3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
3ZIDA 1RQ7A 1W59A 5LYJA 5EIBD 1TUBB 1Z5WA 5LP6B 2RHJA 5CA0B 4M8IA 4X1IA 3RYCA 4TV8A 2XKAA 4LNUB 4ZOLA 5BMVA 4I50B 4F6RB 3HKCB 3JARB 4O2AA 3N2KB 4HNAA 1JFFB 3RB8A 4I4TA 1W5BA 1TUBA 3JAKB 4TV9B 3WGJA 5LP6A 5LXTB 2Q1XA 5CA0A 5CA1B 1W581 2R751 2BTQB 4LNUA 3E22B 4I50A 3HKCA 3JATB 3JALB 4O4HB 3N2KA 5GONA 1JFFA 3V3TA 4EI9A 2RHHA 5EYPB 4TUYB 4O2BB 5JQGB 3JAKA 3WGLA 4IHJB 1FFXB 5ITZB 2R6R1 5LXTA 1TVKB 5KX5B 5CA1A 5EZYB 5JCOA 4E6EA 3RYIA 4B46A 2BTQA 3E22A 3HKDB 5MN6A 4EB6B 3JALA 4O4HA 5MN4A 2Q1YA 5IYZB 2RHOA 5EYPA 4TUYA 5LP6C 4O2BA 4O4LB 5JQGA 2VAMA 5ITZA 1TVKA 3VO8A 4O4IB 4IIJB 5IJ0B 1FSZA 4EI7A 4ZI7B 1SA0B 5KMGB 3HKDA 4EB6A 4XCQA 4U3JB 4F6RA 3JARA 4O4LA 2RHLA 5JCOC 4EI8A 4O4IA 4FFBB 4IIJA 4TV9A 5IJ0A 4X1YB 4ZI7A 4KWEA 5CB4B 1SA0A 1Z5VA 5KMGA 4U3JA 4DRXB 5LOVB 1W5AA 3WGKA 3JAWB 5IJ9B 3JATA 1W5EA 4I55B 2BTOA 3VOBA 3ZBQA 4YJ3B 4FFBA 3ZBPA 4IHJA 4X1YA 1FFXA 4O4JB 3UT5B 5CB4A 5KX5A 5C8YB 4B45A 4ZHQB 5EZYA 3RYHB 3RYCB 5J2UB 5MN5A 5LOVA 3WGMA 5J2TB 5IJ9A 4U39A 5M7EA 3CB2A 3N2GB 4I55A 5IYZA 2XKBA 1RQ2A 4I4TB 4YJ3A 5EIBC 3RYFB 5JVDB 4YJ2B 4WBNB 3M89A 4O4JA 5FNVB 3UT5A 1RLUA 4X20B 5C8YA 5LA6B 3WGNA 4ZHQA 3RYHA 5J2UA 5JH7B 5J2TA 1W5FA 2GVIA 3R4VA 3N2GA 5GONB 4X1KB 3HKBB 3HKEB 3JASB 1OFUA 4WBNA 3RYFA 5JVDA 4YJ2A 5FNVA 4X20A 5LA6A 5LYJB 3C8LA 3VO9A 3RYIB 3M8KA 5JH7A 4DXDA 4X1IB 2VAPA 3VOAA 4DRXA 3VPAA 4TV8B 4ZOLB 5BMVB 2VAWA 2VXYA 3JAWA 4X1KA 3HKBA 3HKEA 4O2AB 3JASA 4HNAB
chains in the Genus database with same CATH superfamily
1Z3IX 5DGHA 3TX2A 5JBIA 3DO5A 1SBCA 3PPXA 3KXLA 5MHTA 3DAOA 1OH7A 1WBDA 3V00A 2OM6A 3P5SA 2YIJA 2YOGA 4QL3A 1XTPA 3EDCA 4PYKA 4F5EA 2BCCH 3EVKA 1QU9A 3MRSA 2ZRJA 1Z34A 4TXNA 2CNNA 1HNWB 5K0BA 4XGKA 4IRMA 3ONVA 5EZYB 4Z2YA 3CC7F 3ICXA 4P0TA 1OIVA 3WKEA 1SZQA 1U04A 2NQ2C 5JAIA 2O8EA 1I1HA 3VTZA 1KAEA 4CS2A 1KYWA 3B8MA 1FJHA 4FJCC 4MVRA 2XIJA 1XNQO 4POAA 2C8LA 2AFHE 3LI2A 3DWIA 4GXNA 4BNUA 1XXHA 1WDMA 1E1LA 4LQDA 1WABA 3WB1A 1NHWA 2DUUA 4LMBA 5I5EA 2IHUA 4DDVA 1AB5A 2UUBB 4JLWA 1UPTA 4NMLA 2BWJA 5JJJB 4WZBA 4LGVA 5FA6A 4A92A 2BMVA 1TFUA 1ZX3A 1T4CB 3FPBA 4POOA 3ZKWB 1YZNA 4AG5A 1WMAA 2G07A 2QL6A 4B87A 1NMXA 3E7DA 1R37A 1BMFA 2DT8A 1F2VA 3A2FA 2OY0A 3OPNA 1WCIA 3O4GA 2JKYA 3UGKA 1FLNA 4FC6A 1U6JA 1TT5A 1EGHA 4JN6B 2YQZA 4RX1A 4MI6A 3QOFA 5KYUB 4TZ6A 3K5LA 4OF4A 4EG5A 2BL4A 2Y6UA 5LP1A 3P27A 5BR7A 1GRJA 5L53A 3D2BA 1X52A 3CVVA 4EH1A 4E7PA 4OHOA 2FK8A 2LKDA 3DMNA 2QVZX 4XSHA 1SUEA 4R7TA 4J7KA 3QG1A 1VMAA 1E9FA 1GNLA 3QXCA 3WGMA 2B2XA 4OXRA 4L8GA 1YE8A 1LX7A 1KZ4A 4M7RA 4KMOA 1YZ3A 1W47A 4P92A 4GRAA 2J6CA 3F1LA 1L7NA 1Q0QA 4N3BA 4PAOA 3U6BA 5CB6A 5HWSA 3DAPA 3JASA 1L5FA 3ED1A 4KRGA 3ZOKA 4Q4HA 4C4TA 3RGBA 5EY5B 1NQOA 1JA1A 4CFZA 1NF8A 4D1YA 3QE0A 3K4HA 2OAQ1 3G2JA 4CG3A 2Q8VA 2IE0A 4ZJPA 3DTUB 2KQUA 4MQUA 2NTNA 4H6XA 4IHJB 3EAFA 4TSFA 5F3WB 2JGAA 4HAXA 4ZPXA 3GZJA 3OM0A 1FNMA 3HVJA 4XFDA 2WSIA 4XOIA 4BV9A 3W4JA 3JYPA 1IN1A 2G0AA 3KHKA 4QE3A 1Z2PX 4BE7B 3RU9A 1DBRA 3IPRA 2FOLA 4HNSA 1QOPB 1NJ2A 5J2UB 2DBYA 5ESDA 4XTRA 4BRSA 4QUDA 2OA0A 3L7LA 1L3IA 3QJ5A 2K1SA 2XAGA 3HO8A 5A4DA 4JJ6A 1XKTA 2MIIA 3CWQA 5J47A 3AU9A 5T6MA 7GPBA 4BJ1A 3EXEB 1H4QA 3PVZA 1S2OA 4OHKA 4RV9A 3EZFA 1G60A 4QWMA 3WGUA 1IBMB 4C3VA 3PEFA 5KJFA 3MWDA 4EYOA 2BFOA 2H5JA 3HGTA 1A50B 3OFKA 2WFAA 3PPWA 1A9QA 2CHVA 3ZP7A 4BWYA 4IQ8A 1YZHA 3KKQA 1MO5A 2JLQA 1MZFA 3CZMA 5CFMA 4G37A 3E9ZA 3H4VA 5B2EA 3DZBA 2WG0A 5ALDA 3MRXA 4AUEA 3EE6A 1GT6A 4KODA 2CLKB 5IPFA 5HIAA 4IIDA 2JD0A 3UXEA 4R16A 3IP5A 4G0MA 1BQZA 3IOBA 3QVGA 1DIBA 2XUAA 1GKIA 1QDLB 3ZXSA 1F4PA 4LOKA 3L41A 4GI7A 2NUAA 3DMYA 1NJ6A 3CD6F 3IIEA 2YWJA 2GK4A 4HWPA 5JLAA 1Y34E 3BL5A 5J4VA 3G0HA 5ALOA 1RJ9A 3EIHA 1VXRA 4PNPA 1QTIA 1SVMA 1W4ZA 3OR6C 3B20A 4UPEA 3CC2F 3JXEA 3WFIA 4PWTA 2P2GA 4D44A 1GTL1 5K0ZA 5FPKA 2FWBA 4YYEA 4P3XA 3ZWCA 4RDIA 2AIFA 3BQMB 3MZ0A 4EG1A 3PDJA 4FCVA 1Q82H 4CHTA 3ZO8A 2M6YA 3A6KA 5DULA 4HDSA 1KIFA 2O8EB 1KY2A 3UK6A 2NXNA 4EI7A 5BSTA 2JGEA 1U3WA 2VPWA 3WWEA 2VHCA 5TRTA 3U31A 1AS0A 1G21A 1I5OA 1RLIA 1VPWA 5IJ0A 1NH2B 1ZNZA 3U7EB 4UCRA 2J5RA 4GLXA 1XXHB 4BUZA 2FDXA 5K8TA 2K7ZA 3QVUA 1GH6A 2VJMA 3MN1A 5KZMB 4DCSA 4OMFG 1CY4A 2OP0A 2Z2ZA 3KBOA 2XT9A 1P75A 3CCJF 2NYUA 4R2LA 4WZBB 1K7FB 4YASA 4EVQA 3RVKA 3SXPA 4DBLE 4GL2A 4KXQA 1E66A 1V43A 1JJ7A 3PEEA 4UVGA 3QKWA 3H5LA 2KSQA 4ZAFA 3HZZA 1WCIB 1ZSYA 3CRQA 1NM5C 5KPJA 4XAQA 4V0RA 3LGXA 2P2ZA 4DBLC 1JAHA 1XRRA 3A3OA 4GEGA 1KQPA 3ZVLA 2AOUA 3HL4A 2HEIA 3B89A 2PNJA 3IOMA 4MVJH 4Q3AA 3K5PA 3F71A 4RXUA 2JFNA 1ZVVA 4F4JA 5G0VA 3IT0A 2F8LA 3M34A 3HTXA 3FFXA 1KVSA 3EF3A 5IY5C 1XHEA 2RAFA 4BXOB 1RXYA 4R8LA 2XB9A 4MKXA 2DKOA 2FE1A 2R62A 3RARA 4F21A 2G9ZA 4MW5A 1A4UA 3GMSA 4DQLA 10MHA 1M1XB 3U44B 1B16A 3NMUF 3ZY6A 1R0RE 2NAFA 3AK1A 5CT5A 1WP8A 2HCRA 2FZGA 1B23P 3JASB 3CNOA 1WNFA 4Q4HB 4NB5A 4WBSA 2Q7OE 4BQQA 1VSVA 3JAMM 2IIPA 4F9TA 3R3SA 4G4VA 2FR1A 1YVWA 5DCUA 1VJCA 3HMKA 3IKTA 2DRIA 5F2EA 4PYMA 1QB8A 1DJPA 4MTGA 5E9QA 3RS5A 2I80A 1I8TA 1JQDA 2REQA 3KKOA 4QPNA 2WKRA 2GILA 1W85B 3VPSA 3F67A 4G4YA 3ONFA 2IZ0A 1EN4A 3B2QA 3UXMA 4BVHA 4QYTA 3ZHSA 3IAS1 4RE6A 1ODLA 3E7XA 2EG9A 2XECA 2OBMA 1ZK0A 3IIMA 4RFLA 3PN1A 4YY3B 2GM5A 5BY1A 1QHFA 4E2ZA 5J4YA 4MJLA 2AC7A 4KBGA 2Q3FA 3NAQA 3WL5A 2C8KA 3R5HA 5LVAA 1F0YA 1OHHA 2IW1A 1PYOA 1SCIA 4YV0A 5KYYA 1UMBA 3MT0A 4YCMA 2ZWAA 2ZSFA 4QDZA 3RFTA 3ML0A 2ZE6A 3MT8A 4BNJA 2P9ZA 2QS9A 3WWYA 1ZO8A 3RVBA 3I5YA 3MWDB 4RNDB 3M6UA 4DILA 5JSFA 3HA7A 2PD3A 2D74A 1H0KA 3ROFA 2BGWA 3WL7A 3QVMA 5BNFA 4WI1A 2P4HX 1X1BA 1Q81W 3DT8A 2CEAA 4OFZA 1EWRA 4DVJA 1XUQA 2XWBF 2GLZA 4URWR 3LL7A 5HM8A 3BXXA 2V9PA 1JEEA 1XVLA 3JPWA 2HLDG 3K72B 2NSLA 4IL5A 2G4LA 5IDJA 1IM8A 3K8OE 4B9EA 3ZP4A 2ZT7A 2OZVA 1EUQA 4LF7B 4Y0NA 2NUAB 3ZCXA 3LYLA 3L7CA 2JFPA 2K6GA 3BORA 3C74A 4EFNA 4V2UA 1JWAB 2WNIA 4K9RA 4B6QA 2WBLC 1Y9EA 2PHZA 3CRMA 3OOWA 2B33A 2X6AA 4HY3A 3TTWA 2Q07A 1S01A 1ADGA 4K81B 1I6WA 3TSZA 1ODTC 2W6JA 4PRKA 4H17A 2AMYA 2BOCC 1PS9A 5IJXA 3HYCA 1QIEA 2JFQA 4ALLA 4Z86A 4HDSB 1GDDA 5AVSA 2FZWA 1N3IA 3GJ8A 4A6PA 2FLWA 3TJMA 1G21B 4E15A 5IJ0B 4TS4A 4IDEA 2PZSA 3CRZA 4HH0A 5HX7A 2QX4A 5F64A 1JUDA 2VJMB 4K6KA 1BKYA 3EJWA 1AI7A 5H59A 3LCJA 1RR6A 3GPDG 4NU5A 3HB4X 2UZAA 1RRGA 3DKVA 3AY7A 1LLFA 1O5TA 4YJ3A 2L2QA 5AWFC 4CR7A 4GMXA 5IJAA 2BTEA 3EVGA 3TNJA 2X0KA 1YQGA 4ANFA 1XCGB 1RWWA 4X8OA 3BIWA 3GY0A 4PGFA 3WLHA 1EFKA 3AQ4A 3AG4C 3RQIA 3I9OA 1C1HA 3HU2A 3WXBA 5EZ5A 3ZGXA 1XRQA 2J3IA 2DOSA 2A5YB 2Q8PA 1NVTA 2FVXA 1XTRA 2MINA 2AOUB 1GAEO 4RU1A 2WE7A 4H3HB 1WDTA 4UZSA 4LISA 3V6MA 4NTWA 2G1PA 1ND5A 4C8EA 2R7KA 1AKRA 1RD4A 1TAHA 1H1TA 5AI9A 2ANBA 3AEYA 4CH4A 4PX9A 5CBGA 1Z47A 3NNDA 2WSYB 5AJHA 4CRWB 1JDSA 1RTTA 1E3DA 4I7EA 4ZYLA 3AERA 2R11A 4EY5A 3R8FA 1XAIA 3WNZA 2WAYA 1X14A 1J0BA 2BDTA 2ZU6A 2FH5B 1W5EA 3WGTA 4PRLA 3P10A 1E7MA 3K70B 4UV8A 2TECE 3CNNA 1UBJS 5DLYA 3HYRA 2PZ8A 3UQ8A 2VNHA 4W6QA 3CLUC 3OM8A 2ABWA 3K0DA 3ESXA 2BCJQ 3HVHA 2V74B 1DSSG 2EFJA 4JWKA 3EWIA 4MOWA 3NP9A 3D3JA 3ZHQA 3W7VA 4WLEA 4O3FA 2REQB 1XEWX 3EVAA 3COWA 3P2MA 2BFNA 4DIFA 1ACLA 3AK4A 4IT5A 4LF5O 4O5OA 2XHZA 1W1WA 4TLBA 5AVQA 4ENQA 1OI3A 2XZOA 2IKSA 1JR3E 4PR0A 4F3YA 5KNLA 3GHYA 1L4KA 5AIBA 1LSUA 4HYEA 3L8CA 2YJGA 3TRDA 4UDXX 3HEBA 1DCMA 3P3PA 2O2CA 4CIAA 3KYJB 5IYDO 3LDTA 2DPLA 1CHDA 4GX2A 1O57A 1A9TA 3HJFA 5KYYB 1UMBB 3Q7QA 2O06A 1PJ2A 1DMSA 2JD1A 1R1DA 4HG2A 2DXIA 4MWBA 4FLVA 2HSWA 4UUBA 4BN4A 4G0VA 2VNKA 4Z54A 4QELA 3R3YA 3WGLA 1LTKA 2O2EA 1RYDA 1VL8A 3MRTA 2Z8ZA 1N9GA 3KO8A 3JSAA 2DHDA 3D0RA 1ZN7A 2W93A 3SPJA 2J5KA 5BSFA 1P2BA 2WT8A 2H2WA 5JZSA 3BXOA 3TQCA 3DONA 1I1NA 2HTEA 1O03A 3FOCA 1I4DD 4O2BF 3PGA1 4NFYA 4PXSA 3SC4A 4PXYA 2AEEA 3IOYA 3CLKA 3B6NA 3E05A 2QYTA 5AKZA 1IG3A 2ISCA 3VR6D 1QH1B 2Y05A 3VO1A 2C57A 2XKBA 2Z9DA 3LRPA 3U3OA 1JSRA 5AK0A 2HGZA 4KX3A 5B7QA 3CBGA 4YRNA 4FDUA 2W0FC 3EW7A 2WKQA 2BZ1A 1WVIA 1KHHA 2UUPA 2X5OA 4PZAA 4P31A 2WFLA 1PZFA 1YI2F 2VA9A 3AK2A 2MK3A 1R0KA 2ILVA 1RBYA 2ZIOA 3OD1A 2XNDD 4DUGD 3ML1A 3HR8A 1R88A 3ZRWB 3ZGZA 2DLNA 4OO3A 1PJSA 4CL2A 5HOQA 3KXIA 4HYTA 1G291 4EHKA 4C6TA 4Q3BA 1IXSB 1NF3A 1P1JA 2VOEA 3CPJB 1TAEA 4PANA 4YDQA 4DMKA 1JDPA 1PNQA 3TO5A 1TM2A 2WICA 2GRJA 3HDQA 4JT8A 1VCHA 4YJ3B 4LXIA 3RV4A 3OZFA 3U48A 3BBPA 3MA0A 1DS6A 1NX6A 7MDHA 1K4CC 3SEAA 4ERXA 3I2KA 5H82A 3F5TA 4AK9A 2FWRA 4ABTA 2GPBA 2AW3A 4FIZA 1K6MA 5G2OA 4R1LA 3I9V6 4B6RA 1V41E 2CXRA 2MINB 1EDBA 2GPJA 1QLEC 3JZAA 3BRSA 2VJLA 4YECA 3CJHA 5ICMA 4TKMA 4XIIA 4UQLA 5C35A 2H5EA 3EXIA 1PD3A 2X40A 3HRKA 1RM3A 5CH8A 1T2NA 3Q2IA 2BTUA 1ZW1A 1YZBA 1G8JA 3HA2A 1PZHA 3CRW1 1M74A 1M56C 4GXRA 1N7GA 5FWDA 3M7IA 1GAXA 1U9IA 3AERB 4R7GA 4AMYA 2A0XA 3QU2A 5BOSA 4BT4A 1D2EA 3FF1A 2WUEA 3PL5A 4I2NA 5FUBA 4X8LA 1R3UA 3IBYA 1DOHA 2I3GA 1MRSA 3HB3B 1CZUA 3L6RA 2HF9A 3P0EA 3H9JA 2PH1A 3B6ZA 2JARA 1OCOB 3UG7A 1KDRA 3ILSA 4KVZA 3IHKA 4RS3A 2EJBA 4EG3A 1MFZA 5LQMA 1J1ZA 1K7XB 4JLOA 1QV9A 4L4SA 4FYMA 4QM6A 1OA1A 1UXJA 1ZA1A 4C7BA 4TTQA 2ZE7A 1WSDA 3JV7A 2W6MA 3NJ8A 4FYXA 2HZ7A 4OU4A 4DXDA 1K5PA 2C7PA 4DSZA 1NXPA 5AXBA 2HP8A 3RIMA 4Q1BA 3UWKA 4I66A 4R2JA 1VIYA 4O6VA 5TC4A 5IU6A 2WB2A 4FP9A 2PYZA 3IHWA 4NJEA 1TAQA 3ABMB 1EFTA 3D00A 5EKDA 1QYIA 4XX0A 1QX3A 1CJMA 1C7QA 1R9MA 2IKQA 1NF9A 3DO8A 3HNRA 3OJLA 1Z39A 5CTJA 2PT9A 4A1OA 4C2TA 2Z2YA 3RUCA 4DA7A 4FMCF 3G8CA 1D09A 1WPQA 5DU2A 4IXMA 3W2IA 1G8FA 5JSZA 3L1HA 1OFIA 1YL6A 5T4FA 1PV1A 2UZHA 5DYYA 1WBJB 1OH5A 3LUKA 1L1FA 1C81A 1DKOA 1E62A 2CKDA 4NFLA 3N87A 5IJZA 4IDFA 5JNUA 4B76A 2J09A 3RKSA 1RCTE 4JUFA 1CETA 2AD5A 2JJ8A 4MUJA 4MR9A 5ALQA 3KQHA 4YRBA 2NMVA 3MTAA 1OLOA 4LP8A 2C84A 1E6LA 2CFIA 2A84A 1SBZA 2Z9BA 2ZBUA 4R81A 2P11A 3HFSA 5J4KA 3IQGX 3G9QA 1PP9H 3VH2A 3QO8A 3CW9A 4X84A 3N28A 4RH3A 3T5AA 2FVYA 4KPYA 1YAHA 4EPXA 2V5AA 3RF7A 3SKXA 4HEHA 3JRWA 1RM4A 5FJIA 2H7XA 5JCZA 1MC8A 4Q6BA 4DUZO 4TWJA 1FX0B 2PJUA 1GQOA 2YN4A 1CZRA 1E1QG 2OOSA 2YFYA 4MUIA 1YK1A 4JNKA 4HYYA 1Q16A 3RV3A 3OH8A 2RGUA 5IAGA 2HYDA 1VQ5F 1KK2A 2IGTA 3KLMX 2WFLB 4F3TA 3SBOA 1VP3A 5C37A 4LWSA 2IYSA 1CF2O 3JAWA 2VT6A 1PKEA 3CNBA 2N3ZA 4F2GA 2ONCA 2KB1A 2YBEA 3N8IA 1OHHD 2DWPA 2XXJA 3K0TA 2CMDA 1ATIA 4MW7A 3TLZA 1FMLA 1VMEA 4HVAA 4I5DA 1QVZA 2EILB 2AJTA 4QPZA 5KU7A 4F5DA 1WO8A 3IVXA 5LXTA 2BM1A 3HJHA 1NV9A 5BSHA 4I1VA 4FR5A 1SXHA 2DX7A 1VP9A 1Y1RA 4ETNA 2NIPA 2YBDA 4TQUS 3STYA 1POXA 4G0OA 2QQGA 4XGNA 3AF5A 1GIAA 2FQQA 1OJHA 3QG5A 4YJHA 3HCCA 1JPVA 1HBJA 1ODJA 2O1WA 1DXYA 3C3KA 3CMCO 1HNZO 4NFSA 2NV2B 2Q5OA 4UDNA 3WLTA 5JADA 4E2LA 2DBZA 5LDDC 3FFQA 4WLFA 3OQ1A 2OCIA 3E9MA 2P3LA 1SIOA 3HUDA 1M8FA 3JTMA 3UCXA 4MLCA 2PVCA 3CJHB 2A1TR 5ELMA 4RK6A 3ZCSA 2WLKA 4EVSA 3SZGA 3ETQA 1VHDA 4ALJA 1NW8A 2OTCA 1AN9A 1NAHA 5EJ4A 1CULC 3Q4HA 3ETLA 1AKWA 3RANA 4X9XA 4QAJA 3T1YO 3GUYA 2DQKA 5A3RA 1ESMA 1IPHA 1Y1QA 3LX5A 2J08A 1KQFA 2V7EA 5ALIA 1W0JA 4RTKA 3MHPA 2W6JD 3PXGA 1KVTA 1ULZA 2OHJA 1GVHA 4R8MA 5LQUA 3PV0A 1W4BA 3KEFA 3BYQA 2D13A 4DLNA 2ZI6A 4CM4A 1YHQV 1FQKA 4N0DA 2XUQA 1YQ9A 2QXYA 2BM9A 5KVVA 4TZKA 1B26A 2EV9A 2PT7A 1F8FA 3RS4A 2OFXA 3NI2A 1L5WA 1STOA 1S2NA 1UANA 2JGJA 1P72A 1SU7A 4BWFB 4DGQA 4NJEB 2H94A 1SXPA 4FMBB 2IBSA 4LNHA 1OT5A 4XX0B 2O2ZA 4FE4A 3PVCA 2LCIA 1HSZA 1Y3HA 1X7HA 3O8CA 1DKQA 3MMXA 2VDQB 4RF5A 4GZMA 3EFEA 4CYMA 2Z6AA 4Z3DA 2PDAA 3AUFA 1QPBA 2ZB4A 4LTNA 3FAVA 1M34E 1M66A 3ECSA 2ZVQX 5D6OA 4EVIA 2YYSA 3EPRA 3DWEX 5JSZB 3WA7A 4ZZ2A 4TM7A 4KWEA 3R0IA 3A6EA 3EQ6A 3AW9A 2P4KA 2GMWA 4BMSA 4W5HA 1FW8A 1N6NA 2PXXA 1GM7A 2C83A 1DTEA 3K03A 4LECA 1D0SA 2Y1LA 3I76A 2IHVA 2NW6A 1FMFA 5AUOB 2XUGA 4RUFA 3CRNA 3ICWA 2AJ8A 1RRMA 1S9DA 4G65A 2YXLA 3KB1A 4MR9B 4YIPA 2P2LA 1NMSA 2A4KA 2GK7A 1AUQA 4QFCA 2JGUA 2H2IA 1WCWA 1RLTA 3MC1A 3GDWA 5IT0A 4I9QA 4TLLB 2BSKB 1EUDA 4NPHA 4JI4B 2AFVA 5FUWA 3CBQA 3I9FA 4D6XA 5FAKA 4UW9A 1YRYE 3WSTA 2PX8A 4NF2A 2P6YA 1LI7A 2PEZA 1FP2A 4AFNA 5TEVA 2UXBO 3IIJA 3PUIA 1SD2A 4TRMA 4OQDA 3ND9A 3ZE9A 2OCPA 4EYQA 3IUYA 3A9SA 5JAMA 3OTHA 1XIVA 5EA2A 1T25A 5EBMC 1RJFA 2PUSA 4FFBA 1YK0A 3E84A 3RGGA 2QN6A 5B64A 2DZDA 4FHCA 2WWXA 3BD9A 3PNYA 1RI2A 2OWEA 3F74A 4RWEA 5EE1A 4LWSB 4C22A 1RXUA 1X1RA 2L82A 2B1GA 4L07A 3UMRA 3G0BA 2WUFA 1SULA 2VJYA 1XE3A 4OB7A 2IPMA 2BVNA 4HLQB 3SQXA 3CCSV 1YIJF 3P96A 5C7YA 4NXNB 4F4CA 5CIWA 2Q99A 1KIMA 5KKAA 5LXTB 4CKCA 4MUGA 3NK6A 3OKAA 2Y1KA 3WLQA 4YP9A 4XEHA 4J76A 1I7QB 3UHOA 3PUVA 3VKHA 1EZZA 1SZDA 1H2SB 1FPQA 1MC1A 1RRFA 3Q85A 2OLKA 1DLBA 1IEXA 3ZVKA 5KWVA 1QBGA 3I1YA 2NMUA 4OGLA 4YJHB 2PBFA 1ECPA 2GEFA 2V7QD 2Q5LA 1DT3A 3DMRA 2JRIA 3VDNB 1C41A 4U39A 3OEEG 5DCLA 5HCUA 2ODWA 3BK1A 2CLMB 3ZY3A 2C82A 1IONA 1ZY2A 1ZCJA 3USZA 4PZYA 2VSXA 4DSOA 1W5AA 1CQZA 3OVMA 3OT5A 1FDTA 3Q4HB 4QZVA 2BUCA 3U10A 1JAYA 4YCCA 1XVTA 5H70A 3P4UA 4LY9A 4TTIA 5C51B 3RKRA 2G83A 2HCBA 2H1SA 1HYBA 5TJHA 3OPXA 4G4SP 3ABLC 2GM4A 2Z1NA 2YDEA 3H2YA 4H7HA 2F67A 4WL0A 1BQEA 3S3TA 3MLEA 4UNPA 2VRCA 4C1BA 2Y4OA 3KKNA 4GHWA 2QE7D 3CX5F 3VDRA 5A04A 4KPGA 5DPMA 2FWPA 2A7XA 2B35A 3RVRA 2Q0OC 3D7LA 3GLGA 3I56V 2WJ4A 1Z0FA 4Y9SA 2OD7A 5A2GA 4PS1A 2QPLA 5HE8A 1Z88A 3FOZA 1E9AA 5H2FZ 1VF5B 2I1QA 4HFRA 1L1RA 2XBLA 2X4GA 4R7ZA 1ONIA 2BZGA 4LZLA 2ZJ4A 3H87A 4ZC1A 2NNWB 4U2DA 4TL9A 1PWYE 1CUHA 2HT1A 1WXHA 2ZBQA 4EATA 2YVAA 3HZHA 1ACJA 3FAVB 5MGBA 4HNQA 1HEIA 1JGTA 1I0IA 4L85A 4PNZA 2OZKA 2C88A 4G2KA 3MQ4A 2SCUA 2IYRA 3SJBC 1E4EB 3SR0A 4COKA 4TXLA 2ZM6O 1UKAA 3E70C 3ZBUA 3QE9Y 1EG2A 2X3YA 3ZVRA 4U7HA 4RZUA 4KFMA 4IJVA 4YRCA 5K0FA 2ZFUA 2OR3A 4LF6B 3G9TA 2ZJ2A 3WQBA 2ZJYA 2IPAB 4PAMA 2K4MA 4BYMA 4DIUA 5K45A 1KWKA 3MJFA 3M89A 2COUA 3B6MA 2JH9A 4EHIA 4HBNA 4XWKA 4DIBA 2AYXA 1ZVKA 3LC2O 2UU9O 3JTEA 1Y0BA 5M04A 3NHWA 1VQMF 3OCYA 3Q0TA 1EUDB 3T3HA 2A7QA 1QH8A 1YKFA 3EB9A 3FYCA 3GLIA 3OF5A 2P7TC 1VGQA 1ENYA 1EBUA 2B7CA 4KQMA 2JLXA 2GZHA 4BO5A 3UN1A 1XZ8A 1U2EA 2NT3A 5EJMA 1I80A 4XDYA 3KQUA 3WLAA 2QR4A 1P39A 1Q77A 3VC1A 1D2HA 4JI5O 2FJ0A 3F3SA 2JJ2A 4DW1A 3KQMA 5J3JA 3DOFA 5D51S 5DTQA 4FFBB 3L6DA 1H0SA 1V8BA 5B53A 1W19A 4J0GA 4NZ9A 4IH9A 5AW3A 5A1TA 4C3ZA 4Q1AA 4XUDA 2FF7A 5BVHA 4IX1A 5EHQA 1JR9A 4DABA 1YONA 2EYUA 2CNOA 1NI4A 1RM0A 2X0LA 4FM2A 5AVYA 3WA6A 5CFRA 5AOBA 1VZ2A 2IV7A 3MBIA 3AGPA 2R9VA 2CKMA 2IXEA 4NNPA 1ID8A 1T6XA 3RUHA 2HJRA 2QLJA 1N4DA 3FWPA 4JLJA 3TLEA 4CC6A 3LDEA 3PWZA 1DHRA 4YAGA 1VYTA 4J75A 2C59A 3CUUA 4KJXA 2Y8EA 1RAIA 2A9KA 4X8AA 4EI9A 5A71A 1Z17A 3KWFA 1AZSC 3QXJA 3CEJA 1J33A 2QG9A 6LDHA 1UJMA 1R9NA 4JYZA 1F12A 5EBLC 4IDCA 4RF3A 2YZGA 1SXQA 5ARCA 2GZRA 5GQSA 2CV2A 1SA0A 1CUFA 4JP2A 1FAFA 4U7WA 1JTVA 2B2CA 5GM1A 1T13A 3P94A 3WRXC 2ZAIA 1GQFA 2H06A 1JB1A 3KLOA 1XYGA 3EXHC 1VFNA 4MP3A 5EWLA 1DCTA 3I0NA 5IVPA 1VBNA 3L0OA 2WUDA 5EIEA 5FFMA 4TTAA 5KNCH 3N6XA 1U43A 4KIWA 4OH7A 3IJEB 4OK5A 3JRXA 2RBGA 1QHXA 1L4UA 4OPHA 2GOYA 3QBVA 4AJOA 1JN1A 3N0XA 2OHHA 3RYCA 1CUWA 4GM1A 2XMZA 3H1BA 1OXTA 1H05A 2BDUA 2HS0A 2IODA 4WXRA 3TX6A 3VNUA 1ML3A 2B0JA 4Q7LA 3DDUA 1CLIA 4LRYA 5I9BA 3CZPA 2J46A 4F9FA 2GUZA 4IBOA 4I8XA 1YJNF 4MP6A 3NUQA 1R0BA 4EL0A 3PQEA 2XCSB 3LBFA 2VK4A 2G67A 2COKA 2C4NA 1LJ8A 3JQGB 4OBWA 3SJCA 4U3JA 3GLGB 4OQFA 5G0SA 5C5DA 1KXZA 2HPZA 3HUTA 1YJ9V 3UJAA 1IN7A 4XYGA 3JQBA 3ZXYA 2ZW9A 3HDTA 4BIZA 2Q4EA 2XYQA 3PJSK 4F93B 1Q1QA 2I1WA 1EX1A 5DRTA 2B5OA 2MSLA 2P1RA 1G5QA 2XRYA 2ZIWB 3OAAG 2EZOA 3IQXA 2EKZA 4Y6GB 2YJ4A 3OFND 5CT6A 3DHYA 1JKIA 2GNPA 2JFGA 1SHJA 1V5EA 4IM7A 5K3CA 1I94B 4KQ1A 2GAAA 3X2QB 2G5GX 5LD2C 1YFLA 3IE1A 1P7GA 3GGDA 1X7YB 2WM2A 1I2DA 3D54D 2SCUB 3AHCA 3UZUA 2V0GA 3WMWA 2AXEA 5IT9M 2UYYA 2I91A 5BXQC 2ARHA 4DV4B 1GTZA 1K9SA 4KL8S 2FPGB 4QA9A 4D0NA 5ALPA 5HKLA 4IUCS 5ED0A 1SBYA 4GXTA 2W4MA 5HFMA 4MKRA 3TW0A 2DQ0A 1G0NA 4I6GA 4DKJA 2R4TA 1LPAB 4ZOQI 4QO7A 1GEEA 1MB4A 1GUYA 2JNBA 1P2GA 1J25A 5IVIA 2G17A 1SCDA 4PO1A 3NCTA 5FI0B 1T0AA 2R8YA 1QK4A 2H2DA 3RSLA 4C7UA 1W30A 4J94A 3NFRA 3U62A 1W0JD 2R5FA 2VPPA 1DIOB 4HNHA 1UBMS 1YBVA 3GLIB 1AZTA 4IIXA 3I3SR 2B21A 3A04A 2HP3A 1P5FA 2C7VA 1BDBA 1EX7A 2QRZA 2D4HA 3AESB 2LBPA 4TSRA 2A5GA 1Q3HA 1S9HA 2C42A 4YMIA 3I9LA 3DOUA 1MORA 2M32A 4NTYA 1Q5OA 3V3TA 1RM1B 2ZATA 4RVFA 4H4EA 5AQ1A 3QFRA 4MYDA 4IKEA 4UEOA 4MQFA 4X93A 5FPPA 3HUEA 3AWIA 2PKWA 4KQGA 2VQEO 4N7MA 3ER8A 4F56A 2EC5A 3ZD6A 3UQZA 3HK2A 5EJEA 1F7YA 2ZDHA 1GN6A 5FLXM 1V6CA 3VPHA 3ZUGA 3TDMA 5BVHB 1YH3A 3E81A 4JLKA 5B5EZ 2OORC 1V1JA 4J0KA 2GYYA 4BMPB 3E61A 5EIBC 4R2KA 4DG9A 5FOXA 1NI4B 1ZD3A 4MMZB 1F1BA 1DU4A 1NULA 1NVBA 5T6BA 4EI2A 4GSLA 1YDEA 1MT3A 1JWLA 1HR0O 2HJHA 4M1EA 1PP4A 4JZ2A 5LL6P 1AB3A 4URUR 3K6SA 1U98A 2C3YA 5LUBA 1MO2A 4RVDA 3E5HA 3J81k 5F35A 3QTLA 4OJMX 3HN6A 4XCXA 3W7UA 1W581 3A1WA 4B6FA 4JK3A 3U80A 4DIOA 1A04A 2WTBA 2YIMA 1WVMA 4G9EA 3CEIA 4UJ5A 1IAVA 4QAQA 2VTBB 4A9AA 1UH5A 2Y0IA 3DEZA 1SA0B 4X7PA 3L4KA 2ZJ3A 1H2EA 2Y3IA 4I6JA 4L74A 1LQTA 4WERA 4PDMA 5JWHA 2P22C 5EWLB 4B9AA 4UUNA 2HQSA 4OFWA 1JJBA 3DVAA 4IRUB 4XYBA 1H8ED 1ZQ1A 4WZAE 3VZBA 1TJ5A 1GWNA 3VR6A 4FI3C 1WL8A 5JBQA 2RH9B 8OHMA 2QTOA 3KSRA 2W6NA 3L4EA 1L4HA 2ZQMA 1E63A 5A6SA 4YMLA 3W1VA 5DBHX 3DXXA 4DC9A 1ADBA 3VZQA 2VRWA 4IJ5A 2K7FA 2YWRA 3T80A 3I5AA 1YZUA 1MH1A 3MIZA 2GUZB 5JXWA 1POWA 1W3EX 3B2NA 3FBTA 1LTQA 4MWCA 5TIIA 2WYWA 5AI6A 2XNDA 4DUGA 2X7JA 4H77A 4U3JB 1SG9A 4HMPA 1H2NA 1F4MA 3QMVA 2VK8A 2WIBA 1M76A 4YP5A 1EXNA 1KZ1A 2I2FA 5BSUA 4GPZA 3STHA 4YJFA 5A02A 4B45A 2QTVA 3K9BA 3PQ2A 3U37A 2HWXA 2X2FA 2WM8A 3NWOA 1PNMA 1JDZA 3FNEA 2HWYA 2YNMC 4RZQA 1J5EB 2PJZA 3C2QA 3MWLA 3QYPA 4GAEA 3LWBA 1OV4A 4GBED 1QRAA 5EXDA 3MDSA 3T9DA 4AY4A 4Z4EA 2IU3A 1XZJA 4HHEA 3INTA 3WG7B 2XQKA 3B5IA 1WB7A 3O1HB 4PGMA 4EPWA 4QNNA 3FETA 4MVJF 4ZQCB 3GEHA 1CWUA 4NRDA 1YNSA 4DARA 3GYQA 2WIJA 3Q3HA 3L05A 4UNQA 5J1SB 3R7SA 2FW6A 2ZWVA 4JIGA 2VJOA 4Q0MA 1FUUA 2FSVA 3BJZA 4YAUA 1C1DA 3L70H 4O2BA 3S99A 1U11A 3SLKA 3X44A 4PSDA 3VTFA 4GNKA 4CM7A 5BZBA 2HF7A 1L7BA 2JAWA 4QLAA 5ILQA 5IZ4A 1BDHA 4I5FA 1AUPA 5ECWA 4NARA 4FK5C 3BQ9A 4UUQA 3R0PA 5KPDA 5FOSA 2D6FA 2H5IA 1X3LA 4KXVA 3SSOA 2FZVA 5BSMA 4QUKA 3TI9A 2QT0A 3M8AA 4BNVA 8GPBA 4B3XA 2QZPA 1CEZA 1RA4A 4RM2A 3BA9A 2FC3A 3VC7A 1Z7EA 2VRCD 1O6GA 3FDJA 3VTAA 5HGJA 4X1KA 3WJ7A 1IJBA 2QKYA 4WUTA 2HK6A 1K6IA 2Z2XA 4FFVA 5A2QN 2FFHA 1UDBA 2OTJV 3TSYA 5TPWA 3BTOA 5DASA 4MQFB 3C3DA 1SPBS 1JQEA 2Q2VA 4OBEA 3CPWF 4DF3A 3W9SA 1CR6A 1YEWA 4K9KA 1PK8A 1U1CA 3WIOA 4M0CA 4UCVA 3SE0A 3AFIA 3GWKC 4HF7A 3VI4B 1L7PA 4ZMSA 1IXZA 1OX5A 1U5AA 1N0VC 3IALA 5CX4A 4B6PA 1XF1A 4E22A 3EFFK 3R7BA 1QF7A 3T1TA 3STVA 4XQ0A 1OAOA 2X22A 3ZE1B 2J3MA 3ROGA 1AHHA 3Q8LA 1JL3A 5EMKA 4H16A 4TLEA 5BVGA 5IT5A 3SXJA 4GX5A 2NPOA 1EIWA 4MVJD 1TT5B 3K6SB 3JD3A 2X1HA 5IN4A 4PDLA 1MV5A 4R2XA 5BWLA 1G7CA 2YZKA 3HY3A 5DH9A 4BMDA 3KP1A 2KGWA 2FJPA 2P75A 4C08A 5KUTA 2V55B 4FKMA 2JFBA 1TFRA 3TH5A 4UOQA 5EL0A 2EWMA 1NWHA 3L3BA 2JDID 1TEVA 2VP4A 3RBZA 1A9YA 2ZTLA 4YRTA 1WZ2A 3EF0A 3T5BA 1XDBA 1SUFA 3C6BA 1G0OA 1SQ5A 4RMIA 1MIHA 3TSOA 3SHFA 3HBNA 1Z4PX 1Z4QA 1PN3A 2JEZA 5EXSA 4JEMA 3FPCA 2QR2A 3WGKA 3DVAB 2XB2A 1USGA 4FOLA 821PA 1QYXA 5THQA 3OHSX 4LXHA 1M5RA 1Q6YA 5JHHB 3BJIC 2JIQA 4D9KA 3BMNA 1CVLA 3UAYA 3L7QA 5C0OE 5I5GA 3GGSA 1NW7A 3OU2A 1EEHA 1X9HA 1E5QA 2J30A 5KDLA 5A6SB 4IP0A 2YI9A 1R6VA 5B66Z 1BCCH 2JJ2D 4LMPA 3T7TA 3N86A 1E3LA 1IHYA 3EYWA 3E7FA 1ISJA 2XKAA 5HOEA 3GVXA 5KC9A 5CVTA 3ONEA 2ALEA 1GAJA 1W1UA 3W7SA 4IIFA 2RHTA 5K4GA 1DVRA 4M1YA 2XKJE 4TPKA 4WJZA 3KKZA 3PUJA 1UWCA 1LRJA 5I6DA 2X0NA 2Y2UA 1BXKA 5KC8A 4F6EA 4CL3A 2R68A 4OQYA 1L5SA 4YJFB 3R7FA 2QTVB 2GNAA 1L5YA 4LRSB 2IYAA 3R9KA 3MMPA 4PI0A 3M1IA 2H1RA 3KPYA 3A1VA 1ZU5A 1NU8A 1PTJC 3JQ8A 2R6DA 3RSZA 4W7IA 4QE7A 1UOEA 1J42A 1GTG1 2OZEA 4QPJC 1E9RA 4FZ3A 3M6LA 3SDSA 2OV8A 3CSXA 1JZTA 4D0RA 1DI0A 1ONNA 2CHQA 4BNIA 1OLSA 1THTA 1MZEA 3ZXUB 2NO6A 3HQ4O 4NCJA 5CW2A 1XK6A 1M2VA 1NJ5A 4HBZA 1R6KA 1C1DB 5IULC 1WU8A 4O2BB 1XU4A 4Q4LA 3OY2A 2O0KA 4GI1A 3T9CA 3N2EA 3GLVA 4ROTA 3QVGB 1XEFA 1FUYB 3GTZA 5C80A 3OGIB 4B82A 1UJ6A 3SGIA 1EH5A 4P2ZA 2X0RA 2IHJA 1EFRG 2I78A 3R3VA 3K31A 4C8GA 3ZI7A 3BH6A 1HFWA 1RJ9B 1QB7A 4IINA 3ACDA 4D6PA 13PKA 1ZD9A 4FHDA 5AOVA 2X9QA 4RTLA 3CVUA 2HV9A 3STWA 1RQLA 3R5SA 5DM2A 2QY6A 3MAQA 3W5HA 4MW8A 1OQAA 2IPLA 1FNCA 5L95A 3RSHA 4X1KB 3H2JA 1R8JA 4RK7A 5I7WA 1F20A 3BFRA 1E9DA 1TL7C 1Z7BA 3OIVA 3QNUA 5KU1A 1FFTB 3PI6A 5TPWB 2OBYA 1ZK2A 4G0YA 1OT3A 1O3YA 1KMHA 4OM8A 2V0CA 4F4HA 3TZKA 4UM5A 1J6UA 2HIGA 3C3BA 2ZRCA 1K9VF 4QU0A 3GP8A 3C87A 2XAQA 1I32A 3B1FA 1UAGA 3JY6A 4OYYA 1E6UA 2VAMA 1ZW6A 4LKRA 5J59A 5IC6A 1NYQA 1N2CA 3UJNA 5EQDA 3CO0S 5CCDA 2PFSA 4M53A 5B12A 2I6RA 3GVMA 2LTAA 3FWZA 3A4NA 5BVGB 4LV6A 2BRUC 1NG9A 3BFPA 1NBEA 5B1SA 5DWDA 3QPUA 5ALZA 1D07A 3OKCA 1M10A 1HL7A 3QPWA 2L0XA 1C4WA 4TKZA 2QMUA 1SBTA 5KOJA 2QI9C 2EBUA 1ZSPA 2F4VO 2JBAA 4EGFA 2AH5A 3RRZA 3SLGA 4CBCA 3VHQA 2GAFA 1F3OA 4LBEC 1GZ6A 1ZGZA 1CUYA 3DT9A 2QA4F 3DZFA 2BIFA 3FSEA 1LTHR 2XE8A 2C5LA 2C5GA 3ZLBA 1GRQA 4FW8A 2KW5A 5L4LA 1W5SA 3C3TA 5LDGA 1WD5A 3KSMA 4X91A 2ZSJA 3WGZA 3VYSC 1TECE 5L4SA 3IQHX 2PUWA 3D1LA 4XZ3A 2IE8A 8AT1A 1ECFA 2VZ0A 3MCZA 3Q8KA 1VOTA 2BR5A 1QHTA 1KC1A 4GNRA 4ECAA 3BMNB 4HWGA 4JYPA 4FFKA 3WGIA 3V8QA 1VQOF 5A0VA 1F6WA 2QUJA 2J9YB 4OJQA 3VV2A 3CUTA 2YIDA 4CTJA 5EMNA 5HCIA 4E09A 3TNYA 1TIPA 1PSWA 4UPDA 1M6HA 3L0DA 1E1CA 3SPCA 2OQRA 4U7PB 1VARA 4IILA 3LU1A 4G0WA 3EPPA 5BYAA 3ACBA 2PLRA 4LVNA 2I2AA 3VYTB 1R0LA 3CS3A 3INRA 3DP9A 2WV7A 4LC9A 1OVGA 2YHSA 3K4QA 3EBOA 4FMCB 1KERA 2OD2A 2FR8A 4BDSA 3IV9A 3C3YA 1MGOA 4W8GA 4F1JA 2RKWA 3RW0A 3KVNA 4BW9A 5JNVA 5JZMA 2CW5A 4BO8A 3TW6A 2YMMA 4ZO9A 2QAGA 2IELA 1A77A 3A9TA 2BKLA 3JQ8B 4BP9A 5FR1A 3I2FA 3L2OB 3RJ9A 1X7GA 4N54A 3DR5A 4ZKEA 2V7QA 3RUFA 2PBRA 5LKRA 2IUUA 4DDUA 4Q48A 4RIIA 4FX5A 1M2VB 1QGAA 1MX5A 2O2XA 3CX3A 3ASNB 1GTOA 5CH3A 4N03A 4C0HA 2VG8A 4X6XA 3HBAA 1L4FA 4N0PA 4DIKA 2B9EA 3MJRA 1SBNE 4W8HA 5CXXA 1TC2A 3HL0A 3DUWA 3IBFA 1QQAA 1FYFA 2CLDX 3M0EA 4IYIA 4Q9IA 4BLSA 4S1NA 3I9NA 1VIMA 4LZPA 1BRTA 2Q3BA 1UXGA 1UMKA 1TRKA 3GYGA 3V2HA 1K7DA 1P45A 4UMFA 5B2FA 4AKEA 3BA1A 2GDJA 3CCUV 2YMLA 2W6PA 2HRUA 4BT5A 2AR7A 2OO7A 2QEQA 4AF8A 2QE7A 4ZK6A 3OOJA 4JYBA 5TPZA 1L4GA 1VE7A 3PXCX 3UMBA 1CIJA 2R60A 4X62B 2ST1A 4JP5A 3R2JA 3D7RA 5I8ZA 1DUIA 1SXGA 1KDPA 1PQ4A 2WU1A 1KMHB 4RPCA 4YRKA 1Z6ZA 4C7KA 1ZFNA 2G04A 1FDWA 2CLOB 2AOVA 4R4JA 5E9AA 1N2JA 4BVQA 4WFJA 3EAGA 4QUIA 2AKAB 1U1GA 3CSSA 1YUMA 3JQ9C 2J3DA 3CA8A 4CV1A 1B4DA 4QODA 2X8BA 3HFGA 4JZKA 4G1EB 4FYJA 4ZJUA 4E21A 4GZ5A 3FYUC 3LX8A 1XNRB 1N6KA 3CRAA 3VVLA 4IICA 4R8VA 1PNTA 4RMNA 4BEJA 1R64A 3V97A 5LSAA 2H31A 2GEDA 5CB4F 2P3OA 3C45A 2FFBA 3OOSA 5KWEA 2HUPA 2C4HA 4DCJA 3A27A 4ICGA 5L51A 5KOJB 3JSNA 1PK7A 3M70A 4FEAA 1FSPA 1XRMA 2XODA 2IYPA 2PLNA 2QMYA 4RTRA 3C3AA 4D4KA 2G1UA 1XTIA 2B8WA 2ZVJA 1JDJA 1CLEA 2NTJA 4QTYA 2H4WA 4AS1A 3KZNA 1ZLYA 3AFMA 3PXUA 1S96A 4MK4A 1RRVA 4Q15A 2V6MA 1QZZA 3UCEA 2BKEA 4A2CA 4DLBA 1QIKA 2GSWA 4D79A 2F8TA 3OG9A 3GROA 1DBVO 1VJGA 1N36B 1AR4A 1WOYA 5AJWA 5K8IA 5ALWA 3OMAB 4MB6A 4LUCA 3CUYA 1GA4A 2WYIA 3AF3A 3UK7A 3VU1A 1QQCA 2AK3A 5IXJA 1SERA 2WP0A 2IUEA 2QTTA 4DNQA 1GZ0A 3K1AA 1YS1X 1QOQB 1LPNA 1FTSA 3UT0A 1S7GA 4XUCA 5DXAA 3VX3A 2FPLA 1HZZA 2Z6VA 1E1CB 4XDLA 3G82C 2JVKA 1SGWA 1UFRA 4MRRA 3L7JA 1K5GA 2FJUA 4YO8A 2ECQA 2PQ6A 1W48A 4MSUA 2IC5A 2IF0A 2X23A 4ARCA 1PG5A 2C04A 3WKDA 3UW3A 5FDFA 2GVNA 3FB4A 1YB5A 2BGJA 1DXQA 3RFUA 4XM2A 3QPCA 1Z6TA 1UFOA 2RONA 4IWNA 1Y1PA 4ZT6A 3SXUA 1ORQC 1O87A 4FX2A 4ETMA 4PVDA 4PN3A 4ZAXA 4MUMA 2YY6A 1ZS9A 2B8NA 2QAGB 3P2OA 3NR2A 4J9VA 5J5VA 3UGQA 3I42A 1E32A 4TRJA 5T57A 2VTVA 3CS5A 3QX8A 5LB4A 4RKEA 1YO6A 2KYRA 4J0IA 3FUCA 4JP1A 1G8YA 1N9GB 2FPXA 2O1SA 2IAFA 1G7SA 5G4VC 1JU3A 3H2GA 3ZCUA 4HZUA 1M1KW 5JMOA 1XPUA 2RGDA 5NULA 3AMVA 4ALIA 1EJ2A 3BCHA 2GJ8A 3KE1A 1USUA 1ETUA 1G66A 1V9SA 4PHFA 3M6FA 2OXTA 3WDKA 5LYJF 4W99A 1PUJA 2XV1A 4ZV4A 3NHKA 4RUKA 1XCJA 5AK3A 3NU1A 1HDCA 2W6IG 1EA5A 4M37A 1MUUA 1SCKA 1U6IA 1JHOA 4WJKB 4V03A 5CDTA 4DB4A 1UZMA 1EWTA 2ZYUX 5EHXA 2QN9A 3HO1A 5ELXA 2X6BA 1KYVA 4GR4A 5C7OO 1XP5A 4S2UA 5LBTA 2R6HA 2FE4A 3MCQA 1LUWA 3SYNA 3IBSA 5IYBO 1YRAA 2QGFA 3DULA 3GUZA 3FXAA 1N3LA 3QUWA 2GXSA 5K05A 3X1DA 5L3RA 1ZCZA 3HTNA 4W6ZA 3H1TA 4UE3S 3KWMA 1T6BY 4B0OA 3EZNA 4IJQA 3LZCA 4QUBA 2FB5A 1Q3EA 1YJWV 1LVGA 3AU8A 5TNXA 1RKVA 1U8YA 3DMGA 2LCAA 1RXSA 2JCYA 4C6TB 4CI9A 4QC2A 3C3WA 4BP3A 3TTTA 2P2NA 3DBRA 2WTUA 2REOA 3VQWA 3T54A 4JBHA 4OIMA 3EVNA 2GA8A 3RVOA 4TTTS 2QE6A 3FBWA 3OFNA 2FMFA 2XGOA 3CCRV 2AJDA 3SDZA 4Q66C 1NY5A 4I5SA 5C1DA 1KI1A 3GBPA 5JYCA 3UWMA 4PXAA 4YRFA 1JKXA 4A0RA 3IDQA 2V1XA 3JYQA 5EVCA 3D54A 4N40A 5JR3A 4CV2A 2HLDD 4ZOAA 1UQRA 3KR9A 1NLFA 1K88A 3K0BA 4ZICA 2HPHA 2V7BA 1HETA 1JXOA 4DLSA 2HJSA 3EORA 4E5YA 1PJCA 2JBWA 1XMQO 3B5EA 4G89A 5TXGA 2CW4A 3F0FA 2CCKA 3PPIA 3EXIB 4M54A 4QGSA 1T5BA 2OHFA 3IEMA 1CUGA 1CB0A 4A8TA 4L75A 3X0DA 5CVUA 3LMKA 3CZRA 3Q8HA 1IN4A 2KM1A 5BOSB 3VFDA 1W49A 2GB4A 3ZLUA 1E6WA 4ZOLF 2CL0X 1KQ3A 1EGAA 5L7TA 3U40A 1W36C 2HUNA 2A57A 1OCRB 5C1BA 2OYRA 3UXHA 3V4ZA 5KYTA 5GTHZ 2ZCUA 2ANCA 3U4CA 2C7QA 1BH2A 5CVEA 1EJ0A 1WB9A 3NDPA 4ZOCA 3GLQA 4R1SA 1AV6A 2DQYA 4H1TA 4I9UA 1NVPD 5JYDA 1C7IA 4Z7QB 5DBOA 1FJXA 5CVVA 1ECLA 3HXMA 1PWEA 3ZU2A 2PWPA 4GZ3A 3KOZA 1V39A 3UGTA 4B81A 5FOWA 1HDZA 3TE7A 5ABPA 4DMHA 2UXNA 1BA2A 2CMGA 2VDUE 1UPAA 2R6CA 2W90A 4QVGA 4JYYA 1BJKA 2QUAA 3SXUB 3KXPA 1VQ7V 1NXOA 3N74A 4P7JA 4B2LA 3BSSA 4I5GA 3DEJA 4G0PA 1J24A 1K6XA 2C9OA 3HXPA 3JD0A 1VQ9F 3EOBI 2MU1A 4D8XA 2GN0A 3P0HA 1KC3A 3LY9A 4CV0A 3UKJA 5BNWA 1H1LA 1T5TA 2G3YA 3DNFA 3PXAA 4BFYA 1OXMA 1HDYA 1GPWB 4R0MA 3AY6A 4HZUB 4JUBA 1GTRA 1Q86W 4NULA 3LXUX 1W6UA 5C18A 2KTVA 2WG2A 3WR5A 5B1AB 3A9RA 3NHAA 3WGQA 3N2GA 4UVAA 1ORTA 4JX9A 4RW0A 1Y76A 3AUXA 1X15A 5B7NA 2CVHA 3TLMA 5JJLA 3WNVA 2YMQA 1ZEJA 5EPEA 5GMOA 1JS1X 3BMQA 1H8EA 3LF2A 4L9RA 4CG0A 4QQNA 1NQTA 1T2VA 3ZN2A 4IIVA 4DV5O 5HXUA 3CF4G 3R6DA 2JRCA 1X1EA 4NG5A 4R2HA 5GW7A 2QLTA 4MIKA 2ZODA 2H2GA 3H0KA 4TMFA 2GKGA 3MJ4A 2FMKA 3TYXA 3HJTA 1CY1A 5ADHA 3HUFA 4PD4F 1I3OA 4BGVA 1A71A 1ROPA 1ZJWA 2G25A 5BRNA 4W9NA 4JFAA 3W8FA 3KDSE 5JPDA 5IFKA 5IN5A 1E9BA 1L8XA 1XBLA 3JAWB 4RKFA 2WMOB 3AF2A 3TAXA 2CDRA 2C4WA 4RMGA 3TLBA 4KACA 3MIIA 2ZUTA 1U96A 2PMFA 4JI8O 3KLBA 3U81A 1Y7PA 4K8RB 5CLGA 4EOGA 1TC1A 5GWXA 2W2LA 1Y6QA 4ESHA 4DRXA 1WCV1 3GWGA 3E2EA 3D8HA 2IGBA 5AIAA 2OCXA 4ZV7A 1DINA 2FDRA 5ALLA 1XMJA 2Y99A 5DGIA 2MR5A 2VUHB 2OBLA 3O1JC 4RHFA 3M49A 2R00C 2CYAA 1RZ3A 4EYGA 1T0BA 1HTTA 1H9BA 3KZCA 1SUWA 3S8YA 3HN7A 2DB3A 1MNGA 1WJGA 2CZGA 2H57A 2KBEA 5B1NA 1Z12A 4KQJA 4D3XA 2PAFA 3EA5A 1OYYA 3DQPA 1ZMTA 4EMUA 1AG9A 5AHWA 2J41A 1VF6A 4EEXA 2HOQA 2H0QA 3UUFA 4FILA 2IZZA 1Q74A 4EY7A 5TR9A 4Z53A 5K3FA 3AVPA 3O7MA 4YLGA 3K9LA 4RZIA 4MT8A 4F1KA 4C4ZA 3COZA 1KDZA 3BCSA 3BK2A 3LDAA 3IAAA 1DWPA 4JV5B 4LW8A 2AI1A 5AKEA 2B5WA 1V7PC 4TKLA 4DV0O 3JQAD 4IIGA 1WXEA 3U13A 3SEZA 1H9CA 3CUVA 3H17A 3FB8C 3O9OA 3FRJA 3C3SA 1T5OA 2A1UA 3PJDA 3B78A 4EJ6A 4KYTA 1V95A 1BEUB 4CM4B 5TPZD 5A03A 3HJNA 2CWWA 3VKFA 2VH5R 3ZU6A 2Q1SA 3E1KA 4J9UE 3LIIA 3CUKA 5LUAA 4EQZA 3SYQA 5DN6G 1VLZA 3GFRA 3OBYA 1T5SA 1Z8HA 2ZSAA 3KXKA 1AMUA 2G28A 2VH2A 3N2YA 3X1KA 4MA5A 3FJ1A 4FYWA 1XJ0A 3PNBA 1BTOA 5LQJA 1KY3A 1PZMA 1R3KC 4QSMA 2PN1A 1O2DA 2XCOA 3FGPA 1ZWZA 1AURA 3G6KA 2FKXA 5B1IA 3LWQC 1DTWA 4QOIA 3QWHA 2Y92A 4FNMA 5H5NA 2Y67A 5IF9A 5EP3A 4C0KA 3K2IA 5A9GA 3OC0A 3PNMA 4MVJA 1FIUA 2OCCC 4PTYA 1MHTA 5A5DA 4Y6PA 4H1HA 1KY4A 2HU2A 3AUTA 4RY0A 1OU0A 3HXLA 4AMZA 2E18A 4HQOA 2UVDA 2FSIA 4F2PA 4BQFA 2ZUBA 1W57A 4G81A 3RVLA 2GKSA 2JDIA 1ZRMA 1P0MA 1H1LB 3GJYA 2VDJA 4Q1DA 4TT3G 3CYOA 1GO0A 1XU7A 5DWQA 4RJ2A 3F9CA 3OP4A 1PFWA 1AY0A 4IO1A 3UAGA 3E3NA 3N2GB 1M0TA 1G4YB 1Y76B 3BXPA 1R9GA 2H9AA 2R87A 2NV6A 4CIBA 4CQLA 1T1SA 4AX8A 2EBHX 2C1XA 2ZGVA 3BMQB 1NQAO 2C4VA 4PGGA 1CRQA 3GNLA 3IAFA 5D2CA 1H3NA 3G49A 3TD5A 1WV0A 3QXHA 3NGXA 3KOYA 2NWQA 4BKQA 3P4XA 4IZHA 3EPJA 4BNYA 2Q5EA 5LIPA 3M33A 2RI6A 4E4EA 1U0RA 3H2ZA 4XYLA 1N9KA 1E9VA 5A3QA 1X74A 2NYVA 1GO2A 4HBGA 4C4PA 1MENA 5HTKA 2RB4A 1JJIA 3TCXB 5D5QA 2QP3A 2DT4A 2HJWA 3U1VA 1ADYA 2XWSA 3CGGA 4HRXA 1OLXA 2ZI3A 3H1GA 1XSEA 5LQNA 5KYKA 2QT9A 4QJ3A 1FMTA 5AW2A 4B33A 4B83A 2V7XA 5G4LA 2G7MC 4R83A 3R7NA 1AK2A 4AZ3A 2VDKB 4CKCB 4LE1A 3K5MA 5BQ5A 1SRQA 3LBNA 1IZ8A 4MI1A 3UWDA 4PC7A 3PRKE 1S3FA 2J3QA 1NTRA 1DHTA 4BZXA 5K0EA 4PX3A 2PGAA 4OLFA 1YR7A 4DCPA 1A8HA 5TE9A 3REOA 5AM4A 1VDMA 1NT2A 5BR1A 3CHYA 2ZJOA 4UU7A 3R9WA 2Z01A 2WM9B 4H0FA 2EJTA 5CCXA 1X8JA 3I55V 4JA0A 2O7RA 1Y5IA 1IEWA 1RRKA 1MDBA 1HNWO 1E7SA 2HJ9A 3DLIA 3SQLA 3SC2A 2BFFA 4NZPA 5HUJA 1PR5A 4CT4B 2CUZA 2AEMA 1W2WB 2PZKA 3FGNA 3OWHA 4Q7JB 3W7BA 1R6UA 3J81A 2QWOB 4M46A 3IR9A 3NEAA 3URKA 1HE4A 1DQSA 5CM8B 1E1QD 4EJ0A 5K3FB 2GBIA 3IR5A 3PC2A 3FMIA 2E5WA 3U0OA 3N59A 4KITB 2F1IA 1UDAA 1AI6A 1PAUA 4X41A 1P80A 2WP8J 1NNUA 1NW5A 5FYQA 2C9DA 4C0BA 2UKDA 4YRPA 4GYKA 4U0KA 1AX9A 3MTIA 4B3TB 2UUBO 4NK4A 4CODB 2WJ3A 2RC6A 4D3SA 2REXB 4N4AA 1Z4OA 4JI7O 2ZIUB 2A1UB 5EXPA 2JFOA 5IFLA 4ME6A 3X1YA 2O3QA 3BRCA 1KH2A 3DXRA 1ADCA 4FM0A 1YT5A 3UHJA 4CNBA 2EINB 1DPFA 3HXKA 5A3SA 1YQEA 5BT9A 1MABG 3F7TA 1AVTA 5EIWA 2VNAA 1XUOA 2AHRA 2MSWA 4IXTA 4NHOA 3PC4A 5JAPA 2QUKA 1ZDMA 4MS4A 2G5CA 2WPDG 4P7FA 3HRIA 3M3PA 4B2YA 1CD5A 2PRSA 3C70A 3PQ3A 3X1MA 3OF3A 2EIJB 4INJA 1DTSA 2Q5ZA 3OMIB 1BL8A 4CEJA 3D4LA 1KDYA 1UINA 2BHTA 3RS7A 2P9BA 1KU9A 3RRBA 1DTWB 1T8WA 4NWIA 3U7JA 3HBFA 2YY7A 2IHNA 4JELA 3AG3B 3UPDA 2VAWA 3HJGA 4ERHA 4J6FA 1WB4A 2CLFB 2UXCB 2ZRDA 3ZDRA 2P6PA 1B76A 3SMQA 4YT2A 1VI5A 3ICQB 4TRRA 3ZVMA 2WHYA 3JD1A 3FHLA 3UY4A 2WALA 3WPWA 4EMTA 4JYAB 1ARZA 1IBSA 2D06A 3FYHA 3A8TA 4RVOA 1JE1A 3M4NA 1FNJA 3OFVA 3NAZA 4LYHA 2HRYA 3CLSC 1EZ4A 1Y9AA 4NLLA 3W4IA 3NBYC 3LRTA 4BW5A 1MDFA 1GGNA 3F7VC 3BKXA 3E4CA 4EVRA 1K33A 4DA8A 3O75A 4AZ0A 4HN2A 3GZNA 1JRLA 4QGGA 3URMA 1QYRA 1UDRA 2ZYGA 3O65A 4HDCA 4WK6A 1DC7A 1QH8B 4CQLB 4CTKA 1LQUA 3UT5A 3DE3X 3F90A 1EGQA 3M3HA 1K8QA 1PKXA 3LSUA 3UWOA 4IIUA 3WGGA 2KI5A 2IS1A 1L4LA 4PA4A 1IHPA 5BSVA 2YSUB 2Q1WA 1IQRA 3SYMA 2JI9A 3SK0A 1VM6A 2YZNA 3EARA 2I6SA 1IBMO 3WI7A 1I3MA 4UFNA 2NX2A 1AA6A 2HD4A 3VNBA 3CT6A 3RC9A 1EDDA 3H11A 3ZWNA 3U1BA 2XUHA 3OESA 4JJEA 2EGHA 4QNMA 4CS3A 2VJAA 1BEZA 4HL6A 2EFGA 3W77A 3ZG6A 3PX2A 3QLVC 3LL4A 3ZYCA 1GXSA 4WINA 1OLXB 1BW9A 1E1YA 5UKDA 3E1SA 2OE2A 1MAHA 5K0CA 1XAJA 2BR3A 2YXYA 3OZ7A 4DPKA 3RUAA 2NU6A 4ZJZA 4ZHWA 1XJQA 1Z73A 2A59A 4MVWA 1FYJA 2IEYA 4AZ3B 1E8DA 4W9MC 4F8EA 4M9QA 3SYLA 5AUNB 3EOZA 2BFPA 5BQOA 1XRNA 1RPRA 4NKRA 3C0KA 4U8HA 1F6DA 1Q95A 4OXYA 3B7GA 2XZPA 4DR2B 5K0LA 3LYUA 1NDHA 3ROEA 1NT2B 4WFAV 1PWHA 1R6NA 4FPXA 1ZH8A 3BD6A 4CKWA 4KNWA 1H47A 2D1RA 3QHQA 1QJCA 4TL6A 2LUOA 3C3XA 3Q11A 4MMXB 4AZTA 3DNMA 5BQXA 4GOND 1RYHA 2JZNA 1RJDA 2ACVA 2Y27A 3SC2B 2BFFB 2GERA 4WTOA 1JJAA 1IPEA 5BW4A 2QVGA 3NORA 3ZJVA 1FFCA 3LWOC 1U8FO 4V0ME 2Q5HA 5GGYA 2EZ8A 1V3QE 4J4BA 1S2IA 3GJ0A 2JNWA 2CNBA 3IKJA 1SR8A 1DELA 5HQJA 4D2IA 3BXFA 4R05A 3I2YX 2HFKA 3G5TA 4PQFA 1U5BA 1HLGA 4MYHA 3N7AA 3F3KA 4QICA 3K6KA 4OQMA 3ZMSA 3CYFA 3VZRA 3SPXA 2CHFA 1TM7E 2N42A 2JVIA 3GA7A 3RYCB 4LXTA 1SC3A 5AJXA 3L7MA 5IH7A 4DWJA 1DG9A 2WTXA 2WIKA 4LZWA 2Q41A 3OZUA 2ADMA 2FG6C 4M4SA 3RRYA 3UKMA 4K6GA 2E4XA 3EQZA 3H04A 5JU6A 5H1YA 2AKEA 1JTEA 3UUWA 2J9FA 4BGDA 4DBZA 1WM1A 5DLPA 1RQ7A 4A27A 1Y8QA 4LOHA 3FCXA 2GCGA 4JXXA 4YO7A 3ZQ6A 2B6NA 2EBOA 3YASA 3MB8A 3DYVA 1JEOA 4YYZA 4RQEA 2HAEA 4YV1A 2PO7A 2QKSA 2Q9CA 3LOPA 2ZTHA 3N0TA 5C4GB 1VE3A 5IWAB 4OHBA 3PJEA 3FX7A 3I45A 1DQNA 4LF4O 2W2LD 4JL6A 3BWCA 5IM4F 2JEOA 16PKA 2OK8A 3BSYA 1Q0PA 1UWVA 4G01B 3L73H 3D8SA 4RPJA 4RFVA 4CEJB 4GR5A 4MUXA 5AI4A 3NHJA 4F06A 3BVPA 4ZXFA 4TLAA 1K0UA 1Y67A 3QBDA 2ZTSA 3LVFO 2EQBA 4AO6A 1A8SA 3I01M 5ITWA 1Q81H 1FNBA 1O8BA 2Z2KA 1OBHA 3QQ5A 4PYNA 5IKEA 3TSCA 3KL2A 4GL4A 4LJLA 2V96A 4NBVA 1W25A 4HWOA 1ILWA 2XUIA 5ARDA 2CTWA 4K46A 4B75A 2DFLA 1ZOPA 4H44B 1HNXO 1JP7A 3G5LA 2DJVA 1U02A 3H6HA 2W00A 3HDYA 3A1FA 1FFDA 4N5HX 5CA0F 2W0MA 3UOWA 3PUYA 3ZDAA 3LXXA 3WLEA 3SJAA 3SMVA 4P35A 3R6LA 4QOGA 4P0PB 3FBGA 4C5BA 3LUGA 5LP6C 2XMGA 4U6NA 1DRJA 1QF9A 4AZ0B 3GZNB 3LW8A 1IURA 3B2EE 3VJKA 3WMXA 4OUDA 3SGLA 1WVGA 4B3DA 4YY3O 1JQAA 3WRYA 4HGZA 3UT5B 3EFOA 4V38A 1T24A 3ZTTA 5LQCA 1JN0A 1NRXA 5LHHA 2ZCJA 3R5FA 2GN2A 2OCKA 2J33A 3L74H 1F5SA 5H7XA 4BLWA 2ZRKA 4RQTA 3CU5A 2O2SA 1IQUA 1JJFA 1X0VA 3A06A 3UM7A 4KUHA 1GNPA 4JQYA 5TV2A 4KR7A 3AR3A 1KKLA 4H7PA 4YCSA 2OQVA 1GHTA 5CG1A 2PSHA 3SKVA 3VAZA 3CZ5A 3DE7X 2EBWA 5JHGB 3H11B 5ESRA 1BWQA 3KUXA 4X0EA 2R1UA 2C8VA 2HO4A 2IDZA 3QVLA 1GOTA 3S5UA 1BW9B 3AZOA 2R25B 1C7FA 1G3MA 1Z18A 5DJ5A 1XA4A 5TQVA 1IEVA 1HW7A 2AOTA 2NU6B 5EPOA 1T6NA 3IMCA 4WECA 5D3KA 4B7KA 4G4WA 2J48A 2AXTZ 3EVEA 2QUHA 1IJFA 5IVKA 4WA8A 3U7FB 1NI3A 1OXVA 3TG8A 5CB4A 4BAYA 1R3JC 1VP7A 1QHEA 2Q46A 3IUJA 4OQNA 5FP0A 1AUXA 2J5QA 2WK1A 1KZHA 4LF7O 1L4YA 2WJVA 2DYSC 4PN7A 1DZIA 2EBFX 2B3TA 3BH0A 1SZTA 3VPAA 1TYCA 1N34B 4FYIA 1T9KA 2QW0X 5HHTA 1UBUS 4U0JA 2CV0A 5BV2P 1FXKA 1HT1E 5JS1A 1KP3A 2VAXA 1T26A 2F66C 2XA9A 4H3SA 2D1SA 4UMDA 4F0JA 2C31A 4DLTA 1R0WA 5E6SA 3M4JA 3F5FA 2FMLA 1U80A 1HG0A 1HSOA 4RHCA 1U5BB 1AQYA 1OBOA 5EP1A 1CJVC 4JBWA 2RJOA 2UUOA 5COQA 3KUUA 1E2GA 2VTDA 2P91A 5DBEX 2JL1A 2A5FA 4TVSA 4ILKA 4CU5A 3EEQA 1XELA 5BXZA 4LK3A 3HFRA 3U60B 2NPIA 3FLAA 2YOFA 4UHDA 3LDDA 5CYFA 1QD9A 1DADA 2HJFC 2UYJA 1D1QA 2F48A 4CMEA 1PJQA 4R51A 4N7BA 2J9FB 3T5DA 1YRHA 1X3SA 3RRXA 1BFKA 1U2DC 3A1NA 3KCXA 1Y8QB 4JJIA 2H4YA 1TUIA 3GYBA 4G56A 4KO3S 4QRHA 1HF3A 1JSZA 4MV6A 1U8XX 2XF8A 5I8WA 2W42A 1GUFA 3DD5A 4I1OA 2QZSA 5DW0A 2H7CA 4QQKA 1SWWA 1UIMA 3GLTA 5FL3A 5AVOA 5HA5A 1YMQA 5HZMA 3JQ7A 5E4JA 3QA9A 3SYCA 1PF7E 1V5FA 3QU7A 2AR9A 2X9GA 1X38A 1SVOA 5ER6A 2BTQA 2JHAA 3COPA 4LRWA 4CM1A 1X19A 2FGKA 2Q1YA 3WIBA 2HA6A 3W5SA 3RU3A 4N5MA 1Z9BA 3SS9X 1NN5A 3U1TA 1IQPA 1OAKA 2BT4A 1B6RA 5DHFA 3AI3A 2C07A 3L0PA 4YJDA 4TLDA 3EVFA 3SFTA 1U0GA 4CR6A 3DM5A 3TQSA 2LBXA 3GVIA 1UBEA 3L40A 1OSNA 4PX2A 4I9NA 2DJIA 5AHOA 1JDUA 2HLDA 3C43A 1DKLA 1VF7A 3A4LA 5B6IA 1XZFA 3G17A 4GCZA 1G7RA 2CNLA 1W29A 5CLLA 2OUIA 5LYJA 5TGDA 2ECKA 2X42A 3AL0C 5ALSA 2WHEA 1U0TA 4RSGA 2Q4BA 1IYZA 4LJSA 1SKBA 2NU7A 5BNIA 2BE7A 4UREA 4UB8Z 5B3AA 2GLXA 1WULS 4BY9E 2B1IA 4CT5A 3MGCA 3DZDA 4D99A 4ZDJA 2ZKOA 3VTIC 1RIIA 5DNYB 3T4ZA 1RI1A 2LBTA 3LQ2A 4OUDB 2P2YA 1YA6A 4XCQA 1K98A 2XD9A 3EFOB 2ZDGA 2C9ZA 2R8BA 2B69A 1WUIS 2CCJA 3DDNA 2R65A 3QWAA 2BEKA 1YL5A 3SKYA 2FPOA 4BU1A 3AO0B 1L2TA 1DIRA 4MHOA 3WV5A 2DOKA 1XLTC 3OAAD 4L8WB 1BOFA 3N58A 1C14A 5L9AA 2BH2A 3GUHA 2B92A 3L0SA 1I6MA 3GI1A 1NVVR 5SY4A 4M0UA 3LLSA 1CVIA 1CNEA 3MOSA 4TMVA 4DLXA 2VOJA 3TRKA 1V8DA 3ZNPA 4EY3A 1G1AA 4DEXA 4C8IA 2GJ4A 2P27A 1OW3B 3K9WA 2OV2A 3C7DB 2I9PA 1DKRA 3C6ZA 4CBVA 2AOTB 1UL1X 2HKIA 3DTTA 4J1NA 3DE6X 3TXYA 4UNIA 1AK9A 4RADA 1Y3CE 1B06A 2L19A 4CDNA 1PHRA 2HYIC 1DG1G 3NS7A 5CB4B 3DL7A 2AI3A 3JYCA 4GDMA 2RCNA 4RTSA 3G0IA 4PZCA 3RTDA 4OBXA 1ZONA 1VQ4V 2Q5CA 3ZTWA 3K0FA 3OT7A 1LSOA 1TOAA 3KLNA 1O4VA 1UJNA 1U7UA 3JYOA 5BQ3A 2WTAA 4U7FA 2DPXA 5CX1A 4QIHA 2AQ8A 4GYWA 4BO1A 1BU5A 1HTBA 1FXKB 1HT0A 2FWAA 3OCCA 3G23A 1SUSA 4BT3A 1DQRA 3QOXA 3B6EA 5EKXA 4FYHA 5JATA 4ZOLA 1GPUA 4CWAA 1N5LA 5JFOA 4YROA 1ZC4A 1Q5PA 1M5IA 5FBHA 1MSWD 4GQBA 1ODIA 5E6SB 1Z13A 4RC9A 5DNCA 1ZKDA 3FDFA 3PFGA 4DV6B 4HPXB 5IC5A 2I4LA 3A4YA 5KHOC 2IH4A 5J4HA 2CNDA 5ITZA 1FP7A 3FUXA 4BB6A 5ISMA 4OCZA 3QEAZ 1NOIA 5EN4A 3R8XA 2PKQO 1ZVMA 3CPWU 4G41A 3DV2A 3DOCA 3IVMA 3OJFA 5A1JA 3RS8A 4D26A 2FX2A 4CDRA 2IJKA 4HLDA 4A26A 1XQ9A 3OJXA 3HPQA 3B3AA 1JTFA 1JR4A 3UQYS 3BRQA 2DE0X 4P58A 5KDDA 3E35A 2PRKA 1W75A 4UCSA 4LOIA 4FDVA 4G4GA 3HKEA 4WCEV 5DX1A 5EO3A 4B40A 3EISA 1RZRA 2VFAA 1HI9A 3MGGA 3JQ7B 3LT1A 1J00A 1SKYB 2J3HA 4KQWA 2XOEA 3LNNA 3CLTD 2BTQB 1O0SA 1XJ5A 4J7AA 1HOXA 4GE0A 4WXEA 2XYHA 2OL4A 1Y9JA 1H2WA 3DAHA 2Z6QA 2QSAA 4XQCA 4L9WA 3GPBA 4C4WC 3PNLA 2ZSEA 4ZRDA 2EWWA 2R4UA 1P2TA 2CDYA 1ECJA 2DFVA 4Q9HA 1PDWA 3GEGA 5EVJA 2WLLA 3GLKA 3NALA 2BDEA 4B32A 3WX0A 3AJ9A 5LR6A 4F84A 1M1KH 1E5TA 4FHGA 4ER6A 1KD1W 1OLSB 4BRZA 3I1IA 2MOKA 4B7EA 1UF9A 2XD4A 3NM4A 3B3GA 1SS3A 3WKCA 1CUUA 1I7NA 4IRXA 4HB2A 5LYJB 5K9ZA 5LWQA 3DQQA 4RLFA 1SQ0A 2NO9A 4E3WA 1P1FA 3RTBA 2P4SA 3DAFA 4GZRB 1PT9A 2FQ1A 1Q15A 1PIWA 5IAAA 4FR0A 1RABA 2B5UA 3E8BA 4YRSA 5F2NA 4YQYA 4EHNA 1P9LA 5ERYA 4C6SA 2A0LA 1Z0AA 4G88A 1OTXA 2G0TA 1R10A 1X7DA 2XE4A 3JQAA 4Y8VA 3AJEA 1J7JA 1N2BA 4P7BA 3HJBA 1PJ8A 3T5GA 3WIEA 2Z30A 4LTDA 1L1QA 3VGPA 2RHLA 3FCCA 3ABTA 3ZK9A 4X64B 4D4JA 4K87A 4LQLA 3PTLA 3PP8A 3AG1B 3U4DA 3A70A 5FR2A 5HS4A 1NVPB 1XTQA 1G7TA 1SQBH 1ZZEA 2WE8A 1A88A 1C7RA 1UQUA 2Q3HA 3T4UA 1E2EA 2EF0A 1OWOA 4GMFA 1ZMRA 3LUPA 2FEMA 3E2PA 3TUIC 4HQNA 2F95B 2OV4A 3L6CA 4YAIA 2X13A 3NIGB 1V1RA 2ZWPA 3UA4A 2G0NA 2BEJA 1M83A 1VK3A 1IVYA 1N2CB 3GCGA 3IUSA 4AG3A 4D80A 3CINA 1FXVA 2H1LA 3ABKB 4OD0A 2C8JA 4GPBA 3QW4B 1YBHA 4EEZA 3RIXA 4WACA 1H6DA 4O5AA 2WNSA 4EFEA 4OHWA 5CLIA 3SF0A 1EIZA 1U0BB 1GTVA 4LDRA 4F9GA 4LQCA 3EMKA 4ZT5A 3NJRA 4K9QA 3DEKA 1R1MA 4KFSA 3E3LA 3KTDA 1L8AA 4R8KA 2VK2A 1N4AA 3K0FB 2JBAB 3DZHA 2G38A 3V80A 1VKNA 1U3DA 1GRVA 2WAOA 3RT1A 3KSAC 1XX6A 1K9MW 4OK6A 4CMJA 4H08A 3U0VA 2I2WA 3WWCA 4ZOLB 2FG7C 1UFIA 1JG1A 5M2QA 5EEHA 2JFVA 2XF2A 2H6EA 4WFEA 3TD4A 2QN7A 1OYOA 5DXJA 3D3QA 3E83A 2JFZA 4F45A 4UQPA 4KLAA 2VP2A 3I05A 4A91A 2I71A 4MS2A 1NXSA 5ITZB 5AJUA 2HA0A 2PUHA 1PUIA 3Q1KA 2ZREA 3EY9A 4BVEA 3MHSC 2X5JO 5A3VA 1FTQA 1D1SA 1RCUA 4BFZA 1UP4A 3IX7A 4P80A 5DV9A 5LM3A 1N1DA 4HX2A 4JB0A 1ZPDA 4HVLA 3QNMA 3R5TA 3BHNA 1UPGA 5BUZA 1O9BA 3W2HA 3LECA 3Q87B 3WZ2A 2YWBA 5BR8B 2WT4A 1R00A 3GLHA 1L6RA 1NYLA 1JEJA 3HKEB 4FLFA 3ZUPA 3RADC 3PAFA 3A4TA 4UMVA 1DLIA 4JKIA 3GG2A 3GFPA 3O21A 3UHFA 1NQ3A 4E88A 3B1YA 1GG8A 3BGVA 2VDNB 5EE5B 3ZK7A 3G8DA 3T0FA 4CIYA 4KR3A 4QPPA 3B3JA 1JKMA 1ST3A 4XUEA 4ZT4A 1RXEA 4M1ZA 4Z4CA 2CLSA 4CF7A 4QWWA 1TQ4A 4QU8A 3BMOA 2WUWE 2RHCA 2O1EA 4BMXA 4ETWA 3HA3A 1Z6YA 4OJNA 2WLLB 1YHQF 4PINA 5GIPE 3F5MA 4XCVA 1KOJA 2LCFA 3JRNA 2ODNA 1UKYA 2C2AA 5DTIA 2HDNB 1BKDR 1E59A 5GZ1A 3HADA 1EEXB 2JIZG 2O9JA 1LZKA 5KNCA 1B74A 4JT4A 4WOBA 3WZLA 1U7XA 3FRHA 4Y67A 3PQ6A 4BVKA 5GIPC 2ZAYA 2ZPUA 1FB5A 5FPQA 1U1EA 1M90W 2VBCA 3EIWA 1P8JA 3SPHA 1E1QA 1TLTA 1NATA 3RWOA 2A06H 3H8SA 1SFRA 5H80A 4ZC8A 2AN4A 2REBA 5EUQB 1GKLA 3C3JA 1XLWA 2VEDA 5JASA 4RAOA 5CA3A 5CRIA 3TGUH 3DV0A 3ITEA 1MW8X 3JQAB 3E53A 4YALA 1SETA 3OUUA 3IP1A 1ZZGA 3WYDA 5JDIA 2QG4A 3LC7O 2ZIFA 1PXWA 3WYAA 1EBOA 1P77A 3PCRB 1GKFA 4ZDWA 1RPZA 1ODEA 4AP9A 3QI2A 1X6VA 2GVDC 1FFYA 1OXSC 2CZCA 1ABEA 1JYEA 1QZTA 3NO4A 3CRVA 5G0UA 4L5AA 1N2EA 1TLLA 4KOAA 3RC1A 3R23A 3DKIA 2ACKA 1ODKA 2EJVA 4URXR 1Q90D 3AFGA 1HURA 1ILEA 4QBHA 1D03A 1U3FA 2NZ2A 2Q9AA 1FTNA 5FWAA 1V1RB 2EARA 1U2SA 4NYJR 3DZIA 3T1HO 1V37A 1DPGA 5FPYA 2RK6A 3TUZC 1B3RA 4G2NA 1RLOA 1T0PA 4LQ4A 4UCXA 1XAHA 1TO6A 1LW6E 2NNLD 4JI4O 3IGFA 3DAYA 4OQLA 1YIDA 3R74A 3M1AA 1ZWKA 3NQ41 3G1WA 1NIPA 4YH1A 4QNHB 5EKTA 3BDIA 1NY6A 2PGJA 2FYUH 2NQTA 1YSCA 2BSXA 2AZ2A 3CKLA 1EFRD 1E7QA 3ZI4A 3B7WA 1B93A 3I62A 3D2AA 1TZMA 5K7SA 4DMLA 4QUEA 1XN4A 4AKHA 3QVSA 1L4NA 1AKUA 4K9SA 4AG6A 3OJWA 3CCSF 4KXWA 4ZI2A 1UKBA 4AICA 4FXOA 1UK8A 4MICA 4WH0A 4RAQA 1L9KA 2H00A 4OPMA 4REMA 5BXYA 2ZWIA 1GJRA 4HDKA 5A2QA 4GQAA 4HH4A 4B4UA 1Z83A 2D2IA 4XUGB 3EVCA 3ENQA 4ZXPA 4I9FA 4WCFA 2WVAA 4YI3A 4NPCA 1U8AA 1V11A 4NXNO 1I33A 5FUVA 3ZXXA 3N4YA 4CM3A 1PG0A 2GK3A 4JQOA 3TD3A 3ZHOA 3BD8A 1DJOA 3D02A 4EECA 3K1AB 3QOYA 3GGJA 2FP3A 5D5PA 4P5EA 3B4SA 4EI8A 3U3ZA 1MG1A 3IB6A 1M2NA 3P9YA 5DB4A 3STUA 4LDNA 4OHUA 5L6MB 3K0AA 3S03A 4E33A 3RE3A 1LDBA 4ZVQA 1MZPA 2HBYA 3C5VA 3HR0A 5F23A 2V9ZA 4BAGA 1XB2A 4JGGA 4TGLA 1KYYA 4DDKA 1IHXA 5I4IA 4TT8A 4FZVA 4AM8A 5LDHA 4V02A 4WVFA 4AJ9A 1AKMA 4YPFA 2VP0A 5AHXA 3MCTA 1C9EA 4RK4A 3U3MA 3HVKA 3L7NA 3L4BC 2PYIA 3NJ4A 3U19A 2BFBA 3BMOB 1I4TD 1PSDA 1R18A 3L43A 4QUAA 1XHZA 3GWZA 3MS2A 1GEGA 3OBWA 2VZEA 5GINE 3CQ9A 1EDOA 3I56F 4YMHA 4TQFA 4ZU6X 4QYMA 3O91A 1G6OA 2OBFA 1UJCA 1SESA 5E6UA 1DBQA 4GG1A 5A5GA 3VJMA 2I6QA 1UZAA 4MROA 1I2BA 3NKFA 3K73O 4BHTA 5GINC 1XRGA 3U3RA 2CDCA 5EIOA 3MGKA 1XI1A 3ONNA 1YRLA 1T91A 1Y4SA 1EVIA 4O4JF 4KAXA 4XASA 5FHRA 3MM4A 1TKBA 5I9TA 1JQKA 2OV1A 1QQ7A 4P83A 3K20A 4K6FA 3ZGVA 3AGQA 4XIFA 1C9NA 3BS4A 5KYVA 3DV0B 1XRJA 4DC0A 4KLCA 1BT8A 1MN6A 5IUJC 2V0NA 3C7KA 3HCOA 4GVLA 2L26A 2HK8A 2IT1A 2H17A 3VBCA 3BWMA 2IX3A 2QN1A 4AJIA 4G9BA 2IH1C 2I8CA 4CF6A 1DRKA 1K8XB 1CRPA 2RK4A 1ZEMA 3V8BA 5JS7A 5IBPA 3NTLA 3JARA 1KIAA 5FTWA 4EYSA 1I0HA 1RZRD 5KHHA 4O4IF 4H1VA 3KR2A 2VEOA 5DYIA 4E14A 2DETA 4B5LA 4WY8A 4LF6O 5LQAA 4R9RA 1ULAA 5DNVA 2TRSB