA 3KQYA 1ZITA 5FAXA 2Z8YA 4R84A 2NZYA 4BY9D 3G2OA 4EW1A 3GYBA 4MX8A 4U8HA 1EI9A 5DBIA 4EAAA 4NF2A 2YVKA 2OVBA 4L6AA 1NKTA 3UWDA 1FTGA 1FQOA 4YGYA 5CFMA 2DPMA 3WMFA 2G9VA 1MNQA 1AJQA 5HFLA 2OK8A 2VK8A 4NOKA 4Q48A 3JTEA 3OIGA 3PE3A 6REQB 4EHLA 1VF5B 3Q7EA 3DTYA 1XEWY 1F1BA 3EXIB 1KI8A 1UJ5A 3N27A 4F2HA 1SG6A 4D6XA 3OICA 2NN3C 1QVVA 3IPLA 4JASB 4BL5A 3ADKA 1KD1H 1KQFA 4MI6A 4ESVA 1LBQA 5JCJD 1WHTA 3U31A 1JP7A 2Y6VA 3LDCA 2CBXA 2HXYA 4KPGA 3GNQA 4C6TB 4RPKA 4Q1FA 1GZUA 3EJWA 1UCFA 2ORYA 2PK3A 3A1TA 4RUKA 2ZUDA 3BEHA 2WV9A 1OOEA 2UYGA 3TGLA 3CU5A 2GWHA 1ZH6A 1WTCA 2C77A 1SBCA 2ZUFA 2JEOA 5JDCC 3COYA 3PPYA 3HL4A 4MEAA 3IURA 2WYWA 4LJ5A 4QDUA 2ALEA 3EGVA 1L8LA 1RRCA 4S24A 4ABYA 1Q92A 1L5RA 2CNWD 3PI7A 1P19A 1WB7A 2X19A 4AD8A 1WR8A 2YC2C 3RF7A 1G1XB 2ZJ4A 1ZU5A 3VPSA 2QRPA 2C78A 5TARA 2PVCA 3PUZA 1PJ4A 5F2OA 4JC4A 4LJLA 3B2NA 1F38A 2WWFA 5GVRA 2HKIA 4JLAA 1PBNA 3U13A 1FTSA 1O94C 1VPEA 4GH5A 1WY5A 4YMWA 3CLUD 2YIDA 3HB3B 2N42A 3OEHD 5ALWA 4DWVA 1U3TA 4U7FA 4TV8B 2VYVD 5BN1A 1WTAA 4NEHB 2GARA 3ZRXA 3KTOA 3UCFA 2C5LA 2QUKA 3F7TA 4A6DA 5TGZA 4IJVA 1E2DA 4TMKA 5JS8A 2J6CA 3PF9A 4KIWA 4LTDA 4OQZA 1D4FA 3DV2A 4K6KA 1VMEA 3DAYA 4DBZA 1BGVA 2OXCA 1HP8A 4MB0A 1CUCA 3A0RB 4H0FA 1PV2A 4HNRA 4PN3A 2E48A 4FGUA 4TL6A 2UXCB 1VYTA 2HMAA 3K0EA 4YRMA 4I2NA 4TZTA 1ONNA 2BHLA 3TJMA 4YQYA 3JAMA 3CQ9A 4TRMA 1XVTA 2Q5HA 2HHHB 3G2IA 4KMMA 3E23A 2VS1A 3F5TA 2IZ5A 3BYZA 1XZCA 1GZ5A 3N9IA 4JVOA 4JIMA 4D4KA 1C1XA 3BFRA 1DTSA 3DE2X 1RM4A 4AX8A 4MVWA 2V98A 1GXSB 1J8QA 4UVBA 1H6BA 2O07A 3AUTA 4RYLA 3UJNA 3DC6A 3X2EA 5ADVA 1LZKA 1E6KA 4YI3A 3KE9A 4BMYA 1NC1A 1A77A 1M34B 5KNDD 2W2VA 4MUNA 4POAA 1F2VA 1AROP 3PHHA 4QICA 1B6QA 3VBEA 3S68A 3WL4A 5F7JA 5BOVA 3QPWA 5EXPA 4BC1A 1HWYA 5TB5A 5HE9A 4ATNA 1N3YA 3D6FA 5FYQA 2GX6A 3IHTA 3Q8HA 4L7VA 3G8YA 2H29A 3WK4A 4CL0A 3QEJA 3JQAB 4Y2TA 4EHBA 1K0FA 1GOTA 3UKJA 3ADOA 4LXQA 1G18A 3PDUA 3SMQA 1I7FA 2R9VA 1AKQA 3TR0A 3RW9A 4KR9A 5DSZA 4ZAFA 5K6RA 2I2BA 3BIXA 2OAEA 2VAPA 1JJAA 5EPOA 3ILYA 4NTWA 1SKYB 1HE2A 3PQ4A 1KIFA 2JVJA 2GOYA 4U02A 1HKUA 1DUIA 2CE7A 4DDHA 5KI6A 1XR3A 3VSCA 5T3UA 1QP4A 2H1HA 2YIVX 5CNKA 2Y1CA 4ME6A 2PGDA 4QM7A 3I6BA 3MBOA 4M0LA 1NS1A 1R9MA 3DYVA 1BXGB 3WLMA 1WB5A 1SUDA 3HA3A 2G08A 1BXRA 4DY6A 5BSVA 4XB6B 1UKVY 3HBAA 1W9HA 5F51A 2PJDA 2JZCA 2VP2A 3R6WA 2AN5A 1K33A 1Q11A 2E18A 1JDUA 2GN9A 3VTIC 3FB5C 4HP8A 1I0ZA 5FLKA 3ZCPA 1CZHA 1HT0A 4V39A 3MGAA 3MJTA 1BMFD 2JIRA 2GBIA 3HUEA 1I13A 4FB5A 2F3TA 3ID6C 5E1MA 3FFBA 3JWJA 5DCVA 3PQ5A 1P74A 1U4SA 4JYPA 3ZCSA 4ESHA 1C1HA 3ITEA 4DLZA 1DX6A 2GAOA 4G0UA 1X42A 3I0ZA 4MDHA 3ET5A 4LVNA 5DEIA 5SV2A 5FIUA 4B3XA 1BCRB 5L3FA 2F1OA 1VB5A 1M2FA 4F4LA 1NWHA 3ZC3A 4YMTA 3GAZA 3LT4A 4L51A 4U4AA 2F48A 2GJKA 3AKDA 4PX5A 1DQYA 4ZCRA 1WZEA 2HRYA 1Y6ZA 1EK5A 3RLIA 3P2KA 3VMMA 3EZ2A 4M1QA 1Y80A 1UQRA 1KH3A 4KUHA 2D13A 3DBLB 5KX5B 5EKSA 1ORQC 1H94A 4MGZR 2QUAA 2XVYA 2CCKA 4CM8B 4CR6A 1YOVB 2RHDA 2IV2X 2Q6TA 4KK3A 1FY2A 4ZRNA 5LZ4A 3KOXA 1HI9A 1TTQB 1MV8A 3IDFA 4OI2A 1IY8A 3LKDA 5AI9A 3EHEA 1W6RA 1ZD3A 3FYUC 1OT3A 4RWUA 5M2QA 4OXYA 2HCTA 4RBNA 1SETA 3EVZA 4DQDA 3RTBA 1RZUA 2Z9DA 1NJ6A 2CF5A 2I8CA 2ZSIA 3FLEA 3ZWXA 2RGRA 3ZE0B 5JOQA 2GFIA 1QLHA 4LF5O 1GA4A 2PKWA 3AKYA 4EL0A 3GQBA 3VR2D 3K06A 1Q1ZA 3GPCA 2G4VA 3TKAA 4H1VA 1ZSVA 1IXSB 2ETVA 1KR5A 3EW7A 1JPJA 4HATA 2PA0A 3KVNA 2BELA 2O3UA 4GMXA 4C14A 5HS6A 2DT4A 3HEBA 4H1UA 1TJ5A 2E21A 1SVUA 5CLFA 2BDEA 4LF8B 1GM9A 2PSDA 1PGJA 4GOMD 2NXNA 4J3NA 3O4IA 3N2EA 2OL4A 4IXWA 2IS2A 3ZDFA 3QUQA 1H2BA 4KGVA 2EJVA 1XJ5A 1PX2A 3GLKA 2HI0A 10MHA 2M2IA 2UXBB 3D5QA 2EP8A 1FB5A 1CTQA 4O2BF 5HZMA 4QODA 2IU0A 1MAWA 3PKZA 4OLBA 2ZT5A 4WSOA 4F21A 3HS3A 4AJKA 1O4WA 3W34A 2PZLA 4NCHA 3KEQA 1U81A 3WGTA 4P3NA 3G82C 2Q69A 1K3EA 5LQAA 1Q7RA 3C6YA 3MRVA 3Q12A 4R2IA 5ISMA 1NUPA 1QHHB 3GUVA 3GCWA 1CRWG 2W7TA 4LRYA 4B9EA 3SHQA 1H2WA 2FN4A 3B6ZA 5EMMA 2VSYA 3VQVA 2JCGA 1JBQA 2A0WA 2Q73A 3KTFA 3BMNA 4OIFA 1E66A 2BI4A 1DTEA 4MR9B 3ROEA 3VOBA 4L8WB 1SXJE 3OAAG 3SS8A 3FUTA 1CXZB 2EHJA 5LZ5A 1F2TB 3PKIA 1GR0A 4LXGA 1SIUA 2PKRA 4FLUA 2HNKA 4DSTA 4PONA 2EFJA 4OYHA 4DNPA 4B2IA 5JZBA 2QTFA 1QH9A 3TDKA 3U61B 2J59A 2PBLA 4TOIA 1LD3A 1G5RA 4JUCA 1F12A 2NUTA 2MSLA 2HS4A 3Q3JB 4QGSA 2WJZB 5TC4A 2OTJF 4GKKB 3OA2A 4QIHA 2M1XA 3ZLTA 1DBVO 3SDLA 2CHTA 2BFMA 4CKZA 4EH1A 4Y1RB 5JDIC 4JODA 2HX0A 2XMPA 4XUCA 1JXMA 3B9BA 3FBTA 3LT0A 2PH7A 4KBGA 4BX3A 2G82A 1HE8B 3FVQA 2BR3A 1IZ9A 3ZGZA 1SN7A 2W6ZA 2ZUWA 2WV7A 4YXFA 2EEPA 1A4UA 2XNHA 3F5MA 3GMDA 1L4NA 2JAXA 1DBIA 1P5JA 5CTJA 4FM1A 4E5DA 3K03A 3NAGA 2B7CA 4FE3A 4IIHA 4S04A 3IELA 3BK2A 2EG5A 1OR8A 4BYGA 1Y3IA 4EYGA 4PAWA 4QUHA 2IOFK 1WZIA 4A0RA 2BRUA 3EN0A 1D2NA 4CS4A 4NL4H 1ZVVA 4F3KA 2JD1A 3L1IA 4M89A 1V45E 5I7WA 1GARA 2F90A 1AP5A 2X5XA 1SA0A 1QLEB 3CCJF 3DTUB 2W2NA 4BQIA 2BGGA 2XHBA 4IWXA 3KZNA 2ZUBA 5D2CA 4XDLA 2XB2A 4ZODA 1F4MA 4M0EA 2EGGA 1L6IA 2AZMA 4Q1EA 1SVNA 1MNGA 3ABMB 1OI3A 1GTG1 1CZLA 1YJCA 3CPHA 3MRXA 3EUAA 4TTTS 5ALQA 3T4EA 3DAOA 3FPJA 4J8PA 4BRWA 2DRIA 3NK7A 3BHIA 1Y6RA 1PNLA 3BULA 4R0MA 4EVQA 1HGXA 3AVVA 5B7PA 3A28A 3GU3A 4QYTA 3CXCF 4BV8A 5BV7A 1DO2A 3CNHA 3DCJA 2HU2A 1Q5PA 1B14A 1FSPA 3LHSA 3KR9A 3HSSA 1AXRA 3T4PA 2IUUA 4BN0A 2P8SA 4WASA 4ZAWA 4FFDA 1GN8A 3MTGA 1Y5LA 1FDRA 3AUAA 5JQGB 5ECGC 5EVCA 5K1ZA 3W77A 3H1TA 3CPJB 3HCEA 4RZQA 1GRJA 4P2BA 1CJTC 3EQ8A 1EN6A 5AW7A 1BCSA 3UA3A 4QJBA 1EXWA 1NULA 4GOND 4JZKA 2XKAA 2OAP1 3LHFA 4LJ8A 4R98A 3GWGA 5AVUA 4XQEA 1P7CA 2Y99A 1NP6A 4KX3A 2TMDA 1XTBA 1L5LA 2JLVA 4QSMA 2JGLA 2FMXA 4P82A 5SZHB 3C87A 3K5OA 1QLWA 2PVPA 1WCV1 5BW4A 2OZPA 1DJMA 1V7ZA 2PZGA 3BFPA 1B7GO 5I4CA 1U96A 4W5TA 3V3TA 2PZBA 3G7NA 4BS9A 1HYEA 5CLJA 3B48A 3B53X 3DFKA 4ZT5A 3L7NA 4IIGA 4QYMA 5JNTA 5KTKA 2RONA 2RHGB 3N7UA 4XQCA 3L5KA 3D4BA 3DVAA 2WHPA 1MN6A 4GQAA 4HDNA 3COSA 3X2QC 1JJ2F 2HL6A 4ASUG 5DI3A 4REQB 3VHRA 5LHGA 3Q98A 1CWUA 1SVSA 1NN0A 3OTHA 5H1YA 3MCAA 1Q0UA 1DF4A 3ZHQA 2PI5A 5DLYA 4H7PA 3C8HA 2C95A 1KDOA 1PL6A 3FPKA 4QVKA 1KEVA 3E0XA 5EPEA 3GLGE 4ZVRA 3HJGA 4V0NA 2DYSB 1W19A 2WWGA 3WZ2A 1FNCA 1URPA 4C4WC 1G7RA 4X66B 3GYQA 4I4LA 4LJ6A 2F23A 2OD2A 1DRJA 3DZGA 4Y9DA 1RFYA 1M73E 4RQTA 4E3WA 1ISSA 2O06A 2WLLA 3I4LA 7AT1A 3RVJA 4PF1A 2JD2A 1G66A 1VQLV 4MKFA 5TGDA 4A27A 3W3AA 3LTEA 1XRMA 4N5LA 2YWXA 4K6OA 4BO1A 4XIFA 2AN4A 1EBBA 3LXXA 3M1IA 3DHEA 3WSWA 2OTLV 4E2WA 2QBYA 5CXXA 3LDFA 3IQHX 4B09A 2K1EA 4JOSA 3F46A 1U2GA 5DDIP 3ZHVA 3KYCB 2O3RA 4UPDA 1K63A 2LP7A 3NQ41 3SIRA 2OXIA 3PPWA 1FU4A 3H9EO 4M7OA 1UXKA 1W88B 3IDZA 1CR6A 3TSWA 2Q7EA 3TZQA 3QWFA 4CKBB 3OTIA 1E2KA 1FRFS 4AWAA 5BSTA 4EY4A 5BWCA 2HIAA 2IUFA 1GN6A 4G8CA 1AF7A 2HZBA 1R5BA 2EFYA 2F4VB 2GNOA 1GUYA 1W4ZA 1YRYE 1M93A 2DU8A 2WWVD 1L2TA 4CH5A 3M7MX 1A8PA 1TE2A 2E4UA 3MOIA 2UVQA 4H7EA 1SCBA 3VR5D 2IEZA 4C82A 4HQKA 3P2EA 4DR1B 3KCQA 2F1RA 1UC5B 1QYDA 3EAQA 1HLFA 1O7JA 2W2MA 3EW9A 5DCWA 2BEVB 4HH1A 2WR8A 3MOSA 5T67A 4QOJA 1NDUA 4PW0A 3DSRA 2IF2A 2BKXA 2E5FA 1JA1A 2D2FA 3PPXA 3WHLA 3K04A 5TS3A 1EQAA 3L7BA 5KKCA 4X8HA 1UH5A 2XQVA 3HNPA 2DH6A 2XMBA 1CK2A 3BB3A 4RE5A 1OLUB 3VYTB 3T3MB 1PFYA 2V0GA 2HYIC 1BOFA 2UUAO 4QNHB 4HQRA 4BEVA 1L1QA 3ZYZA 1JWBB 2CFOA 2W98A 3F96A 1RPRA 2ZS8A 4R51A 5AVZA 2VJCA 1K73W 2JJ1D 2ZYRA 1Q3KA 2GD6A 4EJSC 3BSYA 4IFTA 1Z75A 4AY6A 2ZJBA 3ZCCA 3SIUA 4X9XA 5EYPB 2NQ8A 3LDDA 2I76A 4RSGA 3ABKB 2CL7X 2KBEA 3NC1C 3OJ0A 3FWKA 3VTZA 5HF5A 5ALDA 5KTOA 4JFRA 1I14A 2W0FC 4UHBA 2PY5A 2Z2XA 4GPD1 1AJEA 3JASB 3JQPA 4OI0A 2WAMA 1V48A 5CIQA 2XUIA 1MJFA 1CNFA 4N4AA 1QTIA 3GPDG 3TNYA 4M22A 5JSKA 5A9GA 4YIKA 4LMAA 4TL7A 3MPUA 2J41A 5IC4A 2ZU6A 1WLSA 4R05A 2XCLA 4A15A 5DO9A 3RW0A 2G1PA 4QPNA 1P7YA 4LHVA 4WFAV 2H63A 2Q4TA 2D7CA 1TQ4A 1ZU4A 3QKWA 2HEGA 5EIHA 4MUKA 4J43A 1PD1A 3UJ8A 2GA9A 2ZDIA 2BOCC 1V54B 4GG1A 4WCFC 3ICVA 4KMOA 4QPJC 1WUYA 3G0BA 2GTHA 2JAWA 1Z28A 1GV1A 1RW4A 1UK8A 3WRXA 1H8HA 3ZLJA 1LSJA 2Q3FA 2VR1A 1Q5OA 3LDTA 1J7KA 1J70A 4R1QA 3TRJA 1OREA 4P9OA 1EZJA 3NYWA 2QLNA 4E4YA 3AM4A 1EIZA 1EWTA 5CVEA 2BFEA 5DTEA 3TD9A 3QE3A 2GPJA 3PVZA 4YDHB 3PEEA 4N54A 3E18A 4IZ6A 2GBFA 3BABA 2AC4A 3V1UA 1LK0A 2LNDA 5JW6A 4BATA 3QO8A 4GLFA 1E2GA 1GZ0A 3KZ1E 4DC1A 5AM3A 4QC2A 3ZQ6A 5AT1A 3HVRA 3PC7A 3S6JA 2QD2A 3O74A 3JATB 4YRLA 4KOEC 2QX7A 4ROSA 4TRRA 1WD7A 4ZYXA 3CXCU 3B6IA 2FP4B 1N2CA 4GR5A 4INAA 2W0SA 5ENZA 3O4GA 4IH1A 4Z8YA 3KD3A 4Q3AA 5EFOA 4AG6A 3IL2A 1NBMD 3D81A 4D4GA 2PWAA 1NG9A 2AQHA 1EWQA 2FEXA 3WAJA 4Z0TA 1DJLA 5C3MA 1F5NA 2N75A 2VWKA 1HDXA 5EJ8A 2WG1A 5K01A 3AI3A 5CG2A 1PK7A 3A1EA 3IFSA 1YZHA 1FDVA 2BJVA 5C51B 4LC1A 4J16C 4I6GA 1CFZA 3D0OA 2XNDD 3GG9A 2RC6A 1R2QA 3PNOA 1KK2A 2OSBA 1XZQA 3SJAA 3FB8C 2JGDA 3FYSA 4EUKA 1VYHA 5FADA 1PT9A 4HDAA 4QD3A 4XGIA 1EEHA 2Q3HA 1O1YA 2OGUA 3B4SA 4RGVA 1DJOA 4GM4A 1W4RA 5EXDA 2Q4EA 3RFRA 1J2RA 1M72A 2IU3A 1J09A 2P06A 1XA4A 4RHAA 3S99A 2A3QA 4IF4A 4NAUA 2QKAA 4JN6B 4BQOA 2PO5A 5EKUA 1N5KA 4XA8A 5DLDA 1B76A 4F9GA 1S72V 3NZEA 2NNUA 1GK9A 3WAGA 4J10A 4CM5A 2MU1A 3FB6C 5FPRA 3OWHA 2ZJ0A 3K9BA 2N0SA 2DB3A 1NXVA 2SKEA 5BSKA 1OAKA 4H27A 1ORVA 3JQAD 5C9ZA 4IJQA 1HX7A 1SHUX 2JVKA 1AHIA 2YWCA 3S7TA 3PHCA 1WCXA 4B8WA 1SZDA 2RJ3A 3R0IA 3SCZA 4UOZA 4DR5B 3P9QA 3HXLA 5J2UB 5TEWA 3ODPA 5DB4A 4F9FA 3QLUA 4MCHA 2J3HA 4R8LA 4RD4A 1I7LA 1R6NA 3I9FA 2R2AA 2H7XA 4PGMA 1J07A 4CGYA 4MRSA 3CX6A 1K5HA 2P2DA 4JDPA 5AIAA 1JN1A 3OUSA 3FKQA 4IXTA 4V0MA 3RFFA 4I5EA 2AZDA 3WRYA 1VBFA 3U39A 4NVPA 2P2SA 3HYRA 1BFUA 4BE9A 4JI8O 1P5ZB 1BKDR 1FDOA 2XQKA 1G4HA 3PRYA 1LEHA 4E2YA 4TKLA 4DJFC 1CP3A 4JT4A 2EZ9A 3VFDA 5HFMA 1VQ8V 3BAAA 3PJRA 2IAFA 1DAHA 3PKJA 5M7EA 13PKA 2JFQA 2Z5VA 1RPJA 2YXEA 3FD8A 4XE5A 2BKLA 3NHPA 1VHLA 2IV7A 4ZYWA 1O57A 4CF7A 3S03A 3BWMA 3K8QA 4KR6A 1FNNA 4E33A 2ZDGA 5DW0A 2K7ZA 4BB6A 1IBRA 2IG8A 4HY3A 3LWPC 4UZSA 4AG5A 1OWNA 4ZN6A 3CYQA 4K6GA 5CU7A 4XSHA 1SBTA 5EKDA 2WPDD 4UBMA 4N03A 1Q44A 1MC1A 1KI6A 1TQDA 3RIHA 3APQA 1TX4B 2DTEA 2HCBA 2LDXA 4A0GA 3UWOA 2L6LA 1O95C 4TYMA 3WG7B 1EXDA 4RD6A 1BN6A 2Q50A 4HNAB 4PPYA 1J97A 3W9YA 4ZEXA 1JHMA 4IIUA 5CB4B 5LYJF 5K0FA 3DG9A 1VQPV 3A7EA 1EDBA 1XAGA 5ILQA 1Q14A 5GZ6A 4B7EA 1IAQA 4NBSA 1IBKB 3CLSD 3OD1A 1SQ0A 1T34A 1VF7A 3LPNA 4GZ6A 4DCMA 2P6JA 2IH4A 3CVVA 1NRXA 3FTQA 1JDNA 3ZQKA 2VXOA 4Y2UA 1FLNA 4KREA 2CNDA 5K3DA 4LMPA 1B41A 1SXGA 3RVLA 2Z01A 1O77A 5J59A 3E9NA 1UC4B 5JD4A 2EERA 3DO8A 3DULA 3VPXA 5HKAA 2H31A 3GLHA 4G0PA 3ML0A 4YA6A 3BJZA 4AECA 4KFMA 1IE3A 2P90A 1AF4A 1F23A 3LXMA 1E63A 3ZMUA 2GS9A 2XB4A 3FTNA 1R3JC 2JJ8A 4YRSA 5B1YA 3ENKA 2C2AA 4UVCA 2CYBA 1Y3HA 1DEKA 4HHEA 5T3YA 3SM3A 3WLEA 2PSJA 2GPBA 2FEKA 4DSOA 1JLRA 2ZVPX 4LRTB 1IULA 4MUIA 3KZKA 3DBHA 2KQUA 1XRGA 2OZKA 4PN7A 1JEDA 2OXTA 3R66A 2PT7A 1VHJA 2F9FA 2VQEO 4Y2YA 5FLXM 3H75A 5JAQA 3LYUA 3JWEA 3DFIA 3A0UA 4B3RO 4LSGA 4BP9A 1QV9A 3COJA 3F98A 3CCCA 1N2XA 4IDNA 4QBFA 1P33A 2PEYA 3CCFA 2JHPA 2JLRA 3JQRA 1WPRA 5MDHA 1GUDA 3QFRA 3TJTA 2RG7A 3VR6A 3EY9A 4PNPA 3H86A 5JECA 3OP1A 3MWEA 4TZKA 4AUKA 2ISQA 3HU3A 4IDPA 4LN1A 4DW8A 1R88A 4FX2A 1P0IA 4FT2A 3W1WA 1L5WA 4CCSA 4TM7A 1DG3A 4QQRA 1BDBA 3DP9A 3EXHB 3MLBA 1VE1A 2P6YA 5H81A 2FCAA 4I6EA 2FN7A 4EPYA 5HY0A 2XAAA 5I4IA 2P4UA 4MVJF 5H2FZ 4IINA 1SY7A 1UKBA 1GTRA 3NHBA 1QGDA 4O1IA 2XASA 1Q1BA 2VZEA 4PU0A 3WLNA 2RH5A 1Y9ZA 5BWBA 3JYOA 1I0IA 3U81A 3C3MA 3ESQA 8LDHA 4K81B 3GBPA 1P39A 2PQ6A 2VPPA 4L95C 2BFNA 5LDHA 5B1HA 2UXCO 3TSAA 2H4HA 1W2GA 3RAPR 4OU4A 3O73A 3P9KA 5JBNA 2XI4A 1YTFB 4NDAA 4PAGA 3AFNA 3QWIA 5A7HA 1XVAA 4J9YB 2VOJA 1GGFA 4ALKA 1YFKA 5CGZA 3JCZA 2J0QA 3NBYC 2XGMA 3NKLA 4DLVA 4RHYA 4QPKA 3F6EX 3DR5A 1OD6A 4UBKA 2F8SA 4DA6A 3QV2A 3AEUA 2CH7B 3PU6A 2IVFA 2ZATA 1PE0A 1JFRA 2R1VA 1SHTX 2NU8A 2NO9A 3J80M 4JGIA 1ICEA 2UAGA 1MEJA 1NLMA 4H08A 1Q21A 3STLC 1V37A 4GT1A 3UK6A 4QUGA 4WERA 3R20A 3P0ZA 1X7HA 1IB0A 3VA7A 3BGSA 4PYLA 2HQOA 4BVLA 4IS2A 2NACA 4KQGA 1GZHB 3KIPA 3BEDA 3Q7SA 3KT0A 1H8ED 4KQJA 2AIRA 2O8NA 1ZM7A 3DLTA 3EQZA 2Q7DA 5IHPA 5D1NA 5F7OA 1TT7A 3GPIA 2P1ZA 1O89A 1GSAA 1L3IA 3PGLA 3T1NA 4CG1A 1YB4A 1NBHA 1W75A 1S3SA 1Z6QA 2QD4A 4HYTA 2R7AA 2EYQA 1JQKA 5JVDB 4WJZA 1PTKA 4B7UA 4MCIA 4L5AA 1D4ZA 1HDGO 1LTQA 3G8BA 1SB8A 2R8BA 2REQA 1MG1A 1PDWA 2IYOA 4JROA 1K8AW 4HTFA 4MUFA 4PO1A 4MVJP 2VDKB 3RBVA 1JEQB 4I99A 2H7VA 3OQNA 1WW8A 1OHHG 4BFZA 3NYRA 2HY7A 2I3AA 4RWEA 3AJDA 3L8ZA 5BSEA 4N41A 2CDRA 4AMZA 1O96A 5H70A 3I1YA 4I55A 5G0VA 2JFHA 2H11A 1E96A 1PKXA 1DJPA 1TGVA 2JB9A 1XEWX 1YR8A 3TCNA 4LSZA 1OASA 4IDOA 1Q82H 5EE5B 2PX3A 4FGKA 3UV7A 4OQMA 4ITUA 3CJRA 1RJFA 4OHOA 2IS1A 2XEDA 4QRIA 3STYA 3VBBA 2O0JA 2Z3WA 4YV7A 2GK3A 3OKCA 1W2BF 1K92A 2AKEA 4YLGA 1KOLA 1XHLA 3RVRA 3HV0A 3BKXA 2IXAA 4HPJB 3D3EA 1KFJB 4RTOA 1NVFA 2GUWA 4AUEA 2VN8A 2HEPA 4BNDB 1OE0A 3FPHA 3GDHA 1ZGHA 3O3NB 1L5MA 1FDUA 1MAAA 1YZLA 1XTTA 3H83A 3NTQA 2O8BA 3HCNA 3NLLA 5E4JA 1KH1A 3LVFO 3F5DA 3GWOA 4TGLA 4UVDA 1Q1QA 1SGWA 3W7SA 1LDMA 1FTWA 1DUVG 1QQTA 3SY8A 2V4DA 1X86B 5JE8A 5EZYA 2Z9CA 4QJFB 4IFIA 1E8DA 1RYEA 3KOYA 4P80A 1AQUA 1KVQA 5BNZA 3MUOA 3DCIA 3HWWA 2MR6A 3T7EA 5G41A 3TCXB 5CLLA 2CLCX 4WKPA 2REBA 5JNSA 4DLXA 4OHXA 4EYSA 3UMYA 4Q9JA 4AO6A 3WKCA 4HDOB 3HCRA 4ICGA 1OJ7A 4QUKA 2G1JA 4QG3A 1JJFA 1CU1A 1R0ZA 1QDEA 3CUUA 3BWXA 4CF6A 2C9MA 4Q4HB 3ZMSA 1G21A 3P2JA 5FA5A 1S2DA 2P4HX 1RM5A 2ZRFA 1OB5A 5FOSA 5L53A 4YAJA 4RTPA 2P5SA 2Z8YM 1T6YA 2D0IA 1YR6A 2QVYX 3AUUA 4YJHA 3V4ZA 3JQGA 3OQ6A 1B06A 5FUWA 4BNHA 2UYKA 5E9AA 1A5BB 1KMHA 1PU2A 3HJNA 4RW0A 3Q2KA 1Q50A 3UJPA 3VX4A 4QYWA 1AILA 1A8UA 5A5VA 4XJVA 3F7YC 4DTIA 4JJAA 4QASA 1SBIA 4X24A 2GKGA 2DHQA 1MW9X 3N2YA 1M0EA 3DBRB 5IJ0A 3BXXA 5LUAA 4ZEWA 3LW8A 4YJGA 1PX0A 3TLEA 1UBCA 1T24A 1W85B 2FSUA 2XNSA 3GWZA 3DCNA 2XUHA 2O2XA 4NBRA 3WC4A 4TV9A 2GILA 1OFIA 3FRHA 4J41A 3JVUA 2PLNA 4LE1A 5LD2C 1E2BA 4DAOA 2HWUA 3PLRA 4M1MA 3DZBA 2PD4A 1VARA 5CA1A 4LF8O 2P1DA 1NF3A 5DT9A 1NQTA 4DIMA 1YS2X 5H3CA 4DQUA 2ODAA 3DUFA 4JCOA 2O2SA 2XTNA 4OX9B 4O4JF 2YMLA 1PN3A 4YAWA 1S7GA 1UJBA 2QTAA 1KVRA 2BSKB 3LUGA 2DWUA 4HVCA 1MOSA 4CKEA 1YMQA 4FFBB 1MO5A 1S76D 4PO3X 3VISA 3QEOA 4IV0A 1SURA 1E3SA 2JCYA 1ZX3A 5L3DA 4B8ZA 5A3QA 3D1JA 3PGMA 1X7XB 1L0LH 5KKNB 3I2JA 4FYHA 1M6EX 2PV0A 3FG9A 4ZVNA 2HVKC 3S70A 2NP6A 2HHAA 1XHXA 5B1BC 3GHHA 1AKYA 2R4TA 1XTRA 3INNA 3LUCA 3HACA 3G6EV 4GKAA 5DF1A 2ZIGA 2ZUVA 4IUCS 4P3YA 1QAHA 1US8B 1NXSA 3Q2IA 3TZEA 2X7RB 2IVZA 2ERXA 3BH6A 5AMXA 2BI8A 1PWYE 1Z73A 3HDGA 3LHIA 4UVAA 3OJEA 1VMGA 1QJ4A 3UGJA 2AQ8A 2ONCA 3Q7TA 2Z1MA 2QQGA 3CF6R 2XTMA 2ZQYA 2BTUA 3Q9NA 2Q1TA 3L3BA 2A5FA 2ERYA 4XSGA 1YZGA 2H8CA 1A9SA 2I29A 4WN3A 1T5TA 3U62A 2LP4Y 1TVKA 3O6VA 1U40A 2IXDA 1Y4UA 4KE6A 5CVTA 3SGLA 3L4KA 5KHOC 1U2ZA 1FFGA 4L9WA 2DP4E 3IEMA 4JSTA 4DBLE 4LXIA 4WBXC 2QI9C 3AUXA 2D5CA 1CEYA 4GKKO 1QBKC 3CKLA 3QH4A 2H6EA 2PH3A 2R7KA 4KO4S 3NHKA 4O3FA 1T2NA 4RF4A 5HHTA 3L73H 3WIUA 1TB4A 2C96A 1T0AA 4LBEC 1MABG 1W0JA 1OC2A 1HDZA 5AHKA 4PS0A 1Y7HA 3MW8A 4PYKA 1IAVA 4JI2O 1X8LA 4DIEA 4OM8A 1J42A 3WYGA 5BVHB 3JVDA 1SUFA 4O2LA 4E7OA 4TUYA 1HFJA 3JAMM 4Y6SA 2VP0A 4QDJA 4NLLA 3EFFK 3AEQB 3K6JA 4AJOA 3HUDA 1NQ3A 2QNRA 5DGXA 4BASA 5EUMA 3FKSA 4INOA 2Z57A 2CXSA 4EDFA 5BW6B 5LZ2A 1D0VA 5CXUA 2HLDD 1I51A 2JH3A 1M2JA 4L75A 4LE2A 2ILMA 4BP3A 2RHJA 4KXQA 1NUUA 3NHWA 5K3EA 4JYMA 4AY3A 3BWEA 2EV9A 5FI1B 5JFTA 4KP4A 1NY6A 1KBHA 3PFFA 4DILA 1M10A 2QX6A 1NDQA 3O8QA 4X41A 1RIFA 5FLEX 3MTIA 1F7YA 1A9XA 2B4RO 4Z0NA 3ASNC 4KR2A 1PJCA 4JXXA 1TCBA 4FIZA 1Y3FE 2VJYA 5A6SA 2P6RA 3AI1A 3TB4A 2PSFA 4IP0A 4MA4A 3P26A 4Q7KA 3I04A 4B3MO 5DYIA 2WALA 1QO9A 4E22A 2R6GA 4J2TA 3FETA 1OROA 3H3FA 1GLNA 3W2IA 2CK3D 4FCCA 4GZMA 2WA2A 2X1MA 4TN5A 4DLLA 3R74A 3DW1X 5EC2C 1ZPDA 3ZUPA 1TTHA 4R2KA 3HCCA 1N32B 1MVLA 1FXKC 1WV0A 5EMHA 1AKWA 1ZR2A 2BDUA 2HADA 1JQLB 1W2BU 4JZYA 1H2SB 5IJZA 1VA4A 3ESCA 3CCLV 4JJGA 1FQWA 1OC4A 4II2A 3CVJA 2VRZA 2REXB 5PGMA 4G8BA 2VG8A 5EJ4A 2WSLA 3MJFA 4MCJA 1Q0HA 1P3Y1 5JSUA 1REQA 2XAFA 2CL6X 3C48A 4DQXA 3ZOZA 1T3LA 2CFTA 2IKSA 2BFCB 3PFGA 4ZMSA 3UYLA 3E0QA 2WD9A 2OXFA 4ZTZB 1R4NB 3IBTA 1AMUA 3AL2A 3Q4HA 1GAWA 4KN5A 1RD4A 2ATCA 4YROA 4BV2A 4L1KA 1GX1A 2M9MA 1UWKA 1CNEA 4OHMA 4Y9UA 4MWTA 3DDNA 3K71B 1L4UA 3T15A 2QS9A 3UHAA 4AX4A 3LUKA 1O2DA 2RHBA 4L8YA 3AVYA 1YRQA 5WRFA 3K5WA 1XKLA 3A1FA 5FL7A 1T3TA 5ERYA 2PN1A 2ZYVX 3TETA 2FPWA 4WLOA 3P4YA 4J94A 4B3DA 3WWPA 3ZWYA 1L8QA 4PG6A 2GZMA 1KS2A 5CPFA 4CIVA 5AXAA 1K27A 3RAFC 1HZZA 4H3HB 3PEWA 1TAUA 1FX0B 3N75A 1YQWA 3V4RA 3MOGA 4U3FH 3DCYA 4G36A 3WADA 3KQPA 4AWXA 3UXMA 4E70A 1ZCJA 3LWDA 3I01M 2G09A 3I42A 4EG7A 1R3UA 4QECA 1YF2A 3EQ9A 1XELA 1W4AA 1UDRA 2IH5A 1VKJA 1BWPA 4RS4A 4UUJC 4A0QA 4HFJA 4ZYYA 2QD3A 1CUDA 4TLEA 3E86A 3SBOA 3SJQC 1XP8A 3DXZA 2K1SA 3EIFA 1U0HC 2HRDA 5BNWA 5EZ5A 2WLIB 3IPXA 1QG0A 5H3HA 4YJDA 4PBRA 4YONB 2QTOA 4XD7A 2PT6A 3NUGA 4ZTBA 1BJTA 4YS6A 3TLKA 4JKOA 4LYYA 3N2GA 5AKIA 5JSHA 1QHYA 2Y0CA 3I64A 4I1YA 1GSIA 3QA3E 2KYRA 4DJTA 4D45A 3B3FA 4TTRA 1FNJA 1U3UA 3G88A 3LA6A 2DQ0A 3FYUB 2H7CA 3II6X 2RD2A 2FTKE 2LV8A 2ZI6A 3W5CA 3K16A 5B58C 4B80A 4LP8A 3L8EA 2WSSA 5TMEA 4KL1A 2YZKA 3ZUGA 2QL7A 1R6XA 4IG9A 3Q0EA 3CR8A 4CCAA 3GP5A 1QGUA 4WZAE 1ZRMA 4QFMA 4EATA 4Q7EA 2CXHA 2VJBA 4H2DA 4V0LA 4J0EA 2BSQA 5KQSA 4Z1MG 1LDNA 4J75A 1TUBA 2PHZA 3OIDA 1FYJA 4C0HA 2YYSA 2Q2QA 1CP9A 5I7SA 3MAAC 1YTUA 1CERA 2FCRA 3QVGB 3LWQC 1X74A 2Y4TA 3OMNB 2DQZA 1VOTA 4KO2S 3AVXA 1Q0QA 2Q29A 2J7KA 3ZZMA 1GSOA 1PK9A 2HRBA 3KCYA 4CS2A 2QEXF 2P6MA 4P7GA 2ASEA 4N39A 1P6XA 5FV4A 4ZYVA 2K2QB 3ANNA 3L07A 1SU6A 3K70C 3LDHA 3WJ2A 3DNMA 1P0FA 4Y2JA 1E1RG 3T0FA 2HH9A 4LY3A 1XKXA 1BMDA 3QQ5A 4EFKA 4YP9A 1YZYA 2QNIA 5FDFA 3PLAC 5BRJA 1ZFNA 4OQFA 5DNVA 1QS0A 4G65A 2YTZA 1S3FA 4B4OA 4LK3A 1QG2A 4TMFA 5KWJA 1Q0LA 4RAQA 1B0AA 4YR7A 3EVEA 4RABA 1NZDA 2EIHA 3EXFB 1ZRHA 1NVPB 2I7DA 3IKMB 1IVNA 2M32A 1H2EA 5J9FA 1W96A 2PGIA 2Z83A 2LIVA 1GO3F 2R1ZA 1FJGB 4F38A 2X86A 3EPJA 4NULA 1T3ZA 4QUEA 2OB2A 2ZRQA 1DKQA 4W5NA 5T7BA 3CMAV 2Y0IA 1TF7A 4PRKA 1XEXB 3PTZA 4OP1A 3G6KA 4L07A 1NHGA 3GB7C 1CUFA 3LJKA 2QVGA 1H23A 3DHWC 1MPXA 1P61B 2XECA 3HR7A 2YXZA 5E4TA 3WDLA 3GIWA 3AP2A 1CUHA 1P77A 2OQRA 3AETB 1E4VA 5HR5A 5IKPA 3ZZ1A 4CQLA 1QZXA 5M34A 5IYZB 2HDNB 4FM2A 3MS2A 4Q7MB 2PZJA 2DFVA 2W9XA 4GO1A 2D2CB 2NADA 1ULSA 3H1PA 2GRJA 4FGZA 1SXJA 3GJ0A 1T8TA 3ZDAA 5IDYA 1SQXH 1BGXT 3PHGA 1HSZA 3B36A 2WU1A 3OR6C 3VJMA 5E4FA 1PP9H 5AUQA 1U63A 4HLCA 1Q6YA 4J7CA 3PNSA 5G0TA 2R7LA 2KTUA 3SKXA 3VU0A 1A50B 3L8HA 2GXAA 4COOA 4L5YA 3W1EA 5B4UA 2P3OA 1M1YE 3E8HA 4TMYA 1EJ6A 5HCUA 4MS3B 3KLBA 3PC2A 4RSMA 1PTJC 2WW8A 1K97A 3QEBZ 2HUPA 1COWA 2YVUA 2IITA 1RRPA 4XWWA 4MQ4A 2W8BB 3A04A 4CT0A 4US1R 1YZVA 2POQX 5JO0A 1UXGA 5IUKC 2O2YA 2ZAOA 2YJ6A 4R2XA 2CLEB 2ZQZA 4YT2A 2QYSA 3S28A 3QV1A 4HYQA 4DIKA 3OFND 1SUPA 4HQFA 2QR2A 2XF2A 3T0GA 3PNVA 3GOHA 2WJJA 2YZ2A 4FE7A 3KWJA 1BNCA 1VLQA 4PWTA 2X2OA 3SZLA 5CCBA 2C4VA 4E09A 3VH3A 4IYJA 3T3EA 4DLNA 3WRWA 3FDFA 4AB1A 2NLJC 3ELBA 3DAHA 4RZSA 1YTFD 4OM7A 5CYOA 3IDSA 2EL7A 4TVKA 3I2YX 3RBAA 1JHYA 2FPOA 3CCSF 2PGXA 1VE5A 5A4KA 4X20A 2WMDA 1C3VA 1DG9A 1KEEA 3QE9Y 2YRWA 1WZUA 1EBOA 3E4DA 3N87A 5ALYA 1BHSA 4LISA 4I9QA 1JAIA 1EP2B 4CNBA 4FLYA 4NFYA 1Z18A 1NTRA 5FULA 1FYXA 2BEKA 2ZUUA 2HXGA 2X0NA 1U6KA 1PF5A 4PGAA 1G16A 3KHTA 4JAVC 1XX6A 4RKQA 4BNGA 4HUJA 5KYXA 4K9QA 2J3IA 5I9TA 2H07A 4XH9B 3W5BA 4GMHA 1N2ZA 3E5NA 4X5OA 4N7MA 3WBJA 4LI3X 1Y8RA 1JB9A 2WLHA 5EZSA 2F8LA 3JAKA 1EB9A 3RG8A 1X9HA 3LO8A 2AUTA 1XVLA 5C1OA 3PEUA 2FUEA 5JJJB 4AMBA 1E7QA 4PPFA 5D1HA 4DR5O 1KF0A 2QRZA 4S1OA 3HZHA 5C8YB 5BR1A 3UHFA 5JJLA 5B5SA 2OT3B 2GCOA 1JE1A 3TUJC 3IVAA 1YF3A 2Q6OA 2QVZX 5CB6A 4I8IA 4C7UA 2J3EA 5DMXA 1GNPA 1M5TA 4Q9KA 1HYQA 3X2QB 3VPCA 5FQOA 4OHPA 2OOKA 3NMUF 5EC1C 3MCQA 1MTOA 4KDEA 1JKFA 4BWFB 4B83A 4DV0B 5AJUA 4EPWA 3IERA 2ZYGA 4EY6A 1EFPB 2JHGA 3RBZA 4NMHA 3KD2A 4L2IB 1U0RA 4Q7LA 4ZOQI 4JVNA 4TWIA 4I9HA 4S35A 2UZ3A 5JMOA 1NLYA 1EXVA 4XR9A 3TNJA 3NW9A 4XX1A 4BZPA 2QF7A 3AZPA 4DYLA 1Y1TA 1AKEA 4XYGA 5DTQA 3ROTA 4N82A 1XBTA 2IBMA 2V4UA 4CG3A 1MVNA 4GNKA 3KT6A 4NU5A 2YBDA 2I80A 4CM1A 4CFYA 4CMGA 3GRYA 2P7IA 3C9SA 2VVTA 3BX1A 2QN1A 3H65A 4IXDA 1YJWV 3E9QA 3L0SA 1SF9A 3KEOA 4DHEA 1E32A 3GLGA 4RTJA 1MAUA 3ORFA 3H1GA 3GEIA 4JSRA 3IUMA 3D7NA 4JBYA 4ZVOA 3QP9A 3GB9A 4AC9A 1ZSNA 4LXXA 2YASA 3KKZA 5LP6C 3H18A 3MF4A 4B33A 2RMKB 4KV7A 5IJ9B 4UM7A 2OCPA 2Y1FA 4LH6A 2FPXA 1KU0A 4V0KA 2HO4A 3QFHA 4G1CA 1GRNA 4ZT2A 4CUZA 5AW6A 4DG5A 2OCDA 5DNCA 2QIOA 2ZPTX 1LDYA 4PD4F 1GAQA 3UTDA 4GKJB 4KXXA 3D6NB 3WWCA 2HDHA 1IBKO 1NNSA 1QYRA 1LBTA 3P2OA 2P68A 2J3LA 5FFFA 2Q0AA 2X9QA 3O65A 1JZQA 2FPLA 1VF6A 4W63A 1YR1A 4YDRA 1DV1A 2VP5A 2A1TR 2FDRA 4YUXA 3IR5A 3CSXA 3ZY5A 3TQOA 3RFUA 4ZANA 1QLJA 4O4IB 1Z6GA 2LR0A 3QU5A 3PRHA 1SXHA 2W4IA 4Y6RA 1ZYUA 3QVXA 1JSRA 3W5AA 1H05A 3KAPA 4PZCA 5AHRA 3DFMA 4DLSA 3CEJA 4F4FA 3LPMA 1NR1A 4CIAA 4LWQA 2GCPA 5L4NA 3MIZA 4ROTA 1W52X 3BIFA 3KYBA 1IEVA 2FUKA 3C1UA 1XV2A 1NPDA 2O48X 4H6XA 4FLEA 1JXQA 2ZSFA 5IEBA 3SPHA 4N76A 2FAXA 5HGJA 1IHXA 3GLSA 2I4MA 1RLJA 1E59A 3ASYA 3TIXB 4WFHA 2AW5A 2GJ8A 1OI2A 3E70C 3G6BA 1KSFX 4B3FX 3C3AA 2PA3A 1CJSA 3RVBA 5LVAA 1TDJA 1TGYA 4TYQA 3EPPA 3ZV5A 5BURA 4KOAA 4D9JA 1GN4A 5B37A 4KYIB 3IILA 4ND7A 4EJSB 4KU4A 1HDYA 1LUAA 4PSKA 2Q3EA 5CB8A 3OZXA 5KMGB 3FR7A 2J6IA 4IEEA 4D6YA 4CKYA 4EF5A 4KLZA 2G1KA 1YNOA 3TBKA 2GBCA 1FU7A 2VUTA 3SYOA 1YRHA 4CUKA 3S02A 2QE7G 2F00A 3RROA 1FJXA 4LCBA 4JQOA 3PITA 4LBVA 4DKJA 4MUYA 4RADA 3MRSA 1Y7LA 1V55B 1JX6A 3L8DA 4FQ8A 4DV4B 4L0QA 2JIQA 3CH5A 1IN8A 4ZGWA 1X15A 1LBIA 3VKVA 1WJGA 2QQ5A 3TM5A 4RU1A 2BTQB 4URWR 1Z2AA 4JI7B 4QREA 3KE1A 3IQEA 2FW0A 1RHKA 1OTHA 1PJLA 4XWYA 5EJMA 1FNMA 5KYVA 2VWPA 4N9WA 4WCFB 3JQCA 4JC8A 3STXA 2IDJA 1MTZA 4ZCPA 2G83A 2C97A 4DCOA 4FZ0A 1R0RE 4REOA 4E03A 3PWKA 3PBKA 5GOTA 3NFRA 1TYDE 4HX5A 2KB1A 1UKAA 3A6FA 5G0WA 3FBAA 1IBCA 3FCEA 4R9RA 3C2QA 2HJRA 5CVJA 1DC5A 4B3HA 1O94D 1NW3A 1ZQ9A 2O7VA 4AXXA 2VAVA 3KKQA 1KARA 1XZLA 2Q0OC 5A03A 5LQCA 2PIDA 3RNOA 1LPPA 4IXMA 3FPIA 3SQMA 2IEIA 2XUPA 2XF8A 1GKYA 5JPCA 3G2KA 3PN1A 5AOVA 1EVIA 3T7SA 5LB4A 2JDIG 3TMAA 3H0KA 4Y2VA 3NBAA 4UE3S 3CY6A 4NIMA 4CCYA 2LKCA 3EGDB 2HCRA 1Y4SA 3ND9A 3GEPA 1I10A 1E18A 4D8UA 3AZOA 3JCMM 1JJIA 1E2UA 3D9QX 3MJVA 3OTQA 5AVJA 4OGWA 2FZ4A 1R6KA 4L5CA 1K7SN 2WOJA 3O4FA 1DKRA 4GM1A 4OB8A 1ENYA 4B7XA 3NBQA 1P6UA 4DQVA 1TM1E 2HBYA 2FZEA 3G0OA 2WYUA 2UZAA 2LW7A 1G1AA 1P18A 1NQXA 2F43A 4H7DA 4XXHA 3NVIB 5AD1A 5JXIA 1KQNA 3VSDA 2VDWA 5SZIA 1SVOA 1GIAA 3VDMA 2NN4A 3H1HH 4O4HF 1E8NA 3NIWA 4NQ3A 3K0FB 5FX2A 1QNMA 1L5ZA 2P0EA 4P35A 2BC9A 1HDJA 2VC2B 4PICA 2AEFA 2GT1A 2XE4A 1ILWA 1NOKA 3B6JA 3GHYA 3Q9LA 3T5PA 5GGXA 3ERCA 1JR2A 3STWA 2WDZA 4QYIA 3KJGA 3T3NA 2AMVA 2JNBA 2NUPA 1ZNQO 2L69A 2QAGA 1ODLA 5E1BA 5KUTA 1HF3A 4Q3LA 2IP1A 4I1UA 1OZHA 4YJ3B 1UOEA 3FCCA 3LQ2A 1PJAA 2ETNA 4AKIA 3JARB 9ATCA 1KTIA 3E35A 3RJ9A 1IURA 3B5JA 3TQCA 1RBZA 4R2HA 5FNVF 4OSEA 5FFNA 4CEHB 5J58A 4MVRA 3FCYA 4OFBA 2J31A 1QC5A 1OBCA 1U1IA 5CGQB 2PRYA 3V33A 1NW6A 4GDMA 3WBKA 4JHLA 2NV0A 2DLDA 2GA8A 4FCVA 2DYYA 1HDOA 2EDAA 1UANA 3VRHA 4DR7B 3MGBA 4HLNA 4PHCA 2W00A 2JK0A 3GROA 4Y1GA 3PR2B 1JDBC 5IWAO 5ALZA 5AW5A 2F3SA 3ST7A 1E1NA 1D0SA 2GBLC 1GEGA 3R65A 1HUQA 5DN9A 1HTWA 2W2LD 3D1LA 2IGTA 4FIDA 1Q83A 5JH7F 1P0MA 3LX5A 4DIFA 2HHLA 3IAM1 4Z99A 2PR7A 7ADHA 1FPOA 4O2RA 5DK6A 4MQBA 5FH9A 4X94A 2NO1A 1X80B 3LP6A 3OZSA 2JFBA 3NDJA 1U8YA 1KU6A 1RKQA 3O7WA 3OTWA 1XE3A 1KEZA 4PNZA 3ZYCA 2Z5UA 1YZKA 1UZNA 4YO8A 3WOHA 3FNHA 2J1LA 3ZEDA 2IIQA 2JIOA 4DADA 1CE8A 1KDVA 1KE2A 1OA1A 1IZ7A 1EFRG 2QX9A 5IKMA 1GFWA 2R1UA 1UEIA 3U60B 1ZSYA 1LRJA 3RVDA 4YPOA 1MDFA 3O3MB 4EW3A 1OPRA 3BZUA 2PL3A 2IHBA 1WS6A 1S8NA 2N04A 5SYNA 3ON5A 2H18A 1H4VB 2NU6A 5KJCA 1SEVA 1ZK0A 2AVDA 2VJOA 1VBMA 2AEJA 2J30A 2BGUA 5EJIA 4U2GA 5DKFA 4IL5A 4P7BA 4HDMB 2ZIUB 1KL7A 3AEXA 5JNUA 4UTRA 1GUBA 3P1JA 4JLMA 3NHZA 3M8AA 2HPAA 5B1SA 3BPZA 4BJHB 3PHLA 4P93A 2FWNA 3W7WA 5KVVA 4OX9O 4E14A 4MYSA 5E6SB 4ZVSA 1XUOA 4J0KA 1CUWA 1EESA 2PJUA 4INPA 2QKYA 5LXTF 2TS1A 2IPNA 3SEZA 4RD3A 7REQB 2ACVA 1OLXA 4WEQA 3HJRA 4IIVA 2BM8A 3ITDA 3A0BZ 4U7DA 2E87A 1C80A 4J0IA 5HWEA 4CEJB 2JGUA 1WMSA 1SOWA 3GJ6A 3QRWA 3ZY3A 5K0TA 3AVPA 2I1VB 1U97A 1U90A 4EYQA 5CK4A 2BFWA 3BSFA 1KEPA 3MBMA 2Q7XA 3NM5A 3U1VA 3EE6A 3L8GA 4DOMA 2XB6A 2PRIA 3DEIA 1W5AA 1YR7A 2VS0A 2YHIA 2RAPA 2NR5A 4MQLA 3UJ6A 4M36A 3I9KA 5AXCA 5DGCA 3BS4A 1XZEA 4XGRA 3Q9SA 1XL6A 3A9VA 4PZZA 1AJNA 2QRKA 4JI5B 2UYQA 1N7JA 4JLDA 3EDQA 5A0TA 2VWQA 3S1AA 3JD1A 5JS7A 2WICA 4MGHA 2VHTA 4OIMA 5ITVA 2V7XA 5GTDA 1K88A 3TIFA 4AO7A 1D3AA 2QTPA 2UUOA 3ESRA 4QGPA 3L6EA 1M66A 1WM1A 4WXPA 4D8TA 4LG1A 4XEUA 1JT9A 3EEYA 1T25A 1FRZA 1SZXA 4YMIA 2V9CA 1RXIA 5FHRA 4M1TA 2XYPA 1J0XO 3A3PA 1VGRA 4Q7QA 2X7JA 2VYNA 4CMIA 1ZOPA 1EE1A 2J0SA 1ZNWA 1FFCA 3HWRA 1RWNA 5JXJA 3WISA 3NV9A 4OGFA 4BVKA 2VH5R 2XD4A 2C2WA 1OA0A 2BH2A 1F2UB 5A6VA 3MWFA 4IDGA 3T95A 2B94A 4YJFB 1L5YA 3G4SF 2HIMA 4ZIRB 4P3OA 3QFFA 4FNMA 3V2UA 4B4VA 2EIMC 3LGSA 4P38A 3ZWAA 1PIWA 1JLKA 4EHJA 1EUZA 1Z4NA 3FMVA 3K0SA 4JI6B 4MLDA 2FMTA 1U0BB 2OCKA 3CW9A 1OFTA 4N5NA 3DM5A 1NVPD 1SQSA 4CS3A 1TI7A 2HF8A 1BL8A 3TTVA 1FVOA 5ERXA 2GEDA 4MWDA 4EUSA 1P2UA 3CUTA 4YAEA 5EN4A 1UWLA 1DTWB 1NVTA 5DFAA 5FLYA 5THXA 2GF9A 4YX9A 2PUSA 1KC1A 2PYDA 3HK2A 3HY3A 2D5LA 5E1DA 3A3KA 3RVMA 5GV8A 3K6SB 4PG5A 1TCUA 2QMHA 1Z6XA 4FHEA 4HWSA 3NTVA 3H2HA 2P9CA 4G0YA 4BCDA 2VNJA 5JWHA 4ERNA 1EZ4A 4GQBA 3MYRA 2Z4RA 2DMRA 4CIXA 1Y8QB 4IM7A 3VU1A 1JHRA 3ZWBA 1RQ2A 3Q3IA 1CDEA 3LBFA 1XZNA 3EDOA 4JJEA 3DT6A 1FXWA 5IYBO 3DDZX 1DUSA 4E13A 2QTBA 3GZ4A 4IGEA 4DS3A 3K1TA 4CTNA 2BPOA 2UU9B 2QL5A 4YI5A 3HFRA 2BGIA 1LX7A 5G4LA 3CX3A 5JZ9A 4ZO7A 1JFVA 1YA6A 4MHSA 1GCAA 6NULA 3SFVA 4XAQA 2HHHO 2X8LA 1JBKA 3VNQA 5AHOA 3VTKA 3ETLA 4NJMA 5LBIA 3CG0A 3TLGA 3PX2A 4KRYA 1N32O 1K7YA 4Q1VA 1KBZA 3NIGB 3PFNA 1GYPA 5MF6A 3D7KA 4OQ4A 3RKRA 1YHQV 5EWMB 3REFA 4A5UB 2VDVE 4CIBA 5HBRA 3ANMA 3S0HA 1XLTC 4ZI7F 2O2GA 3R75A 3VO8A 5BV0A 1UWCA 4I50B 3GFOA 1ECFA 4NZYA 2QRJA 4ZQFA 2G0NA 4L6CA 2RGXA 2HBZA 4KVFA 2HVYD 2NU7B 3KR0A 2C9OA 2V7BA 4LRUA 3WICA 2Q68A 1QUFA 1V6CA 2YJZA 1SUWA 4HPXB 4YECA 2CE2X 2LCAA 5DCUA 2X5NA 1K1EA 2J0UB 2C2KA 4MLCA 3EWIA 5LKRA 3SM9A 2WA1A 4G09A 4KACA 1MENA 4NKRA 3IBGA 1G4YB 4AKEA 4M0DA 5DK4A 5CDFE 3BBLA 1SUBA 4EIWA 2FEOA 4PYRA 3SICE 1SC3A 2NNLD 4PYJA 3T8YA 1MEEA 2O9JA 5LBTA 5EE3A 3RF6A 5DSTA 3BQNB 1DPGA 2AH5A 5M04A 3CCMF 4TZ0A 1RKXA 3CF4A 3CNNA 3KJXA 1XQ1A 5AR1A 3M3HA 2YMQA 4LWOA 4XLZA 4CM9D 1E79G 1IN7A 1I2ZA 1GNRA 3OD4A 2OCYC 4FK8A 3ME5A 1Z0FA 1E9CA 1SAYA 5I8PA 3VU9A 3WLLA 1LK5A 3E3LA 4IRXA 2HXSA 1NKSA 5LL6Y 5ELMA 5LQNA 3CEIA 3R8CA 3QXCA 3QELA 3O75A 4MS2A 1M54A 1RI2A 4YV2A 4Y67A 4BRSA 4JEMA 5CJJA 3P97A 1N8SA 3ZDZB 4Q3NA 1P80A 3ZS8C 2JFVA 4F92B 4JTDB 2APJA 3OM0A 2ZVZA 1G17A 3GEDA 3MPOA 1U6IA 5BT8A 1H2YA 4BUJA 1TK2A 4RIEA 3BXFA 1J8MF 1J24A 4S1WA 1EFHA 3I2FA 2COUA 3EHBB 2I71A 1Z7YA 4KXRA 1G9XA 2CHFA 5LA6F 3JAWA 4MW8A 3CBGA 1PEAA 4PYIA 1PR2A 1X2EA 4RMNA 1XWIA 1U9YA 4LWSA 3IMGA 4J4BA 3PG5A 3CCRV 1T3HA 1VE9A 1ISJA 5TX7A 4D4LA 3BPSA 3KHSA 3L6BA 2CNNA 5IPFA 5IBPA 2ZDHA 3F0GA 3KJEA 2A5JA 1EX1A 2ZAMA 3FMFA 1PWEA 2OKGA 2V5AA 5JT1A 2GZ3A 4FGLA 2G07A 2AE1A 5K8VA 2GETA 2Y4NA 1M5RA 1ODFA 2GLXA 2IY9A 3OPYB 4NFSA 1J0EA 1M83A 4OYLA 3KIZA 3UKOA 3TRDA 2DETA 4F7DA 3LSSA 4DIUA 3F4LA 4NENB 3JQ9A 2VT6A 4MW6A 2D74A 3GRCA 2E4WA 4KQXA 1A71A 1L7PA 1K6EA 1HFKA 2G0AA 1UZLA 2RKWA 2V7QD 4BB0A 1L1RA 4QE3A 5LD2B 2E5LB 2XOKA 2IJJA 4LJ7A 5D01A 2XXAB 5CAEA 1VQNV 1QU2A 2ADPA 3I5MA 1WA8A 1KQOA 2PMPA 4TS3A 3DL4A 3V48A 1PR0A 2ZS7A 2GMWA 2XA2A 1GPNA 1NUHA 5MN4A 1FLDA 2H54A 1XKTA 3T7JA 1Y9DA 4RANA 2CJWA 1UEJA 4EO9A 1S4QA 3KFXA 4FINA 1E1CA 5AKKA 4JLJA 4J7KA 2Z2JA 5HXUA 3IKEA 2NZUG 1QAQA 4PA6A 5BT9A 2BGRA 2R6HA 4EMUA 1ADGA 4OHWA 4LF9B 5HTKA 2UUCB 3K9LA 1TF5A 2O59A 1QU7A 2YN0A 4YBRA 3A1UA 1X8JA 4DIOA 1K9MW 1N5RA 5KHHA 3PJGA 5D6NA 4Y30A 1JALA 4C4ZA 1DXHA 2UXBO 1HZJA 1X3LA 1ZOIA 5F35A 1D7AA 2HA0A 3SQNA 3RUPA 2MMGA 2PLAA 3D3JA 1RYHA 2XUOA 3B5IA 4YMSA 2OKCA 1XBLA 4BNVA 3IXLA 1F6BA 4Q4AA 4DM3A 2IU6A 2YEVA 1WZ2A 3A4MA 4OUDA 3O2SB 1FRNA 2TSYB 3KVRA 1V2GA 1RBMA 1FKAO 1ZLZA 3QVKA 1GFZA 4QGGA 3A1NA 1ROPA 1HLGA 1O4VA 1ZMBA 3DSQA 3VMFA 3LO5A 1QYCA 2C31A 3AG7A 4JJ4A 1P9WA 3WGKA 3R5KA 1P1IA 3H1FA 1DBRA 2Z6QA 4E1VA 1IJEA 1PG0A 5C3UA 3K4QA 1G9TA 3GG2A 3LIPA 1S5HC 5HNKA 4XX0A 3VH2A 1NJ5A 2Q5IA 3W04A 1E6UA 3FFTA 2HS0A 2B8NA 2J0EA 2PGOA 6Q21A 4FW9A 3S8EA 1XWFA 1B93A 3E8GA 4IAOA 5HQ3B 2ZGVA 1VPWA 4ZPJA 3SR2C 1EUYA 4C4RA 1OTXA 4PINA 5C4IA 3FR8A 1WMFA 2ONKA 2ECOA 1R0LA 3C8ZA 3R7BA 3B89A 1IG0A 1Z34A 1TU3A 2DBVO 2X23A 3TFWA 1IM2A 3COPA 1OXXK 4W9NC 3AEKA 5ICFA 4RLSA 5EWLA 1FBNA 4UEKA 5JJBA 3O1JC 2HAEA 1ZGGA 2I0FA 5JXWA 2NZJA 1WSWA 2V7UA 1SXIA 3BCHA 3AC0A 1SHJA 5IBCA 2PANA 5HS4A 3R3SA 3ZDCA 4JBXA 1ZAYA 5IC5A 4G0OA 3APOA 1EBUA 1YITV 5B58T 1GNLA 1CQJA 3YASA 1EB8A 3GA7A 5SYMA 4HDQB 4AULA 1QZTA 2ZUEA 2NV6A 5F2NA 1NAHA 5AKXA 3ASNB 4U7OA 4G0WA 2A0YA 3ZNPA 2FRXA 2O8VA 2JHFA 2GAJA 2PGNA 1P1RA 1PZNA 3VYUC 4G25A 4GECA 4EB0A 2QGFA 5AJHA 5G4UC 1M76A 3H19A 3F9CA 3SVZA 1JJVA 3E2MA 3FZYA 1JHPA 4HV4A 4POOA 3R6DA 3WU2Z 3DAGA 4LOLA 3L0IB 4JFAA 1IOWA 4HAOA 4BB9A 2DH5A 3IE0A 5KYYB 1FTQA 1UBEA 4C87A 1FXKB 4MIEA 3N1UA 1X1AA 1VC2A 4EEKA 1Q7YW 4PO9A 5C8XA 4MGYR 4XWKA 2R8YA 1FLAA 4ZC8A 4OXIA 1BE1A 4LZJA 2I4LA 5EIBC 4N0DA 2FQWA 3H5RA 2BZSA 4OSPA 3A1DA 3RRFA 3F6MA 3O85A 4IOMA 3P32A 2HHCA 3QMWA 4YRRA 1CDDA 3AHJA 1Z4QA 3VQWA 4CYMA 3GVMA 3OKAA 3S4YA 3HBLA 2X7HA 5CEJA 3RFXA 2QTVA 3C6ZA 3L7AA 1PVDA 4NTXA 3QBJA 1SIBE 2DFKB 5ECYA 4B0PA 5BN5A 2VUIB 1NXXA 3L9XA 4S1TA 1GM8A 2EJRA 1I7PA 2HJDA 4GOJA 3DV0A 2EIKC 5REQA 1R00A 2INGX 3C3JA 4BZQA 1HFWA 4IHQA 4EKEA 1Q1EA 4HDSA 3OE7G 5FOTA 1H5QA 3GJSA 2YNMA 2W2XA 5H9WA 4AY5A 3DWIA 1YBFA 2EIJC 4KKXB 2FJPA 3B1WA 2BI7A 3TRFA 2H51A 2R48A 3L46A 2JIPA 4C22A 1KC8H 3HB7A 1P7GA 2O8DB 2B7BA 3BH0A 5AXBA 1QH1B 2K2WA 4OA8A 3TQFA 2DX7A 3HRHA 4I1VA 1A7JA 3E53A 1NJ1A 1W6UA 4LXTA 2FWAA 4F86A 1I4WA 3F1LA 1T0BA 4JT8A 1NW9B 4AHCA 1T4CB 4L22A 3OJLA 3O0TA 2KSDA 3SE7A 4PFQA 1RS0A 3KJQA 2YFYA 3EY4A 1XD2B 3JR3A 4LVCA 2I2FA 4MR8B 3NHYA 3RANA 5DNWA 4L16A 2DCMA 1E2MA 4EEXA 4AJ1A 3HN6A 4RENA 4BKUA 4P36A 1VCOA 4CMEA 2HK8A 4MTFA 5J2TF 5FL3A 2BGJA 4JEUA 1X1RA 1Z63A 1SK9A 1AU9A 3AR9A 3HVKA 4PDVA 3CXRA 5D3QA 3CVUA 2V9YA 4GEGA 4Y9TA 1I32A 4MMZB 2EBHX 3ZZ0A 4AS1A 4X60A 2WFAA 2GN8A 2J46A 2J4FA 4R1LA 4DM4A 2C9DA 3RUEA 2WIFA 5IXSA 3Q5EA 1O0SA 4X66O 1RVV1 1R0BA 4RLFA 1M3SA 4RXUA 1Z08A 4B9AA 2H2IA 3QYFA 1PGQA 2G38A 3CWBH 2WZDA 2BM9A 4UFZA 2Y0EA 2AOWA 3O4VA 4QXMA 2FFJA 3OOYA 4LNHA 3SHVA 4GKJO 2C3YA 2Z1EA 1TJ4A 5BYBA 4P32A 2PS0A 4OI1A 4MS1A 1N33B 2GERA 4IQ0A 3QY9A 1OTYA 2C61A 1KAGA 3PC8C 1W44A 3IP1A 5JY6A 1GGHA 2LWIA 2NZVG 2Z1FA 4G86A 1ZX1A 3LX6A 2DAPA 2CY0A 3A6GA 1I6MA 1AGPA 1NFRA 4LZAA 4KYVA 2FTKA 3PC6A 4IDBA 3NHLA 3VM6A 3NHMA 4J1TC 1P7VA 2OQIA 3FWHA 3K72B 4JBIA 3H5NA 4WZAA 3MA0A 1AZTA 3LNNA 3KKEA 1R9JA 1WU8A 3KUUA 1SZQA 3RJMA 1HR0B 1XQ9A 3WTCA 3D43A 5DPMA 4QXOA 2XAGA 2BKVA 3IP7A 3OZEA 3K70B 1TIBA 1PR5A 1P31A 2BE3A 2F4VO 1VQKF 3A3OA 4M9XA 4IKEA 2EX3A 1O95D 4FD2A 3SR4A 1RT9A 1A7UA 1UOQA 4LVOA 1HQCA 2G76A 1C3XA 2W90A 4ER6A 4JP3A 1UK6A 2PY6A 2D2XA 1QO7A 1ZIDA 2ZU0C 2CD7A 3C41J 4N1AA 2FOLA 4FS8A 2EJWA 1ZWZA 3OCYA 4TT3A 4DR1O 1E9EA 2GN1A 5MN6A 3DC5A 2F1IA 3QEKA 3K1AB 4ZQGA 5DM70 1YQNA 2I9PA 1GVHA 1XXHB 2ODWA 4D8WA 2FWMX 2LKDA 4RV5A 1GGVA 4Q4JB 4FWIB 3RA5A 3W05A 3E2IA 4I8XA 2FPGA 4UAGA 1HEIA 1KKCA 4PA3A 4MI3A 2ZRPA 4AXBA 4IIJB 2PYJA 5GQSA 3HXKA 3EDYA 2G25A 2PX5A 1FCJA 5H0IA 4QA9A 5E7MA 4KKVA 3MTDA 3NR2A 3GP3A 1CJCA 2R6CA 3G85A 4DV4O 3FNGA 2PUGA 2ZTHA 2COEA 3K9GA 2OPHA 1Z0JA 2F3UA 1IV3A 1K06A 3DVSX 4Z9AA 1E9AA 1UFOA 3AJ9A 1KMIZ 3NKFA 2Y1DA 1VQ1A 5ARCA 2VFAA 3FTCA 3SX0A 3WFIA 3PF8A 4X3MA 2QPOA 4J1NA 1OX5A 4EGQA 4BIMA 5DYTA 2ZJ5A 4MTXA 1BW9B 5B2ZA 3RB8A 4QNMA 2BGNA 1JAZA 3I6YA 4Q03A 3F0FA 1I1NA 1R0CA 3OY2A 4AYTA 3S2UA 2C82A 4MW3A 1BC5A 1VLLA 2FZVA 4XDJA 3GW8A 2B0JA 1MABB 4AQYB 2OD9A 2UXNA 2UYHA 4PFSA 4V0RA 2GCGA 1LI4A 4C6SA 2BE9A 2VDOB 4FVTA 2CTWA 1Z5NA 2Z5LA 3DA8A 3WK8A 2V7EA 5K4HA 3CVXA 3RSLA 2R00C 4PCLA 1NW8A 3SMVA 2IA5A 4PR0A 4C8EA 5FOQA 2B92A 5H7XA 3CV3A 1T5HX 2VRCA 3OX2A 4LHZA 4B6SA 2ILTA 2XMSA 1G8YA 1JKJA 4ZHYB 3Q0IA 3K1JA 2CXPA 5BW5A 2DM6A 3ND8A 3FBWA 2VQDA 4BVSA 3ILSA 1IVYA 3U6BA 4A3SA 4N01A 3ML1A 1QCDA 4MICA 5GIPE 1JEYB 1FMJA 4PZLA 4XTRA 2GO7A 3PT9A 5G4KB 2Q3MA 1MNAA 4AJPA 3GARA 4NBLA 3PV0A 1HE5A 1M1YA 3H7AA 1I5YA 3U17A 5BP7A 5K0NA 1WWKA 4PGFA 3ZJYA 4XIGS 4J6FA 4HGQA 1BWRA 2ZDQA 3EFOA 4A36A 3C43A 4FFPA 1RPNA 4EPVA 9LDTA 1EWVA 2Q27A 4UVEA 3L8CA 3W5UA 3BOSA 1VLMA 3RHSA 3ETNA 4WXMA 4JKIA 3IP9A 4EARA 1AQIA 1FSZA 2O50A 3PGVA 5LWQA 4WNCA 1UM9A 4LJ9A 1WXGA 4RNCA 3QVTA 4HNHA 2QSUA 5I51A 3C8LA 2H7YA 1JU9A 3AG1C 2YXHA 1E8MA 4MKHA 1IV4A 3W9UA 2V8BA 3C7DB 1GL3A 5L3EA 2XMQA 3W6OA 1M90W 5FI3A 3A10A 3L4EA 3RS8A 3U0BA 2AD5A 3NUQA 3BXGA 1GGEA 3OHPA 2JS7A 4Y3UA 1Q0SA 1QV6A 2YXBA 1VQMF 4XJSA 4DXWA 3LQKA 4QULA 1ORHA 1UI9A 4IIEA 3LCVB 4FEYA 2A86A 2QMEA 2OM2A 2CDCA 4YVFA 5FI5A 4IH9A 3CRCA 4BMDA 4QBKA 3F5WC 3TWOA 4MVJG 3HYLA 5K0JA 3P2IA 3AG3C 3L0OA 4MSUA 3E3AA 2PX4A 4G0XA 4JVSB 5BN3B 3T7CA 3V34A 4HWTA 4MVUA 1XOUA 1QK5A 2H57A 5I9LA 3H3XA 2O2ZA 3GBSA 2DKOA 3URMA 1JG1A 4CLOA 1M6WA 4UTVA 3EODA 1ZI8A 4J4TA 5CFZA 5EB0A 1Q86W 2CUKA 3IPCA 2CUTA 1M74A 4X1KB 2IV3A 2XLCA 4EEZA 2L18A 3KALA 5DT2A 1C8VB 5CT6A 1Z8DA 4R4JA 4ZJUA 1D1PA 5AI5A 3M3PA 2FZCA 4G41A 1KZ9A 4RD0A 5C93A 3UXEA 3FDXA 2P27A 5G53C 1ONOA 3FLMA 3FHOA 4W8GA 1RQLA 4LC9A 1T91A 5KVCA 3ET4A 4JI1B 3UO8B 3TMYA 1P7WA 5AWFC 4C4OA 4BY9E 1FX1A 3L04A 3BA6A 4CC6A 2FMLA 3PUIA 3WMRA 3K5NA 2Y1KA 5KWVA 3G1TA 4NCJA 3E8SA 4K46A 4YO7A 2ICAA 3LVRE 3K59A 1CS0A 4Z8XA 5TV2A 1U0SY 2Q1XA 1IUKA 1ZD9A 2WYVA 3OIFA 4AIRA 1XRLA 2UYOA 2HS3A 1D2RA 3N86A 1SC9A 3JYNA 2FK7A 3GJQA 4K6MA 3G67A 3PDHA 4LZNA 3IQZA 2I2DA 4KXYA 2CC2A 1R74A 1JDPA 3ORHA 1TEHA 4B45A 3OOEA 2HCFA 3WA6A 1LPAB 2C7BA 4QVIA 1EWRA 2IT1A 3Q85A 1BDHA 3PRJA 4P4UA 3HVJA 4UBJA 3THXA 3RSSA 2XKJE 2PWZA 2ZB3A 2PTGA 4RY9A 5EJ9A 1NF8A 5K3OA 1B42A 3UO3A 3BF8A 2KE5A 5JCXA 1RYZA 2NSYA 1IZ3A 4DPMA 2NPOA 4C3VA 3PUXA 2PBZA 3JD3A 1S8FA 5B6PA 1X7GA 2A30A 5CFNA 1DQPA 1M9NA 2Q67A 4QGAA 3RSFA 4CR7A 1IEQA 3NKVA 4X3OA 1DLBA 1G0OA 3CMMA 4GPAA 3B85A 4F71A 3KQVA 4A6PA 3UVEA 1USWA 4DBVO 4LJ4A 5DISB 2YYEA 3FSRA 2ID8A 2YQ5A 4DSNA 2WTUA 4DAEA 2PYZA 2C0PA 2MOKA 4N0EA 2OO3A 1SVKA 3IDAA 4Y2GA 4NWIA 3FJ1A 2H16A 3I6MA 2Q2VA 4FBGA 1GD1O 2I6SA 2YL2A 4BO6A 4L15A 5JPIA 5ILGA 3AK3A 1XK6A 2O8CB 4JSYA 1CV2A 1LFDB 4MW1A 3OT1A 3JQDA 1FYFA 3LLSA 1WG8A 1W25A 4Z54A 3B78A 3B1XA 3F6CA 5JCOA 4CPDA 1KYYA 2YUIA 4TYWA 2OZLA 1I6WA 3PFBA 1Y8CA 1YL5A 2O8EA 3DQPA 5DWDA 3WXMB 2AHOA 2GCNA 5ED4A 4DGQA 4ZU3A 1YS6A 1BRTA 4Y6OA 4WY2A 4FM0A 4CKXA 2I6RA 5IAKA 3I72A 3B3GA 4OGGA 1DC8A 5AI4A 2RGNA 3OM8A 2HSDA 9MHTA 2B8WA 1ZNZA 4QXRA 5FRDA 3SSNA 2JW5A 1KRWA 2ITCC 3HVUA 1PZFA 4G3XA 4GX2A 1TXGA 1PYDA 4NPCA 1PL0A 3CC4V 3LUBA 1Q84A 4J6EA 3CFYA 3L84A 4YLEA 3E7PA 3T9EA 1V4BA 4B2LA 2IQQA 3P9XA 3B6KA 4ZEMA 1FSSA 4E5SA 1WF6A 2ZBUA 4M1KA 3GVIA 3ONFA 3CX5F 3DDSA 1VKHA 3IMCA 4BT3A 2UZ1B 5I7EA 2ZKIA 4OGQB 3MBIA 1MV5A 4ZQBA 3S06A 5I3ZA 4ZVLA 3L6OO 3D64A 4TS4A 5KS2A 1K3FA 3WQBA 2FEAA 4ZT3A 3THWB 5B64A 4G81A 1P2BA 4FSDA 5CLIA 1K7DA 1OI4A 1XCPA 2NP7A 4KLCA 3WYBA 5CJ2A 5FR1A 4DN6A 4LS3A 4CKCA 1JH8A 4G67A 2WJPA 1UXJA 4J7XA 2O8FA 3FVVA 3HUTA 2ZR3A 1V7CA 4WADA 3RSZA 4HGNA 2N9UA 3ZK9A 3AHCA 1U2PA 1BFDA 2DTDA 4MWSA 3HLTA 2ORVA 4GSLA 2VPQA 1T0UA 1TL7C 2JGAA 1G60A 1NUQA 2Z6UA 4U7TB 4FZ5A 2DQ3A 1Y5NA 4G4GA 1ZHOA 4GR9A 4KWCA 3WGHA 1L9KA 2EILC 4IHJA 3RVQA 2QN2A 1E3TA 1R12A 5FI0B 3RAJA 2X2EA 1SCUB 1UIMA 3D0QA 3UWPA 2XGSA 4ZQIA 1WKVA 1SQFA 3VZRA 4BYMA 3EMDA 1AI4A 1WULS 3G9XA 1N1MA 4REMA 2JIZA 4RAOA 1X77A 4DLYA 2WSIA 2UU9O 1Y9AA 2IX9A 2AGAA 4QL3A 3U7IA 1P44A 1NW4A 5GONA 1PEKE 4V1CA 4E2FA 4WBNF 1O87A 2DW4A 2F9ZC 4YLYA 3DUWA 4J49A 5CYGA 3A4TA 2E1PA 1QUEA 421PA 3J7AU 3WE7A 1Q12A 1KP2A 4P2ZA 4DK1A 4LFCB 1BJRE 1YDWA 1E1QG 4DT1A 1WXHA 4XDHA 1FK8A 4TXHA 1BMFA 3T1OA 4LNUB 2DG2A 1ONPA 4EA8A 1Q95A 2YSUB 3E8XA 1J8VA 1PJBA 2CJYA 5HIMA 4UUQA 3KWFA 4GIBA 2Z56A 9ABPA 2YIBA 4PXAA 2UYNB 2QX4A 3OLWA 4QU8A 2Z3YA 5EVJA 4D4HA 3JQ8B 2XAQA 1XA3A 4KWTA 4RIGA 3LYBA 5B3JA 4NAVA 1T5LA 3DOIA 4EOGA 1Y5MA 1RAFA 3EGXA 4TTVA 2YFKA 4B2YA 5DTMA 4TSFA 5KHKA 4HJXA 5LLTA 1Y7TA 2RGWA 3G5AA 3BH7A 2O2JA 5DN6A 3PIRA 3BHPA 1TUEB 2OFPA 1AH2A 4YAKA 1QPGA 1VHDA 3D31A 3RIYA 1JR9A 2P2GA 5TIIA 1FP2A 3PXAA 1UMKA 1QFMA 1O6FA 3MLEA 3ILHA 2X1HA 2X4IA 1NQAO 1RJWA 3CZMA 1UBGA 1YQDA 1EG7A 1PZXA 3HP4A 2FJ0A 5HXAA 2AQIA 4OFZA 4YK7A 3RK4A 1W57A 4DC9A 1X14A 2WLJA 1SUIA 3WKAA 3S5JA 1H2FA 3UV3A 2X6TA 1URFA 5DHQA 4F3YA