3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
3JASB 5LYJA 5GONB 4O2AA 5LP6B 3C8LA 5EZYA 3JATA 4I4TB 3RYIB 1Z5WA 5IJ0A 4X1KA 3N2GB 5JCOA 5LXTA 2VAMA 3CB2A 5EIBC 3VO9A 4O4LA 4B45A 5CA0B 5LOVB 4X20A 5FNVA 3WGKA 5CA1A 4O4JA 3RYHB 3JASA 3ZBPA 5LP6A 2RHHA 1W581 5MN4A 3JAKB 3RYFB 3RYIA 1RLUA 3N2GA 5EIBD 4I50B 5JVDB 4YJ3B 5IJ0B 5CA0A 1SA0B 4TUYB 3ZIDA 4O4IB 4O4LB 3RYHA 4DRXB 4IHJA 3VOAA 4O2BA 3JAKA 4O4JB 3JALB 3RYFA 4EB6B 5CA1B 3R4VA 5M7EA 1JFFB 2XKBA 3V3TA 1FFXB 4O4HB 4I50A 5JVDA 4YJ3A 1SA0A 1Z5VA 4TUYA 5EYPB 4O4IA 1RQ2A 1W5EA 2BTOA 4DRXA 3WGNA 1OFUA 5IJ9B 1RQ7A 1FSZA 3JALA 4EB6A 1JFFA 4IHJB 4KWEA 4M8IA 4O2BB 1FFXA 5J2TB 2GVIA 4O4HA 5LA6B 4HNAB 3WGLA 5EYPA 4EI8A 4ZHQB 5IJ9A 4EI7A 5C8YB 3N2KB 4WBNB 3HKEB 4EI9A 3UT5B 4U3JB 5J2UB 5MN6A 5J2TA 5LA6A 4FFBB 2RHOA 3RYCB 4HNAA 4ZI7A 3E22B 4X1YA 1W5FA 4ZHQA 5CB4B 5C8YA 3N2KA 4WBNA 3HKEA 1TUBB 4F6RA 5IYZB 4LNUA 3UT5A 2RHJA 4U39A 4U3JA 5JCOC 5JQGB 5J2UA 3VO8A 4FFBA 3JAWB 3RYCA 3E22A 3HKBB 4I55B 5LP6C 3JARB 4ZI7B 4X1YB 5CB4A 4X1IA 1TUBA 5IYZA 5KMGB 5JQGA 3HKDB 3HKCB 4E6EA 4IIJB 3VPAA 5KX5A 4F6RB 2R6R1 4LNUB 5MN5A 3RB8A 3JAWA 4TV9B 3HKBA 5ITZB 4TV8B 4I55A 5JH7B 1W59A 4XCQA 1W5BA 3JARA 2R751 5BMVB 2VAPA 3M89A 3WGJA 4YJ2B 1TVKB 5KMGA 3HKDA 3HKCA 4IIJA 4X1IB 4ZOLB 2VAWA 5GONA 2XKAA 2BTQB 4I4TA 4TV9A 5ITZA 4TV8A 5LYJB 5JH7A 5KX5B 4DXDA 3ZBQA 4O2AB 4B46A 2Q1XA 5EZYB 3JATB 3M8KA 3WGMA 3VOBA 5BMVA 5LOVA 2RHLA 2VXYA 4X1KB 5LXTB 1TVKA 4YJ2A 1W5AA 2Q1YA 4ZOLA 4X20B 5FNVB 2BTQA
chains in the Genus database with same CATH superfamily
3RFVA 1NULA 2D7CA 4GGMX 2CFOA 4OYLA 1H9AA 3H4IA 4OHVA 3STYA 3GOQA 2RC5A 4PBTA 5BSGA 4HZUB 1K86A 1ECCA 3B2EA 2E37A 2V6MA 1JXOA 1VQMV 3AGKA 3D3NA 1LS6A 2CF5A 1TIBA 3K06A 3B1JA 3RBAA 1FLAA 4CS2A 1B8NA 4IOLA 3CTPA 1GADO 3NBYC 4V03A 1HWYA 4ZMBA 2Z04A 1J1IA 3NEPX 1SRYA 4Z3DA 1WXQA 3HWWA 4WLUA 2PRJA 4DR2B 4BJ5A 3H2ZA 4K05A 4E46A 1XKXA 5JSQA 1G6HA 1EM8B 4J7JA 2PTGA 1XXHE 1GQOA 1E2BA 3FSJX 2VBGA 4Q3DA 4Q4JA 3EWNA 4FLUA 5HBGA 4HGZA 4L6AA 4MJ7A 2HIHA 4YA6A 1P39A 4RV5A 1BVHA 1UPCA 4PS1A 5JH7A 1LQTA 3KPJA 1SWWA 3DGEA 1Z75A 1E1RD 1VRWA 4X20B 4BKPA 3IIMA 2A5JA 3LY8A 2ZZNA 2LUOA 4PBRA 3IQWA 1T9BA 4BLSA 4NC9A 5LHHA 4WFKA 3WSWA 3DTUB 2DX7A 4PSCA 5J59A 1YQTA 4QGBA 4Y6GB 5C32A 1UZMA 1XFAA 3AEYA 3O9ZA 1WSAA 3OMLA 4RWUA 2HRUA 1KNJA 4MYSA 1HKHA 4RUKA 3SZMA 3WR5A 3F5MA 4JI5B 5I8PA 4WXPA 2O1SA 1KMIY 1YJNF 4MZXA 3SJ7A 4LWOA 5THXA 3PCTA 1K73W 5IYZB 1JHRA 1A2BA 3H5NA 3DLIA 1U0FA 4OJYA 2QRGA 4FLEA 2CWDA 4OQDA 4BV9A 1SUFA 5P21A 4P83A 3GFPA 4JJ7A 2FZEA 2OV6A 1YZBA 2QSZA 3CKYA 2ZBGA 5BSEA 5E6RB 1OIVA 1UMBA 3C1AA 3CLRC 3VU3A 3O03A 2FF5A 3QH4A 1ZNXA 4J4BA 3ZCTA 4PINA 3D3KA 3ZYZA 4GOJA 1UC5B 1MVLA 4MLDA 3PXUA 1U8AA 1W4LA 2VQSA 5EAIA 4X8HA 5H1YA 2O07A 2RK6A 1FMTA 721PA 2QN2A 3LUCA 3B9QA 2OD2A 2HWWA 1O96A 1C3LA 1OPXA 2G1AA 2HPHA 2PQ0A 3MMPA 1RBQA 3C7TA 2Z6AA 4M0MA 4P80A 1DTEA 1UJMA 5HF9A 3PXBA 1X38A 4PCVA 2Z6UA 1TCBA 2GZAA 2J7PA 3B1VA 3LSUA 1I2MA 1FNMA 3ZWAA 4GZ6A 1FMLA 1TEHA 5H6RA 2BSXA 3NDJA 5D3ZA 1Q8RA 1OI7A 1VQMF 4EW6A 3NX4A 1FS5A 1ORWA 4IZ6A 4OHRA 2AWOA 2OVBA 3B82A 4QZVA 4CLRA 4I4TA 3B8HA 2EBUA 2HRCA 1RRFA 4EKIA 3MHPA 3AJRA 3PA8A 1NY5A 2DFDA 3GFRA 1L7PA 3DE0X 3PKIA 3GFVA 3OGIB 2P4SA 4AP6A 5LWHA 3GT0A 2FKAA 3VR3A 1TPYA 2OCHA 2WA3A 3Q8LA 3AV3A 3X1MA 1NBOA 4M0CA 2EKZA 3DFIA 3MINA 4BTLA 2CXRA 1ZHHA 5IF3A 1PLKA 2JZCA 4P5EA 2R44A 2EX0A 5AD1A 1XLWA 4WT7A 1E1QD 1JVNA 1N1EA 5LIRA 4WTOA 4L5CA 1GKUB 4JI6B 2VGMA 3URKA 2IZ1A 2I7DA 3LE8A 4YR7A 3W0LB 4JIMA 4X62O 5TR9A 2JIZG 2ZQ5A 3CEIA 3SDLA 1RQNA 2QOEA 1PK9A 1DSSG 1LW6E 3RQSA 1E9VA 3CONA 3EVZA 2JGJA 1IQ0A 2A1TR 1TU3A 3TNLA 4BLPA 1E2NA 3OF3A 4CKEB 4S0XA 3PJRA 2ZRDA 1ZM4A 1RVV1 2ES4A 2KYRA 2LP4Y 2CXOA 3GN2A 1O6BA 3DVAA 4G88A 4ND2A 2Q3EA 1P4RA 4IJKA 4TT3D 4N3CA 3BHIA 4B4VA 1AP6A 3HY3A 1J9ZA 4MR8A 5EKUA 5K6AA 4FLXA 1NLZA 3HDYA 5DWVA 2PQMA 1G6Q1 1U2QA 3I5MA 1Y3AA 1LF0A 2GFHA 5CNJA 1ZITA 3DS8A 1Z0AA 1UJBA 2WYUA 4HNAB 1H65A 3TWOA 1GHTA 5EC8A 2DY1A 1AVTA 3IP9A 3V8RA 3TRDA 1P0IA 1B74A 1IM2A 3RT1A 4DO2A 1GUYA 1CUXA 3SSAA 3L0SA 1E92A 2F95B 2NPOA 2O1XA 1W0JA 3ZWPA 4QLOA 3H42B 2YHSA 3QKWA 4U7FA 4CNQA 1DO8A 1II9A 4B6FA 4FLFA 4JVOA 1DNPA 4KGXA 1N8NA 4JGGA 2D2VA 3UPTA 1PL8A 3VTAA 1G5FA 1H94A 1TGVA 3G9ZA 3WWOA 2JJ2G 4ZZ2A 1H42A 3A9CA 3RWOA 2VYCA 5BY1A 3ZCQA 5HVNA 3R8FA 2A5GA 3X1JA 5A7HA 1O94C 1EHIA 1T1RA 1DEKA 1YBVA 5TMDA 2NMVA 4FZ3A 2CLLB 5DYIA 3LOUA 2MHCA 1EVQA 2CXXA 1NYTA 4IYHA 2HQBA 4IGIA 1NVKA 1JOYA 2PLRA 1BE3H 2Y1KA 1TJYA 4TMXA 1G8GA 1BXGB 4RQOA 3BWCA 3CJQA 1GNSA 2XCLA 1PI3A 2XRMA 2IBZH 5ICSA 1ODKA 3EQ6A 5KSZA 1GG9A 1TM3E 5LXTF 5FH9A 4UCQA 1J33A 3RVSA 5CLLA 2JEZA 4U8GA 4QOFA 3KJKA 2E89A 1OYVA 4BUCA 3GA7A 2OXTA 10MHA 3MCUA 3DUFA 4QODA 1Z8FA 2PUSA 1XLUA 5LPNA 4QSMA 1LI7A 2XV1A 4N9QA 1OU0A 3LFHA 2C97A 3IQXA 4BBJA 1L5SA 3OU6A 3O8RA 3COJA 3JALB 2NV6A 4LR3A 3LUTB 4F46A 4AKGA 3AZPA 1U2EA 2MK3A 2X8JB 4AFNA 3KWJA 3NP9A 4LK2A 1SN7A 4XIGS 2FTKA 2H1FA 2JAPA 1U43A 2J5RA 4PPYA 4AMGA 2D74A 3I9MA 3REOA 1ZU4A 1RM0A 4LWQA 4ARVA 4BQQA 2Y1WA 4UV9A 4M83A 1TJ4A 4AW9A 4ZJUA 1GUZA 4K0RA 5DYNA 1GL6A 3BSFA 3PI7A 4FFSA 3F73A 4J9ZB 5EE3A 1AK9A 2ZOSA 1XZ8A 4GMFA 4I5EA 3BGIA 2WJGA 4PFSA 3B38A 3CRZA 4OUDB 4RPHA 4RCVA 2IUFA 4BWAA 3R9XA 3PTZA 1DV1A 5K8UA 2WHPA 4OHCA 1ZK1A 2R1ZA 3HXTA 1Y8CA 3Q8KA 1BE0A 3X44A 4WFJA 3CS5A 1R73A 2AE2A 2I7TA 3FWZA 4PZAA 5ESDA 5HUJA 2DM6A 1QGED 4BGEA 3RAEC 4YAEA 2OWDA 2ZPTX 2ZTLA 3ZXXA 5A9SA 3HH8A 3ZQ6A 1PM9A 4TQGA 5CBHA 4QBHA 4DA8A 1WULS 4L74A 2PXCA 5A0FA 3M1YA 3O8LA 3NMUF 1Y7TA 3AL2A 2JLWA 2WU1A 1E7RA 5DIFA 4ZT2A 4ZEMA 1ZAYA 1ZUNB 1C9JA 2YMPA 2VWHA 4YDQA 4KXXA 4BNTA 4DEXA 4R41A 4BFVA 1XILA 4CMJA 3DPSA 3SBEA 1OASA 3DEAA 1DBPA 1I3MA 3RK0A 5AUPB 1R18A 1LRLA 2RMKB 4JI8O 2CHQA 4CM4B 1I6KA 3C2QA 4UTXA 1GCUA 4MDFA 3K0SA 1MQ8B 5IKEA 3A1FA 3FZQA 1XKQA 4BGDA 4OQZA 4GVPA 4KYIB 1CY0A 1ZN2A 3NUQA 3MILA 4BN4A 3BXHA 4LYDA 4L75A 2BGRA 5KC8A 2VXBA 2Z2ZA 4MQ5A 1K7DA 2X9VA 2XEXA 3EEQA 4GE3A 4C0HA 4IY1A 3HKBB 4AS1A 2PEZA 3JARB 2UYYA 2W2KA 3GCZA 4L8FA 4F4IA 1L8AA 1A4UA 5TMBA 2YC2C 4M0PA 1SBQA 2XHEA 2ZAGA 1F9EA 3OOHA 2JRLA 1UT8A 2ZS8A 3IDFA 4GOOD 4FD3A 1PVDA 4B48A 1DF5A 3QE3A 4LISA 1L5OA 1NUUA 4HXFB 1KXJA 3RS2A 3HMKA 4Y2PA 1NBMA 2W9XA 5I48A 3I62A 4ZAXA 1GAXA 2FDXA 1JG3A 1K92A 2AEJA 3PHBE 4OXXA 4D82A 1O4WA 2GCOB 2GM5A 5EE0A 2GR9A 4N8SA 4P4SB 3FNQA 3CCVV 1NUSA 4LZNA 4RVOA 3JVDA 1JF8A 4L5IA 2UV8A 4BFXA 1BWSA 4E7PA 1IRXA 1Z8HA 1DJPA 3FH0A 4RPJA 2IJIA 5AVWA 2DFTA 1BWPA 2NZUG 5D7BA 3N2IA 3TUZC 1F0PA 3M4SA 3LQ2A 5BUSA 3W8RA 1S2OA 3W9BA 1O58A 1DO2A 2GXUA 1J9EA 4E5KA 2EINB 5K1XA 4RQBA 4MKZA 3HKDB 1XK7A 2DHQA 5MN5A 1UINA 1TM5E 3H5IA 5CB8A 1KGSA 2J5XA 4OOEA 5C5EA 4P31A 3U6BA 2SCUB 2FPUA 3EGDA 4GMGA 1YA6A 4RHUA 3MRVA 2FW8A 2GI4A 1JA9A 3K20A 1FUUA 2WF8A 1Z22A 1XTPA 1Q74A 1UBHS 4YECA 6REQB 1JEQA 1U3FA 1HG0A 3A05A 4G5GA 2VJDA 5CNIA 1ZM2A 3HWUA 4ARAA 3B5IA 4ZJPA 4R8SA 4HWGA 2WSSD 1C9YA 4J0KA 2D2FA 3P0RA 2V6GA 3UB4A 4W6ZA 2Q21A 5LGTA 1HK7A 4G0QA 2JLRA 1Q1QA 4OQ4A 4GDFA 1DQPA 4RESA 3E03A 3TR0A 2XSZA 3IR5A 2QN8A 4BZQA 5CFZA 2OCPA 4JKIA 4TS9A 4KQCA 2RCNA 3RSZA 2CLFB 3CINA 4DV0B 3VQWA 2JBAA 4ZDKA 2ZS9A 4ZK7A 1MQSA 3QKIA 4OJMX 4D0LB 5CW1A 3ZCCA 2E7ZA 3AF2A 1Z8DA 3LHDA 3UW3A 3ZMTA 2BE9A 3N6RA 5LU8A 4UCXA 2WJYA 2FSHA 5KWEA 1XRQA 3B8EA 1JQAA 1BMFD 2BHRA 1OE0A 5JJBA 1ENPA 3L8FA 3ST7A 4Q3KA 3B5EA 5FJJA 4N7JA 3WRYC 2X2OA 2M98A 3V8MA 3RU2A 3M5WA 1RKQA 1SZTA 1C8KA 4DR1B 1TGOA 2DQ3A 3SOPA 4S1PA 2W8BA 3D3WB 3T41A 2ERYA 3R6DA 5LR6A 4LY9A 2IXTA 2IEBA 4XYEA 1BAPA 1VE6A 2VBCA 3NBZC 2NYAA 1GTOA 4E5DA 3TLEA 3A6JA 2Q5FA 3EEBA 2VQFO 3CR3C 2H65A 2IX9A 1DXQA 2ZDGA 1OGIA 5EC1C 3LWDA 4OLAA 2CUKA 1Z0ZA 4MWGA 4JI0B 3V4RA 3K72B 3T7DA 3CCVF 3H7IA 4EFNA 4AG3A 2FUG1 1ZM9A 4MIEA 3C3YA 5F1KA 1EMDA 2P40A 1X7YA 1F8YA 4RM2A 4PHZA 1KU0A 3EPJA 4UHHA 2AN4A 1SXJE 1JPJA 4LFBO 4G1BA 3CU5A 3AHHA 3ZH9B 1C2TA 2YYYA 1XZMA 1ROPA 2O7NA 3UAXA 4LYGA 4QDZA 3KLPX 3I9V1 3OZ7A 1Q5PA 2ZIMA 1RRGA 3EZGA 1EAMA 3GGOA 1SURA 3WDSA 1ONNA 5ALLA 5EJMA 1JL3A 2DYRC 5TC4A 3VDRA 1RQLA 1X7GA 1G8JA 3NU1A 4XRRA 5CBPA 2GDSA 3LTNC 3IDSA 5B1AC 2LWIA 2Y76A 4ZVLA 3MZ0A 3O4JA 2FV8A 4H60A 5DNWA 4DDUA 1KBZA 3OE5A 4F4UA 5CXXA 1ZAKA 4ND8A 1P3DA 3SVLA 3NBXX 1FX1A 3MQ2A 4DA0A 4ZAVA 2MIIA 1SELA 4ROTA 4B3CA 2P30A 1NRIA 2ZRBA 6ADHA 3THSA 1FJGO 3IVCA 3NUZA 5KI6A 4ND6A 1J21A 1O1YA 2DQSA 2Q7GA 2DPXA 2PY5A 4N49A 1KH3A 1G4HA 4NH0A 2WWWA 3CX5F 5FBQB 1QNMA 2HADA 5C34B 5EP3A 5FTLA 3X2FA 2A0FA 3FNFA 3HB1A 3I34X 3UOWA 3LLUA 5FOUA 5CDFA 2GAAA 4H08A 2E5LO 2Q3BA 3WXMB 1HNXB 3O82A 1ISHA 1JDZA 1V96A 2H4FA 3GLFB 3I9NA 4UUNA 3CRRA 1ODCA 2YIJA 3PUVA 4Y1FA 1EP9A 4BO5A 5I7RA 1QS0A 1PD0A 1PWHA 3T3MB 1KR5A 3NVAA 1L3IA 5ISMA 4FEGA 1O6CA 1QR6A 1KE2A 1QQ5A 5CDUA 3ID6C 1DX9A 4YB8A 3G2KA 3CXCU 3SMVA 4OHFA 3HCFA 1Y1RA 2NUAA 1KJJA 3MGAA 2OBNA 3SX4A 1DAEA 1VJTA 2BMDA 4QQFA 4HRAA 1NYQA 3CRW1 5DCWA 2BFNA 4KI0A 2IEAA 2JHPA 1T91A 4HXYA 3NXKA 1K6JA 2FPWA 3FZNA 1XJQA 5I3CA 4DUZO 1IV2A 4QICA 4RIEA 3JWJA 5TY0A 2X0DA 4BT3A 4Y0AA 3PJDA 4OX9O 3PNVA 5JNVA 1GJRA 4QFMA 3SJQC 1OHHA 1M2NA 1K5HA 4H1HA 4HQFA 1I94O 4QUJA 1MLDA 3UAZA 1L5YA 1SRQA 3V42A 2HUNA 5DBHX 3GUZA 2E55A 1RTKA 2HHLA 4C29A 2HB6A 3E9CA 4AQDA 1ZOLA 1FYEA 1T1GA 3HKEB 3HLTA 3ZRVA 5CK4A 1JFLA 2AOTA 4ZU6X 1V9PA 3E84A 1Y4SA 1EXWA 1ZJWA 4HS9A 2CUZA 1JKXA 1WABA 5FUWA 5C1DA 4B6EA 4NVRA 3QMMA 4M1SA 4CI9A 3LOQA 3UWKA 2QM3A 1W36B 1SUCA 1KVQA 5HS4A 4R6WA 3FFAA 2B20A 3R8CA 2GZMA 4UCFA 5IYCO 3PZRA 2YNMC 1ZR2A 1NVBA 1W75A 3KUKA 3OJEA 1YHQV 4G1MB 1B0PA 1Y1TA 5FLEX 3TNYA 2G0TA 1WPQA 3I6BA 1KOGA 4CKYA 1U5AA 4QXMA 4TQUS 4DNFA 5FOVA 2BOBC 2BOVA 3S29A 3PX2A 4Z51A 4OQFA 3R3SA 3ZHOA 3I3SR 5CGQB 3MWLA 4HAXA 1S5PA 2RGWA 3C9UA 1ZESA 2FMUA 4NWIA 3NVIB 5G3ZA 4DCPA 3K5PA 1W4RA 2ONKA 4UZFA 2CV1A 1Z2CA 4MGKR 4E31A 5E8JA 5J2UA 1ML3A 1PG5A 4JVMA 3CCJV 2A9QA 4G5QA 3E53A 4HDNA 1DJMA 3K2EA 5FTNA 5AXCA 1P4HA 2R1UA 4D3FA 4IDOA 3NKLA 4GC5A 2JJYA 1ECLA 3HVIA 5ER6A 4M9QA 3L6EA 4PZ0A 1ISSA 1GLNA 2YKGA 2IJHA 5GM1A 5LJIA 3CCRV 5J4VA 3VO9A 3E9NA 4RCZA 2QVGA 2QYHA 1Z4LA 3GGPA 3TH5A 3DE4X 5AOCA 4X64O 5L7YA 5EWJA 5BW8A 3KFLA 3L46A 2CN1A 2GPWA 3G6KA 3FKSG 1AA6A 3DTYA 2OAEA 3WIOA 4KPYA 2R96A 3T7KA 2P2GA 3TVYA 5KOJB 2WUWE 3GUCA 2AI3A 1RBYA 4DIBA 2XCRB 3W1WA 4RFSB 3J80N 2YYEA 2IEIA 1K9SA 3DMRA 3G5LA 4WCFB 4KBYA 4JU9A 5ALKA 1KU9A 2Q4TA 2YJNA 3DFMA 4Q9NA 1XMXA 5B2EA 3HJWC 1OCCC 4YDSA 1J0BA 4WLFA 4KCGA 2JCVA 4OHYA 1RZ3A 5JZBA 1U8YA 4C0JA 1GPNA 1QVZA 4ZYLA 5KYXB 3H9GA 1PNVA 2Q5CA 1UXOA 5A9TA 5KNCA 2DGDA 1KAEA 5LQCA 4G9EA 1R5NA 4HWOA 1MRNA 3CO0S 2YXNA 3CYQA 3ZPXA 3P45A 2ACKA 4Z1MA 5C80A 4BFLA 2NSLA 4OTZA 3WQQA 3Q4HA 3F3MA 4MSWC 3A32A 1RKXA 1YWGO 1JY8A 1JMVA 4A8JC 4TM8A 4EEXA 3QWHA 4EIWA 5B1BC 4FDAA 3ITKA 4Q16A 4UM8B 3UFBA 1NMYA 1YHQF 2XOKA 2BGMA 1WZNA 4Q9JA 2VSQA 1TRHA 3HP1A 1Q17A 2KLHA 4QWMA 3D00A 4X90A 2NTNA 3ILXA 2JEXA 4GYJA 5FJIA 4FFDA 2DMRA 4XDGA 4TS1A 1EZJA 1Y1PA 5HZHA 1NZJA 1ZGZA 4FYYA 3U26A 3DV0B 1FNDA 3BH6A 3GPCA 3WNZA 2OCYC 2E76B 3U3ZA 4O2AB 2HP0B 3H2YA 4DMKA 4D4IA 4MUYA 5DXAA 2Z0MA 2DT5A 1Z37A 3K2IA 4N7MA 2V4MA 3NALA 2BEWB 2OT3B 4CZ2A 1EXVA 4XWKA 5AVVA 2ZJ7A 3F2IA 1E89A 2VP2A 3MTBA 4RGVA 3D3IA 2OGSA 2YL2A 5TQ0A 2FPLA 4RJ2A 2X5JO 3CXRA 4IRUB 1IEXA 1VG0B 3LTEA 5JMWA 3VYUC 2ZDIA 1SHTX 1GA6A 3BMXA 3EVKA 4DLTA 1WP7A 3CCRF 1JQLB 4KDEA 4DXHA 4IS3A 2Q41A 3AG4B 2WKSA 1Z29A 3UK6A 3KC2A 3RODA 1TVCA 5L95A 2XEDA 3O31A 4JLDA 2P8SA 3NC1C 4CEHB 5EGSA 2ODTX 3B13B 1EWTA 2XLBA 4EG8A 1KHHA 5KSPA 4U8HA 2Z01A 2ODBA 2IS4A 3C8LA 4GX1A 2LV8A 2I91A 4NCJA 3BE6A 4MV1A 1RCTE 5L3FA 2JIBA 4NXNB 2Y93A 3I55V 5BN5B 2BEUB 4MUFA 4F2WA 3W7XA 4YJHB 4EITA 4ABYA 1S72V 1YQXA 5AP9A 1C2YA 1L5FA 3U4HA 5J2TF 1WMFA 1XTTA 5IVDA 2JAUA 4KNYA 4KODA 1Z62A 5IT4A 1VLHA 5EERA 1C9DB 4M86A 3D1LA 4N3GA 4NK5A 1I7LA 1CZOA 4E4YA 4X3CA 1A9YA 2RB4A 1JHVA 1NW4A 4TSFA 1J22A 1RZUA 4KITB 1J8YF 2VDVE 1WW2A 1K7YA 3A10A 1USWA 5JROA 1RPTA 2NT4A 3FSGD 4AJ9A 1RXYA 1BXKA 5CYOA 4HVTA 3T9BA 1XBIA 5D7NA 1DIGA 4Z86A 4S2UA 3THXB 3M7MX 4CMEA 4F3TA 2V9CA 3DMTA 5FOQA 1FRFS 5GONB 2NO7A 5IF9A 1PJ4A 2B34A 4X61A 2Q5ZA 5JANA 2L42A 2B5VA 4F0JA 1CUEA 3ZD6A 2NUPA 4C4YA 2PUAA 1Y7LA 3F9IA 4HH1A 3I58A 1ZWZA 1E6MA 4EG5A 3M6UA 4DW8A 3JR7A 2YOFA 4HVAA 2CAZC 1O08A 3DZHA 3R6WA 1XRNA 4WL0A 1R0KA 3G2PA 1LBEA 4RPGA 2PJUA 1LSJA 2F4NA 3WNDA 2GKOA 3KQYA 2NQ8A 2HCJB 4I7EA 3WHLA 5GMOA 4D7TA 2XUDA 3H1PA 3T1CA 3SJCC 3C3KA 3LUKA 3PC8C 3CX7A 3JAWA 4DJJA 3G8CA 4I2NA 1BC5A 2BONA 4NYJR 1H3NA 3BN3A 4LBWA 2IAFA 5EZYB 4RMGA 1YEWA 1PKXA 3ZOKA 1G38A 2ETNA 2AFHE 3G67A 3IC7A 5CEEA 1OW3B 1T9KA 4EPWA 5B1NA 4PM4A 4CLOA 3O4RA 1V1JA 1L4HA 1DQZA 4QOJA 3TD4A 1Y8QA 1WE2A 3AHIA 3UPUA 3GVMA 1L3BA 3L6DA 4L5BA 5AMXA 4B4WA 4AZ3B 1P7GA 1FFSA 5C93A 1LNZA 1OTHA 3PQ6A 4G0WA 3UHOA 4LTMA 2A9VA 4Y3UA 4NYIQ 3TTYA 1SA0A 3PHLA 3CX8A 3R5XA 4DADA 3LYHA 4G5YA 4PLGA 3TZBA 3FYHA 4QT0A 2ZYTX 1SKBA 5G41A 3FRHA 1O6FA 1AK2A 4CM1A 3NGLA 3M5CA 5JWRA 1OX4B 5FA8A 1T0KB 1M1NA 2WHQA 2QW1A 1S72F 2DFKB 3VNRA 4IQFA 3QELA 3KJQA 1JFTA 3DDOA 3KCQA 1YJXA 4D9GA 3ZWYA 1PHPA 3PCXA 1C9KA 1DEXA 1QGUB 1TVKA 2PUWA 4RZ2A 1G41A 4W5NA 2B4KA 3PZBA 2PI5A 4DC9A 2XE6A 3W2FA 5F35A 4XIYA 1CXZA 1CP2A 3G80A 2PO7A 2F55A 4Y2YA 2VK1A 3WL5A 2ZVDA 3GEGA 2XF8A 2YH2A 3BYZA 1Q6ZA 2VYNA 2CUNA 4O2BF 4L4RA 5CTJA 2EGGA 1AHIA 4JH0A 4N3AA 3OSZA 2PMEA 1YI2V 1F5SA 1QMPA 2WD7B 5DU2A 4BKOA 5BYAA 4R0VA 2GPTA 7ADHA 1UPFA 2NMUA 4RM3A 3ZX6A 5J4HA 2VT2A 2YXDA 4NCXA 4RSGA 4HAVA 2BBWA 3U11A 3H11A 1GR0A 1WBDA 4QRHA 2N05A 3PC2A 2A0LA 3OUSA 1XALA 4ZARA 1NXXA 2F9FA 5DNAA 2IL1A 1EFVA 1VMAA 4I1PA 2V65A 3CVOA 1B23P 1EWRA 4QU5A 1Q1AA 2YUAA 3EZFA 1CEEA 2DHCA 3UK1A 2KI5A 1A7JA 1BQZA 4RS3A 2H6LA 3U39A 3AIKA 4YWJA 2GF9A 5BV8A 2WK1A 2D2CB 2YJ3A 4HLDA 3R24A 4JUFA 1QHXA 1Y3HA 3G0DA 2WP0A 2YY6A 5F77A 2PUFA 4ETIA 4DUGA 4OLBA 4J3NA 2H3EA 4NONA 2JGDA 3TX6A 2GASA 1UK8A 1VL0A 1L4BA 4Q3OA 5A9GA 5IKXA 5E95A 3IUSA 4JP1A 2IQQA 1QP8A 1ZL8B 1Y5NA 1KE1A 2P9CA 4G4ZA 1UKBA 3F49S 3RS0A 3GCDA 2H08A 1PDWA 3ITEA 4XKJA 1F38A 4RZ3A 5KJ6A 2IPMA 4B4UA 3KE1A 2H29A 4REMA 2M6RA 4B2PA 3LDUA 4ZT5A 2HCTA 2A14A 4FMPA 3ZGXA 4ZCSA 1QKJA 2WMYA 4ZOLB 2OGUA 4EGQA 2DYKA 1QLHA 4C7OB 2RHLA 4BQEA 5FPTA 1LK5A 2ZRFA 1ESEA 4I5IA 2QMQA 3I5XA 3PQ5A 1TCUA 2XBUA 3I92A 5IRCD 2WINI 2LW1A 5LQNA 5IAAA 5EP4A 5EPEA 1PJBA 2UU9O 1PUJA 1NKSA 3IAEA 4GWKA 3LYBA 3AR8A 1JG1A 4NYMR 4QUHA 5IZCC 4RTJA 2MU1A 3E86A 4F9EA 4HNRA 4GPEA 5I7WA 1YL7A 1N8TA 1L6IA 3JQ7B 3ABRB 1P1FA 1XHFA 1XF1A 1EVIA 3QPDA 3QPBA 1YQUA 5T41A 2ZQZA 4MLZA 4TXHA 1YVUA 1YI2F 1QTQA 3PKJA 5SYMA 1DRUA 3CVYA 3JATB 4WZBA 4K35A 4NG5A 5AM1A 1MSDA 1SBIA 2CKMA 3H13A 3MTEA 3TW4A 2I2BA 5CEJA 4JVSB 1FSFA 3DEFA 3MJ4A 2XMQA 1G8PA 3PHJA 2VA9A 1B14A 3C6MA 4JI3B 1GO2A 1AI6A 4EEQA 2AYZA 3UJDA 3RVZA 1YVWA 1FNSA 4QG7A 4WXRA 1S9HA 4AF6A 5IJZA 5ANRB 2QTVB 4PYIA 1HW7A 4HWTA 3CUKA 5DI9A 3GEEA 1KEEA 4XDHA 2Q7XA 3OMXA 5TF0A 4P54A 5TS3A 3WGGA 5I4CA 3UBMA 4NU5A 4Y2HA 1LPNA 4OLFA 3WGVA 3GJSA 4QYWA 4CM7A 2RBKA 3OESA 3PQ8A 5HWEA 4ZI7B 3FBGA 2IODA 4P8RA 4XSHA 3T1YO 1KVSA 5CX1B 3D8RA 3AXSA 4V39A 4LCJA 4EENA 3IUQA 4DT1B 1YRAA 2Q5QA 8LDHA 2OHWA 2H0QA 2C04A 1TZKA 2HLDA 1XMSA 3EIUA 4XIFA 1QRRA 5I9NA 2CGOA 3MCVA 3I8XA 2Q5LA 1S1CA 3LCUA 2ZT8A 4PAWA 1KQNA 3PU6A 1K8XB 4WXYB 3WHKA 4CI0B 4QKQA 1T0PA 2CEAA 4RJKA 2RD2A 1T5HX 4Q1AA 3OKCA 3ZCUA 1BT8A 1B76A 2CTQA 1IHDA 1DWQA 2X8LA 3H2SA 3TDMA 3DE1X 2Z30A 5HFMA 4MGIR 2HX1A 3Q5GA 2J32A 5IVIA 2YV4A 4AG5A 4QOHA 1MB2A 2JI8A 5TIIA 3ZX4A 4PO8A 3TKAA 4TTRA 3RW0A 1KY5A 5DTMA 2PGOA 3ZWNA 2YWCA 3DCNA 2Z8YA 3UW1A 3QWFA 5H0IA 3ZN1A 5DE3A 4FNGA 1FW6A 1D1QA 4V2UA 2ID9A 4MV3A 1NT2B 4PC7A 1X9GA 3RYHA 5I47A 3LHSA 2QIOA 2H59A 4QL3A 1E1RA 4R81A 1I6WA 5DLYA 5F12A 3UFXB 3ZY3A 3W34A 3WYBA 4JYAO 3U4CA 3C6YA 4K9DA 5I7UA 2ZSHA 5HTOA 3EWAA 1UMKA 4Z4IA 4YAKA 3QVLA 1ND6A 3TZCA 2AJCA 3KZIZ 5JAHA 3TJRA 1R4NA 2M1ZA 4PPGA 2XJ9A 1Z2AA 1U9ZA 4K3VA 2WAMA 3LX4A 3EA5A 3TINA 4US0R 1YQWA 4QU8A 1KA9H 1FE8A 3B3GA 3UT0A 4B6PA 1R0ZA 4AI6A 3BGWA 1NXPA 4I55A 2R1VA 3G6WA 4N8DA 5AIAA 4KTTE 2GSDA 4LF7B 1QPGA 3D6HA 3IILA 4QSHA 3COPA 1SXJC 3ZHBA 1XZAA 3LIPA 1KJWA 3IA2A 2QDXA 1O9GA 4DAEA 1E63A 3D4IA 4EMUA 2WSMA 1GPMA 2ZRCA 3UXYA 4UEQA 3NM4A 1MX1A 4N5MA 5T3YA 1WSBA 3ONEA 3ROQA 4JENA 1COMA 1DWPA 4RC9A 1H0HA 2ZE5A 4EG0A 4CG1A 3HYRA 3H97A 1YZVA 4QHYA 4FMDF 1M72A 2Y1FA 1FDOA 3CC4F 3TQHA 1MRZA 1VIYA 2QUKA 2YUTA 2W2XA 2J3QA 3HUEA 1BSVA 2DFVA 2NU8B 3FWPA 3C3EA 5BSHA 4JI1O 2Z0AA 1Q50A 4HQRA 3PRJA 1Y7PA 3A27A 4D6TH 2ZSEA 3K79A 2BAGA 3L6OO 3ZDEA 3ROKA 3SYTA 1OC4A 1IQUA 2CK3A 3WLTA 4M21A 1QP4A 3IOBA 3CRAA 2QTAA 3AEUA 3RFCA 1SQ0A 3GRCA 2HK8A 1RLJA 3CWZA 5F2NA 1BFDA 3E8BA 3I9JA 2RGCA 5M3BA 3VYWA 3RUIA 1M2EA 1ILWA 3TTUA 3KXDA 4ZTUB 2ODNA 4H4EA 4ZC8A 3R4VA 2VS0A 1VB5A 3SPCA 4D7AA 1YL5A 3GAZA 2PXAA 1I80A 3QV1A 1PL4A 2JJ8A 1IZZA 1I4DD 4J7AA 5FHQA 1E79D 1ID8A 1TI7A 1AXGA 1ZOPA 1H1LB 1ZK2A 2JGRA 2BJVA 3LZ6A 1DFGA 1CU1A 2GT1A 1P2SA 2BR5A 3D8NA 4F5ZA 3B78A 5DX0A 4DDVA 1QPZA 3HC7A 3D02A 2E74B 1E1QA 2BHLA 3IALA 4XWOA 2J30A 1WUTA 1CDEA 1DAHA 4UOEA 4I1RA 1BMQA 2G82A 3HHPA 1UZAA 3ZXSA 4YRCA 4R31A 1X59A 5FD8A 3BIFA 4WX2B 5CB6A 3UMGA 1Y9EA 3TLGA 4JFAA 2BMEA 2Y1CA 2JK1A 3EVTA 3ZS9A 3HA3A 2AUNA 1DKLA 1B8VA 5ALHA 3FF1A 2Z5VA 4WI1A 3SF8B 1MGPA 1K27A 1N5IA 2H31A 5TS2A 4ERNA 4L8WB 4XX0A 1T9AA 3UJ8A 3K0CA 4FYXA 3FCXA 2GBLC 2VNKA 4CCSA 1NF3A 4FOPA 3SZUA 4TT3A 1CZHA 1A04A 1JV2B 2YS6A 4R83A 2NV0A 4PX2A 5IZ4A 5A5VA 4BT2A 4YJGA 4D4GA 5AXBA 4PLHA 2F90A 1K5GA 4ZTZB 5B2ZA 3A1SA 3WKCA 2IOYA 2ZPUA 4MQFA 4K5QA 1GZVA 1UQRA 2IYNA 5HY1A 2B35A 5A04A 3FPAA 5JRDS 5EJ9A 1KP2A 4D8UA 1BJRE 3Q5DA 2B0CA 3AETA 3DOCA 4YHHO 1EG7A 3VQVA 3EPKA 4CMAA 4EHIA 2DHDA 4WINA 2OAP1 4ILKA 3QEKA 3LLVA 3KU4A 1LVHA 3JZAA 4PW0A 1F4NA 3J81A 1W1WA 4LOAA 4BMSA 3NBKA 2XCQA 3GL9A 3F47A 3EK2A 2PX2A 4GR9A 1IN4A 2X9QA 5HX7A 1X1CA 3ETGA 1NXSA 1GGHA 3UJ7A 1ENZA 3QY0A 3J7TA 4RTKA 1HMYA 1R9JA 2OV8A 4LH6A 2IH1C 2PLFA 4DSZA 1Y5IA 3FRJA 5A5GA 1CRLA 3RSHA 2O1WA 3LPMA 4ZEVA 3L0CA 3WQRA 4B8YA 3EVEA 1JT9A 5JRJA 3EXHC 4WOJA 1P18A 3U3MA 5J4LA 4GOMD 1NM5C 3IMKA 4XLTA 1ZD4A 3OBWA 4ZODA 3SS7X 2CV0A 3F7TA 1KNXA 5DLPA 1NDHA 5KYUB 1E69A 1EQAA 2ZIOA 4CQMB 1C4KA 1N1GA 2YY5A 1PTJC 1B16A 5TV2A 4BNLA 4YJ2B 3HCOA 5AJHA 3WL7A 3HDGA 3A6GA 3H3XA 4GVXA 3K1AB 5K0NA 1BE1A 3N07A 3M4ZA 1V8FA 2QBYA 4QNNA 4HDCA 3WWEA 2D2EA 2VA8A 2C4MA 4PNEA 5LUBA 3D8BA 1CUFA 5B64A 3QWAA 1OJHA 2ONCA 1X1TA 1QZ3A 1RS0A 1N2CA 3MAAC 5ADHA 2I7XA 4ZAFA 4Y6RA 5ICGA 1TZMA 1W55A 1C1XB 3AEXA 5C1IA 3RFFA 3WRXA 3I5YA 3QUWA 5AK0A 1E2PA 1IBMB 1T36A 1OGJA 2IBMA 3WBFA 2PRYA 3BQNB 2Q4PA 3PD7A 4XE5A 2RKOA 2D0IA 2H1IA 3KQKA 3ICWA 1UJ6A 1RP7A 3ILHA 2V54A 1W46A 3L4KA 4MVYA 5FPYA 4RA6A 3JD3A 2CTWA 2R47A 1PG0A 3G2LA 4C14A 1HT3A 5DW3A 4OG2A 1NJ2A 1KY4A 1IBLB 4FLZA 4YI5A 1L3CA 4MB2A 2KPOA 1OH8A 3IQDB 2C5LA 3IR6A 1Y74A 2ODAA 1PL7A 4RAIA 1ODLA 1C8BA 5LP6B 3V2HA 1I4EB 2GHTA 1MO4A 4DEYA 1U0HC 1KYXA 4Q9KA 1U6JA 5ES4B 4F06A 4P58A 3IDOA 2PGJA 3Q98A 4QGSA 3U7HB 4FOTA 1F48A 5DBIA 2IEYA 3BAZA 3ORFA 5BT8A 4Y67A 5TT1A 4HDSB 4IL6Z 4TN1A 1RAHA 1A88A 1XZFA 2HRBA 1U7DA 4RHYA 3L6UA 3L9DA 1HF3A 1W36D 1NJ5A 2R84A 3E22B 3SHFA 4OJTA 4ANFA 1DIBA 2VNAA 2ZSUA 4JT8A 4RL6A 4IDDA 5CHEA 4V1CI 2ZRKA 4P4UA 2X6BA 3M6LA 1Y6JA 5GJWC 3H3JA 5JNWA 2GBOA 3A6LA 4CKCA 1T8RA 4JEHA 2F43B 2CHFA 2XA9A 4DXDA 2PYDA 1KD1H 4BNHA 2F1RA 4G4GA 2KJQA 4NBLA 2ZYAA 2GUZA 4ISCA 5LYJA 1BGVA 1DG1G 3TD2A 3RTAA 2B8TA 4B44A 1F7UA 1K0UA 4O4IF 1MJGM 2B33A 2Y1DA 5IFLA 3R3JA 3GFGA 5BQ3A 3OOYA 2YXBA 2Q4BA 1EWYA 2ZRLA 4F86A 1CP3A 4JR1A 2HK7A 1VQVA 3IE1A 1ZUQA 4BE7B 2I6QA 4JGBA 1Z83A 1C7IA 1E6WA 2Q62A 3H87A 5JRZA 2WTAA 1SD2A 1QFZA 2JH9A 2WLIA 4PLCA 2P1RA 4FYKA 1TZBA 4D8XA 1JKIA 4I3HA 5CVTA 3RJ5A 1U0JA 1K8RA 3D6TB 4CT5A 2VTDA 4YPOA 2Y3IA 3OUTA 2I3GA 1Q84A 3JWEA 4AUKA 1PV4A 3F96A 4MUHA 1A4IA 2PF4E 3TAXA 4Z9FA 1JQJC 4AUNA 2OHXA 2QTBA 3E15A 3O1HB 1XCLA 3E5NA 4M36A 4C4SA 1MAHA 1XPOA 4IH9A 3LSSA 2AS0A 3DKKA 1HUQA 2E85A 3DFZA 1BX1A 2PCLA 3FDZA 1TF2A 3EX7C 4FE7A 3KQMA 4FCTA 2IYOA 4POAA 2REXB 1T5LA 4F6LA 3C3CA 3EFBA 3N4YA 3RS5A 3I3OA 1FYJA 1K8QA 2GN2A 5E1MA 1M0TA 1RYEA 3GO4A 2RHJA 1JP7A 4J10A 2UYNB 1FOEB 1SVLA 5AJVB 1RRPA 2FP4B 4F38A 1SESA 5AK3A 2ET6A 4FFKA 3P0IA 1E7MA 3IQIX 2NV2B 3F5SA 4Z7OB 4CF3A 1XAGA 1RI2A 2FSUA 4GMKA 2Y0DA 3UY4A 5F23A 2RB9A 2NVWA 5C5DA 3IC9A 4UCOA 5ULLA 2C31A 4CKBA 3KVOA 2XZLA 4EHDA 4HYYA 1XGKA 2FDRA 4JASB 5KJ1A 4FILA 2HGZA 5EL0A 2HFJA 4HPXB 4KG7A 1QYCA 1DARA 4F2HA 1H1DA 2QQ5A 5AW4A 2VQ3A 2DTXA 5HDQA 2EARA 5ITVA 1KAOA 1H8EA 3QF4B 2IGTA 4K0KB 2YWHA 3K31A 4XM1A 1UFYA 4PTLA 2HHAA 1AS0A 2GO7A 4ZJYA 2XY4A 4A0FA 5IUJC 4ACAA 1THZA 3EG5A 5DCUA 1L5NA 2Z09A 4LI0A 1GTRA 1O3YA 1VCHA 4TTJA 3W7WA 4WASA 4EHJA 3GD5A 3PGXA 1DAKA 1DO0A 5CTAA 4BMZA 2V03A 1N3IA 4OQXA 1T2DA 4DXWA 2ORIA 2WSSA 4XZ3A 1GKFA 4WFHA 4KVZA 2CGNA 2BFFA 3UMBA 3VC3A 4JT2A 3ZTWA 5DZSA 5SZKB 3SKVA 3D6UA 2ZGVA 1WV0A 3S2YA 4ZO8A 1H5UA 4E4EA 4BNVA 3T3HA 5C7LO 1M5RA 2J46A 2V1XA 3B1FA 1VZ3A 4RVCA 4NVPA 1Y4MA 2ODWA 4M8NE 2HNAA 1YH3A 5E6UA 2NNWB 3ZRXA 3FOCA 3MD9A 3JYOA 1GZHB 3ZMSA 4WNCA 3BCSA 3N2EA 1BMFA 4KL8S 3P9QA 3VDMA 1ADCA 4D9MA 4FJCC 1ZL0A 4YPVA 4O8ZA 2O2IA 5MFPA 3VHXA 2D3TA 4QEKA 4QBFA 3JQFA 5JAMA 4AN0A 4PZEA 3DMNA 2H3OA 4UJ3A 4FYHA 4B6QA 3B40A 1YFLA 4GECA 5ALVA 3FYUA 3BMNA 4Q66C 4WBNA 3SHQA 4YT5A 4D80A 2NQ2C 2Q6IA 4Y1RA 3DMHA 5KMGB 1QO0D 5KJFA 2X0RA 5KSWB 1PR5A 1I0IA 4DV4B 1NP6A 3LCJA 1Z17A 5IM4F 2IIVA 2QN7A 2C57A 2ZYHA 5ICEA 1NHGA 4DBVO 1EFDN 4O1IA 3VOBA 3THYA 4HDOB 4BXOB 1JHAA 1TKCA 2AZDA 1HXHA 1Y3IA 1AC5A 3RSLA 2QNRA 3COVA 3WE7A 1SULA 5HXUA 3ZE8A 4DJAA 5LZ9A 4XDLA 4I6EA 5A6SA 4E5SA 1ZIDA 5KOHA 5DHQA 4JK3A 4YR9A 2XTAA 3RE3A 3CF4G 1NI8A 3ZXIA 1SOMA 4FT2A 1W57A 1G8YA 3I9FA 2B9VA 2H8PC 5D3QA 2C61A 3P9PA 4Q7MB 3QBEA 1RPZA 4CMBA 4BJHB 3TRJA 3URMA 3W5DA 1YTLA 1IZ8A 3OMIB 4LDPA 4IO0A 1KOLA 4BQRA 5JV5A 1YJ9V 2LCIA 2W90A 2SHKA 4QU9A 1VPDA 5B5SA 4P3PA 1GPWB 1C3EA 2H2AA 2ZE8A 1QZUA 4OMFG 2LXNA 5JCXA 3QBTA 4JLPA 1JXQA 5I45A 1P6QA 4XVRA 5EIBC 1QCYA 3KLOA 1UIMA 3K4PA 3S27A 3IMCA 4R84A 3SLKA 2CVLA 1E1LA 1JSRA 4KAJA 4YMTA 3I76A 5E9JA 3WG9A 4PGFA 3B5JA 1I7SB 1L9KA 2V4ZA 3G13A 2G5GX 2GZ2A 1HP8A 5GIPC 5IJ9A 3AI2A 4LQCA 3A9TA 2PSSA 2UXBB 2TRSB 2X5OA 5C8YA 1JVSA 1WP4A 1GTMA 5BUZA 2QXUA 4D4JA 3UZUA 3I2JA 5LWQA 3HO8A 3NUGA 2VDMB 1VJ5A 4TS4A 4CWAA 2DFLA 3H5VA 3IE0A 2H63A 4H0NA 4JELA 1N5JA 3LNTA 4TRJA 1CKEA 1UI9A 1HG1A 3FIJA 4WGFA 3UAGA 3TW6A 1JQKA 4HTFB 2CNBA 3PC3A 3E9DA 4MRAA 1XRPA 3ZG6A 4R2IA 4TX1A 4WLOA 5FV7A 4Q21A 3AEKA 4UUOA 2WIFA 3VI6A 4IUBS 2PCJA 2DYSB 4BNDA 4DNPA 1MZPA 1OFUX 4L9AA 2IPOA 1UM8A 5HBRA 4LAFA 4BNWA 4YY3O 4R68A 4OPAA 3QEBZ 3F9RA 2HYIC 1KAHA 2FMTA 2GHIA 3IKEA 5B58T 3ZYCA 1F3OA 4V0MA 1VQLV 1O4VA 3F8SA 3RIHA 1X6VA 3ZDDA 4WLEA 3C16C 3IOMA 4ZHWA 4DOMA 3PHHA 3HVJA 4BX3A 2O8VA 4IIJF 3PTLA 1GRVA 4I14A 1MW9X 4DYLA 2CZQA 2X6CA 2HSDA 2EIKC 3TCXB 1WQ3A 4DY6A 4F45A 5CH3A 2I87A 1QTNA 3SXPA 4H33A 1VHLA 4FOLA 2BSQA 3AVOA 5JSYA 5JLAA 3WISA 3RKSA 2I7VA 4ESOA 3L1VA 3D64A 1RWBA 3EA4A 2V7XA 3DC2A 3H2IA 1MFZA 3MCAB 4EZIA 4R3UC 4WNAB 1YHZA 5AVOA 1W3EX 2J0VA 3KKYA 1O8CA 1RLMA 3QENA 3QPVA 3I04A 3LOPA 4QBKA 4KQMA 1Y48E 1HX7A 4KQ2A 4B85A 4EKYA 1AB3A 4B71A 2BFPA 2W6OA 5EWMA 1WX1A 1R5BA 3ET4A 1K2WA 4TYYA 3VDNB 2WHXA 2I4IA 1SQFA 1KK1A 3BICA 1I01A 2HVYD 1ZIXA 4EI8A 5KAPA 2P6RA 4W9RA 1ID1A 2W71A 5CEFA 5GV7A 1GGVA 5BSVA 2OR3A 4E2LA 2F1IA 4RKFA 5T5QA 4FIPC 5L3SB 4GBGA 2L26A 3K9WA 4ETMA 1ABEA 1JU3A 4JLJA 4GQBA 4AMVA 5BW5A 2BFOA 4MIYA 1VSTA 1WU8A 4GL4A 4HTAA 2PWAA 3IPLA 2OHIA 4B3RO 1NI4B 3R09A 4LY6A 4UUAA 3EW9A 1Z5UA 1LPMA 3T7EA 3LHKA 2FMKA 4HOYA 3N0VA 5LQMA 2YWRA 3NHFA 1SCIA 1D0VA 4DLNA 3WB2A 3I42A 2JVKA 3IDAA 2XYQA 5EY5B 3U10A 3OMWA 3R3YA 3REQA 2XZTA 4DYHA 1OV6A 4FSHA 1M93A 4RF2A 4M0LA 4DDHA 3Q10A 1PLLA 2PX4A 1YHYA 3QHDA 1P2BA 4LKRA 4R8CA 5HJ7A 2NSYA 3ET5A 3CLVA 2GM9A 2Z83A 3ICCA 4B82A 1ZK4A 5KNDD 5K0EA 4ETWA 3M6MD 4RYLA 2ESRA 1W85B 1GZ7A 2ECQA 1MV8A 5EB1B 2OZKA 1P6XA 2HSGA 4IYJA 1XROA 4PGAA 3WRWA 4KV9A 2WUDA 1VQLF 3GPBA 4G2NA 1EFTA 5BQXA 3KQNA 2WG0A 3QO7A 1QONA 2YZKA 2WF5A 3GZTB 2HMAA 2FQYA 3H65A 4UBMA 3LRXA 3BTUA 3IKJA 1L4EA 2HWKA 1DLBA 5HXZA 3UMFA 3GMTA 3FVQA 2GPBA 1KPGA 3Q12A 1SZPA 3MUOA 1A3CA 4B3HA 4J1TA 3AM3A 2N3ZA 1XZNA 4U2BA 2JCSA 5FORA 3VVMA 1DT9A 4JBLA 2C1EA 2XUJA 5FWYA 1XNJA 4Q6GA 3PQDA 1HEIA 4OU4A 4HB0A 3N05A 1D09A 1T3TA 1JXAA 1E6KA 4BNJA 5IYDO 2PU7A 5IXYA 1RP1A 5F9HA 4PBSA 1CP9A 1UK6A 2CXPA 2FW0A 2ZB7A 2XUQA 1QOQB 1YO6A 3LCCA 2XAGA 5TPWA 1C41A 1I1QB 1DX4A 4R0NA 1WF6A 4NULA 4BY9E 1P17A 3PNPA 5GTDA 1EB9A 3I6IA 1PYOA 1GAEO 5EN4A 1M67A 2ZIXB 1WCYA 2GBPA 2QM0A 1HNZO 4NICA 3QUCA 1BN6A 1WDLA 2ZUSA 3JQ8B 4PR0A 2EFYA 5I7FA 3DE6X 4UV8A 5EE9A 3S2GA 3SZOA 2C4WA 1L1FA 3KFVA 3I5DA 3ZQUA 5LZ8A 2R86A 1TX4B 1Q8IA 3WZLA 3QU2A 5CA1F 2DQ0A 1IMJA 3TN7A 3QA3E 2M9MA 1G21A 5IBPA 1GDHA 2BMWA 4FQ8A 4AJPA 1Y6RA 2HMVA 4AQYB 4NMLA 4P7JA 5JS8A 5LQJA 2KB1A 5JSZB 3OZVA 3GJ5A 4MW9A 3KHNA 1NR1A 5D8DA 4LWSB 3FGNA 1YJWV 4B2IA 4X45A 2X1HA 1TT7A 3DT9A 4LHSA 2R7MA 3U4AA 1BEZA 1EA7A 1NS1A 2AFRA 3BXEA 4NXMB 2H2HA 3ASUA 1BDBA 3LGSA 3TXAA 1VE3A 1XZQA 5FUXA 3KYIB 3TRKA 2IFTA 2ATIA 3W9UA 3CCJF 3DF9A 3JPWA 2MJLA 3SIWA 3CYFA 3PHIA 1YFKA 5JBQA 2W0SA 5DF1A 5LFAA 3IAS6 2Z5UA 1WNSA 4OGGA 3VYSC 3GLKA 5B1SA 5AVUA 2DWUA 4KV7A 5DCVA 5H9CA 3H5OA 2DQ4A 4DR7B 3EXEB 4W5JA 2GGSA 2WJHA 4FW9A 4K8RB 1KSJA 1BXZA 4EW3A 4K2HA 4U2EA 4HZUA 2GO1A 1P49A 3OTIA 3JSXA 4RH1A 2YDEA 3HPRA 3GEMA 2B37A 1OFGA 3HCPA 3RSQA 4XPIB 3LMEA 3WLFA 1V26A 1XHLA 2V7WA 1Z6GA 2YMLA 5FL7D 4CMGA 5IJXA 5JZSA 3E82A 5JCOC 2G40A 3AHGA 3HUTA 1JZQA 3SF0A 1NTZH 3MRSA 1Q43A 1MSWD 1BMTA 4E12A 1FYVA 1Z0UA 2CDRA 1YVPA 1OH7A 4OAOA 1R2QA 3IPRA 2PGLA 4U0JA 2VUTA 5DGIA 3SQOA 1YRQA 2W6ID 1X86B 4YQFA 4RZXA 2H4ZA 2QM7A 1T2UA 2M7WA 3FSGA 1T5BA 1EG2A 3FPJA 3QITA 3LY7A 4LSZA 4X20A 2GILA 3KTAB 5CVJA 1KBHA 2ROQA 5K8CA 3VUEA 5LCXA 2IV7A 1MU0A 4Z7JA 5FBZA 4JBIA 3ONWA 1XUOA 4FDUA 2IHUA 4H6XA 3BMCB 4N03A 1J5PA 4WK0B 2NZYA 4UU1A 3D6AA 3AUXA 1NUAA 3K0DA 1QUEA 1TZJA 3IIKA 3W6ZA 2YVLA 4IGAA 2XXBA 2RN9A 2G1JA 1Q5OA 1NP7A 3CJHB 2VG8A 3IEPA 2GPNA 2R5FA 4CUKA 4U7GA 1RSOA 3UOAB 5EXPA 1E7WA 2ALJA 2CFIA 3RHFA 2HY7A 4DGQA 5IYZA 4D9KA 3OOWA 5GJCA 1NPYA 1O9BA 1VGVA 4LC1A 5ICMA 3G0GA 1NNSA 3SDSA 3OM3B 2WG1A 3L04A 3NWOA 3JPYA 3CMAV 1IXZA 5HCUA 3IJEB 1YJWF 4QRIA 1NURA 2FPPB 2LW7A 3BG5A 5E6RA 1XUQA 3CXCF 5EKDA 3GFSA 2WLSA 3T9DA 3FNEA 4O8CA 2Z8XA 3OLXA 4D74A 1OQAA 1BH6A 4WH0A 1H4SA 1Z82A 1BJKA 1TD1A 2H1RA 1BVYF 2PTHA 3FW1A 3G5TA 1WW8A 1U0BB 2CVHA 4J0FA 3M81A 1CNFA 3N7TA 5JS1A 2WUVA 5ENZA 3TG2A 4Q3BA 4Y2GA 1MJFA 2CLOB 3OLCX 5L4NA 1CJCA 1ZS9A 2TYSB 1C3OB 3AGPA 2EP7A 2CCKA 2AC4A 3FCSB 5AOAA 5FOSA 4HLNA 5GJVC 2NLOA 4E4RA 2AOUB 4D99A 5D3KA 3A37A 1LFAA 3RS8A 1R27A 3SDBA 2R8RA 3WK5A 3LLSA 1NE2A 5KLVH 1B04A 1HRKA 4YMLA 1XHXA 3DKRA 3Q9NA 1HE3A 4O63O 5HF5A 3MK31 5FPOA 1QBZA 4CQNA 1PNMA 4MULA 5DBFA 4GL2A 3H18A 1RHMA 3WO1A 5AM3A 4KDRA 3DAFA 1US8B 3E2IA 3FSRA 1C7FA 1KIMA 4ENUA 3UG6A 3JAKB 1P61B 5CBGA 1RLUA 5EP2A 4R2KA 4QPJC 3DYBA 1UZLA 3I55F 4S2EA 1PFKA 4IAOA 1XPJA 1FNKA 3PD0A 3DEZA 5B53A 3VZDA 4BTEA 5KAMA 4R2HA 3BD8A 4RY0A 4PXYA 3AG2B 2O2EA 5AK4A 5EMHA 1X2BA 2A57A 1QGZA 3QIAA 4ZDWA 2JGLA 5CYPA 3HI6A 2XUAA 2W0FC 1DIAA 1TKRA 3B1XA 1P7ZA 4IXDA 1T5IA 4B6GA 2A67A 1M9NA 1PLJA 3CCSV 1K7SN 2Q3DA 3D2AA 1DEHA 1PW7A 4CKEA 2ZAUA 4MTLA 3KJNA 1KSHA 3ER8A 4DCCA 3UMMA 1V5EA 2REBA 2C20A 2IKSA 4BVHA 3L73H 4G85A 2A0KA 2PMWB 3EEOA 1AT1A 2WTNA 4D3YA 3OJOA 2I3BA 3CF6R 4P3XA 2FQXA 4PGMA 4LFAB 3N0XA 1R10A 2FN8A 4G0YA 4D25A 2Z1TA 1TO6A 3CMAF 1II0A 1U28A 1J1UA 1D07A 3A26A 3EPRA 5JLJA 3MTAA 1JYSA 5E2BA 4ZCMA 3ZDAA 1Z0SA 1JLMA 3NIGB 1YVEI 4HNAA 4Z54A 1FUYB 1T8WA 2CMHA 1Z12A 4G89A 2J6IA 2VWGA 3HJBA 3ZZUA 2Q2QA 3ZP7A 2MSDB 1GZ3A 2VDJA 1LNQA 2YINC 4W6QA 1W59A 4TLAA 5U4XA 3NHAA 3OR6C 1ENOA 4WA8A 4I1IA 4RKYA 1G9TA 3A31A 1UKVY 4DA4A 1AKEA 3M8KA 2RH5A 2WSLA 4NEGA 5GIPE 2XRFA 2R6ZA 3I2GA 4K6OA 1M2FA 4DLSA 2IYFA 4J3JA 1PJ3A 4C82A 2YRFA 1PIWA 3RU9A 4EUKA 4XW2A 1O5IA 5EBMC 1NTRA 2NYVA 2OZBA 3ZTYA 2XAJA 3SYOA 3F7NA 3T9CA 1OI2A 2AN3A 4C7XA 1HFJA 3UJHA 2YYAA 2EWVA 4EHFA 3L0OA 4GPTA 3C74A 4TTPA 3K5NA 4UPDA 4CQMD 2COKA 3HRKA 3B3AA 1XCOA 1FXVA 3FE2A 4NOMA 1JKFA 1E3QA 1IPFA 3JR3A 2WZCA 1W52X 3SE7A 4QELA 2RSLA 3G68A 3K9HA 1LCIA 5LDHA 3ZU4A 1X7DA 3BJMA 2OCAA 2ISSD 5E2AA 4B3GA 1IM5A 3FMPB 2E4ZA 4BNZA 1MOSA 4IKOA 1Q7YH 2EJVA 4Z8XA 5CFRA 3VR5D 1NNEA 2RDCA 2K7ZA 4B3DA 1T5DX 4FM1A 4BGUA 2D00A 2NU7B 2G7ZA 5EXXA 1CZUA 4LJ9A 3MWDB 3RF6A 2ZANA 4G37A 1C29B 5ENVA 2G9NA 3K53A 1HQCA 3JALA 1D2CA 2QTPA 3EXIB 5IG2A 4IZIA 2I03A 2Q8VA 1DKQA 4I6JA 1ZTEA 2X8JA 2YC0A 1NSYA 3OPYI 5FAXA 2QZ4A 1PBTA 2WJIA 3T5TA 1PNTA 4K2AA 2YOGA 3DEYX 3K09A 4ZDIA 1Z2NX 3R4CA 3BVPA 3QVNA 4ZVNA 1QLEB 4MTFA 4Q1EA 4QTYA 4ND4A 2Z43A 1JN0A 1MOQA 1XV5A 5FYQA 4O6VA 1YAHA 4HDRB 4I9NA 4LF9B 3IYLW 3NIBA 3I56V 5JS7A 3VPHA 3WQSB 4JL5A 1U5BB 3ENQA 5ALYA 4W8OA 3W2GA 2BD0A 1K97A 3I7TA 4G0XA 2AIZP 1PRYA 1GAQA 3SYCA 3Q4GA 1FYFA 3DAGA 5B6JA 4C2AA 4CF4A 1V1RB 1BKDR 3GJTA 3X43A 3ESJA 5DEOA 3MW8A 4GSLA 2YIMA 3ZVMA 3S81A 1W34A 1YQ9A 2C7QA 3N75A 1HYEA 2N1MA 5L8VA 1TEXA 3IMFA 4FIDA 1E1KA 2N42A 1ZUNA 3MMSA 3OQIA 3WGJA 2F1OA 3PICA 3VTFA 2ZCJA 1QZTA 4X1IB 2XAUA 2FEOA 1GR1A 2ZR3A 4R8RA 2AOVA 3SKXA 3B9BA 4BEWA 3DNMA 3A25A 3JYPA 3R5TA 1H2LA 4M7WA 4CHTA 2HV9A 1UBMS 2OD9A 3E48A 4BP3A 3LA8A 4V02A 1FEZA 2HLPA 1D1PA 4X41A 1JEJA 1AGYA 3PF9A 1RJWA 4BLRA 4CETA 4CM4A 3RVRA 2EKPA 3MFQA 1DEOA 3LQQA 3CEAA 5IHXA 2VNJA 4NY1A 3PBKA 1GZ0A 5BPFA 3ZK8A 1BYUA 2Z2KA 4QE9A 1G20B 1YJCA 1YKFA 2QQFA 4RPLA 2FWPA 2H8KA 4B3TO 2H5EA 2NTEA 3GA0A 1JBKA 2P90A 1NL3A 4FCWA 3CE2A 4R2XA 3ILSA 5HKKD 1JTVA 2ZCEA 2OP1A 2I2DA 3NGMA 2IE0A 3D7SA 4O29A 1N8KA 4E21A 4AMUA 3AY7A 1H6BA 2RGYA 3TRHA 1MV5A 2ZUDA 3JRXA 3FPCA 4XASA 3HKBA 5E9AA 3JARA 2B6NA 4C5BA 1SKYE 4HGPA 1MC5A 4P0QB 3NBQA 4WN9B 3UQZA 3RVNA 5HQTA 4AYXA 1KRXA 3A1CA 1KAGA 1W19A 3F78A 5DDIP 3PITA 3LNMB 1MRSA 4U2FA 1QGOA 1TLTA 3LXUX 4DZRA 2ZNJA 1IPEA 3EH1A 3WJPA 2Q6VA 1YACA 3Q88A 4TOIA 4D97A 2HA4A 1SVNA 3OY7A 3PVCA 5BWLA 2HWYA 2DPHA 2GCOA 1RWWA 2H4YA 4NTZA 3HU1A 3OUUA 4V3BA 4E3WA 4KWIA 1O7JA 1FSZA 4CIBA 2UYHA 3CNLA 3UIEA 4EHHA 2VJMB 4FK8A 4RKRA 2FRDA 1Q92A 2REOA 1GSIA 1DRVA 3T4XA 2H17A 2BP7B 4NU6A 1T25A 3PCRB 1JDNA 4WHMA 1VSUA 2A35A 1ZH2A 3LF1A 1YXBA 3GQBB 4A91A 5B3SC 1WMEA 3OJWA 3HU3A 4Q7JB 1XJCA 5EO3A 2DXIA 4WZAE 3GBSA 4IVRA 5T4HA 3GUVA 1YFZA 4PQGA 4FEEA 1RI3A 3VO1A 2XTMA 3HKDA 3NAGA 3U19A 4QVKA 3N74A 3JV7A 2SCUA 5IW8A 1XD2B 4BGIA 2IXGA 2RH9B 4MOWA 4F8YA 3BZWA 3N8KA 5DHUA 2L18A 4GAEA 1YJAA 2CBGA 1TMGE 1W4BA 4F1JA 1V16B 6REQA 4DPMA 4YLYA 2IZ7A 2AQIA 1C0LA 2XBLA 1VKRA 2H2DA 1Z0JA 2AVDA 4KO3S 1FPMA 5EYPB 1XKTA 2JBHA 2G0NA 5H7XA 1VEWA 3EVBA 1PX0A 1RBMA 1U02A 4L5AA 2GN4A 4MVMA 4W5OA 4N7BA 3VQYA 3A14A 3C8ZA 2PVSA 2HQSC 1X80B 1N6PA 2CJYA 8ATCA 4X6LA 4TV9F 4E5NA 1UKEA 4JUBA 2G9RA 1F23A 2G1KA 4Y2SA 1EBUA 3ILVA 3VU8A 1Q91A 2I6XA 3VSCA 4RF3A 4CJXA 4RF5A 5AW9A 4FDLA 3VVBA 1KY3A 3V97A 1E79A 4CF6A 2JLUA 1G2QA 2OCGA 1O6GA 1JHUA 1NQAO 1UPBA 4EBFA 2ZZKA 3TRFA 4YRKA 2FJUA 1VLMA 3RFUA 2FZ4A 2FWBA 3TLKA 2A9HA 1ZP6A 4L08A 1HE1C 3KTFA 2PA3A 3DD1A 3WA7A 3WO0A 3UENA 3BERA 1QRSA 1NH2B 6AT1A 3OLYA 3PQEA 5EKTA 3O2SB 3K8YA 4G1CA 4AY5A 2W37A 2VZ8A 1BS1A 1NJ1A 1OLXB 3UKDA 1JYEA 3M5DA 5GZ3A 3QPCA 1ZIPA 3EG9B 4UXHA 5LLSA 4N0QA 1EK6A 3ZMZA 3WBJA 3IVXA 1PT9A 2C7PA 3EOZA 4Q19A 1UCFA 3SICE 1KHTA 1Y1QA 3U3RA 4RZSA 5T8KA 4M1QA 2Q2NA 2X58A 2XNJA 2R7AA 1ZJ6A 5A4DA 3A1VA 1TA9A 2EIMB 1XEXB 5M2QA 3NASA 4AY4A 1FSSA 3P3NA 1IK6A 3EULA 4DR6B 5MHTA 4PVCA 4OY3A 2OLKA 1ZN8A 3AF6A 1XZKA 2B98A 2ZIEA 4RXTA 4MROA 3BWXA 3IQFA 4EVIA 1XRGA 1AB6A 2MSNA 2HR3A 2QLTA 2J4CA 2QWNB 5LA6F 2ZJBA 5ALXA 3IO5A 3OIUA 4NPCA 3SNHA 2CBXA 4RLFA 3NH6A 1OF1A 2GXQA 4GZMA 3P5BA 2UYPA 2HCRA 3N27A 1OAPA 3M6WA 2EKLA 2EF0A 4KQEA 3CVUA 3SAJA 4FM2A 3MHSC 4IFEA 1Z47A 1SIUA 4NCHA 3RN4A 2WIJA 1AKTA 2PWZA 1KI2A 4FVTA 4G4JA 1XEQA 2GSMB 4RUEA 3GH1A 5FNVF 4G5OA 1HPLA 5DJ5A 1T26A 4TKLA 1AGPA 1T9GR 1ZG3A 3R3HA 3D43A 4BHTA 1NVXQ 2WYIA 1JR4A 3PQ7A 5HJEA 4N12A 2BTEA 1A2QA 5ALPA 3NDRA 4HKTA 3IXLA 1EJ0A 2HLHA 1IHOA 1T8UA 5CITA 1FDSA 4BT4A 3TXSA 1STOA 1NVUQ 3TGPA 1KEPA 2X8WA 1KMHB 3WXMA 3TGLA 5LQRA 3GLFA 4AJ4A 2ACVA 4E6PA 3LQ4A 3CLUD 1DRWA 2J0EA 1MA0A 5C4GB 1SQ5A 3CZCA 3L07A 1ZVMA 3JWPA 3SSNA 1N33O 2IOHA 2IV2X 2PUEA 5KHKA 2PJRA 1RHJA 4G0NA 1XREA 1S3JA 4EL5A 1TTTA 1K7XB 3S6JA 2AGAA 4FZ0A 3VM6A 521PA 4D9HA 4IXTA 1NF8A 4JHXA 4LXGA 4ZC1A 1B7GO 5EOVA 3F4KA 3WLLA 3ZDCA 3W04A 3LH5A 2HRQA 2OZLA 2RHTA 2UUBO 1HKUA 2QXYA 4OBEA 3RYIB 4XGQA 3ASOB 1W2BU 1D2HA 4UASA 4RVDA 2P2DA 2CLHB 1M1YB 1YIOA 2PS0A 1S2DA 2IK8A 3T5AA 4B83A 5EG5A 4AP5A 1W4ZA 4P92A 2F2TA 3TE6A 2VDNB 3GEBA 1ZH4A 1IN6A 3VKHA 4RJJA 4R7GA 4OLHA 2RB5A 2AEMA 5JALA 4J9UE 3TM4A 4FFVA 3ESQA 3IBCA 4ZVSA 1RWVA 2B9ZA 2QLBA 2XQKA 5FUYA 4MNTA 3JZDA 3HKEA 4EECA 4EO9A 4A8HA 1UAGA 3ZR4B 3IIEA 2P2LA 3F5TA 2J3HA 3BQMB 3KLMX 4RIFA 2EZTA 4Z4QA 2YN0A 3U7FB 3TW0A 5BXZA 4NIMA 3C90A 4LW8A 3MF4A 3U1BA 3TR5A 5HFAA 4QNMA 3WHPA 5K1PA 4FK5C 4XYMA 3OW2U 1QU3A 4K9PA 2XIQA 2DVMA 5E7MA 1FNJA 2HREA 1NAIA 2BRUC 2VP3A 3C3BA 1LDBA 4JLOA 1LGYA 1MT0A 2BZ1A 2PJDA 5JSFA 2P5YA 3RRZA 2IEZA 4OHMA 4YN3A 3F8WA 2ZT7A 1LUVA 2K5UA 1BWRA 5BN3B 5K45A 5AKHA 3WX0A 1F8XA 2I2FA 1KZGB 2BFAA 4EVSA 1Z35A 3GZ4A 1EN6A 2PL9A 1MTOA 5IT9M 3V33A 2HT1A 5F1OA 5LZ2A 1HYGA 1JQEA 4OGLA 1EN5A 5DN9A 3GLTA 4GC9A 4JI7O 1Y80A 4G6ZA 1O9HA 4YJKA 3IO3A 4TWKA 3TK1A 3VKWA 3ABMB 2P5UA 1RC1A 3EMDA 2RGNA 2DKOA 1G66A 4JZGA 3ZHYA 2Z1EA 4HG2A 3CXUA 3FAZA 2VEDA 4FJ1A 1GFIA 3TFOA 1UQTA 4WKOA 1P91A 3FY4A 2P6UA 4U5QA 1Z88A 5GGYA 4FZRA 5T67A 1OYWA 4B0PA 1XR3A 3OGCC 2OTLV 3EVNA 1OT5A 3I8OA 3S0WA 2RC6A 1NMSA 2DZDA 2O48X 2OCIA 2Q8NA 2AJTA 3DWFA 4HQKA 1K3EA 2DKFA 4NV3A 5BN4B 4D9BA 4I9QA 1NVPB 2AZ2A 2H92A 4GSYA 3U0BA 4LRQA 1CJMA 2ATEA 4KQKA 4DHWA 5CCEA 3DM9B 4BCDA 3O6VA 2V0GA 5KOJA 3PF8A 1G55A 2GK7A 4X5OA 2FGKA 3OE7D 4V0LA 4RFSA 1NV8A 4TTVA 1KD1W 4EH1A 4BDSA 4NQRA 2H11A 5CLFA 4WCFA 1JR2A 2WM2A 3ZTTA 2AN9A 4W7IA 4HQ6A 5ALRA 3FCYA 4OCZA 4EM6A 2B8NA 2RG1A 4J3FA 1JJAA 1IBCA 4DC1A 4WBXC 1A1VA 3STHA 1KEWA 4K26A 3G9XA 4GYKA 3RGGA 3WY9A 1JHMA 5KYXA 1PT7A 4HWSA 4TTAA 3OU7A 3EZ6A 4N5NA 3AKCA 1KYWA 3A1NA 1V3TA 3EQ2A 2JZOA 4WOCA 3T7JA 4C0BA 1NBEA 2JJ2D 1E7KA 3PJEA 3IAAA 2BEKA 3M0EA 4GP6A 3B85A 4BE9A 2AG6A 1P1KA 4LKOA 4OGFA 1ZCBA 4I36A 2R62A 2QM8A 1K9MH 5DTEA 3WP1B 2FOXA 3NHWA 4YRTA 4NR0A 1P0MA 2IYLD 4CLDA 3C9RA 2CHVA 2F4VO 1AHNA 3G1WA 1G5HA 4U39A 5BR1A 2QR5A 1WA8B 4N41A 2QLMA 3VCZA 3KD2A 1AKYA 2HX0A 4BKMA 4P36A 3OQVA 1CW2B 1P1CA 3IR9A 1EWKA 2X15A 2ZWPA 421PA 3GLHE 3NGXA 2WZBA 2AMLA 2V6IA 1QCZA 3DV0A 1SKMA 4CTMA 5KOYA 4O2AA 5JNRA 2HP0A 4XDYA 5A3QA 3WGYA 2LBTA 1GKYA 6LDHA 2H9AA 2IU0A 2IITA 2JLVA 1KP9A 2J08A 1F1BA 4Q1CA 4XTCS 4BPBA 2BEWA 2JKYA 3S06A 4O4JB 5IARA 1CJKC 4F6EA 5FOXA 1XKLA 1Y0BA 1YTUA 1M54A 3EGXB 4CS4A 2O3QA 3R7SA 1QZXA 1TQHA 5AKKA 2PZ8A 4CRWB 5A2QN 3SYRA 4ESHA 2Q0OC 3C6BA 4QUDA 2I5PO 4C4PA 1HDJA 5DN6G 4P4TA 3AX6A 1JFSA 4TV8F 3H1TA 1Z3CA 2PMPA 2QR2A 3HSSA 4DIMA 2PE5A 3S44A 2ORYA 4FKMA 3G0BA 5EQTA 4DR2O 4C89A 4UMEA 3U09A 3C6KA 4Q24A 4CEHA 1VYHA 3FHOA 4K9MA 4BT5A 4CTNA 3MAJA 4KTVE 1Z15A 1VC2A 5KAFZ 3B70A 3LX6A 5PGMA 2JA1A 1QO0A 1JR3D 5EJ7A 1HV8A 1SZQA 4BVJA 4NV1A 1EUZA 3HYLA 4LCUC 5BSTA 4HN2A 4ARZB 2V3CC 1AZSC 2YIDA 2A86A 4D3ZA 3C3DA 4BVTA 1SUBA 5BN5A 2BEUA 1WPXA 4YJHA 3N5CA 3I52A 3LAWA 2WAXA 2WD9A 2PBZA 5JCZA 4RUFA 4S35A 1TC1A 2BKEA 3EY9A 1HDOA 3K30A 3L7JA 5EHXA 1X14A 3IXMA 2J9RA 4B40A 4BP8A 4FMBB 3UM9A 3EGVA 1G2IA 3ECSA 5CLJA 1F2TB 3N7AA 1AJPA 2QT0A 4QQRA 2YZNA 1DT5A 2QEQA 4D8VA 4JA2A 1GQ2A 3K9SA 1Z06A 4L8VA 2OD7A 2PUGA 4ZKDA 1BDMA 4RA9A 1R0CA 3IEWA 5DK6A 2R9AA 3IQHX 5CXQA 1W5AA 3THXA 3U4GA 1TMKA 4Y9TA 2E4XA 3E3MA 3UC9A 1E9RA 3LRPA 3VH2A 3CUEF 5FFFA 2FRVA 3ON1A 2YOHA 4KPEC 3NNSA 3LVBA 3COYA 1OD6A 4MVJE 1DWOA 3ENKA 3CCQV 1JXMA 1PQPA 3PFWO 2OTJV 4MS4B 1NZDA 1XJ5A 1EE1A 4X7PA 2QJTA 1L7DA 3D7RA 3MGGA 3MJCA 3TX2A 3VKUA 1TYAE 1QWOA 4KMMA 3REGA 2PRZA 3MA0A 4IFTA 1OXKB 1IZ7A 2J0SA 1QD9A 4FBMA 4KXNA 3ZJUA 3T4UA 4PPQA 2FPMA 3ROFA 1IZ9A 1NFRA 3GK3A 2FY8A 3QXCA 4NMWA 1ECPA 5LC1A 5EZYA 3H5TA 1RYHA 1V1MB 5IEJA 1U4OA 4IIBA 4I08A 5KDOA 1FKAO 1MB9A 4KRFA 3HL0A 4I50B 1ZRMA 2GCGA 1CQXA 3FZGA 5GZ6A 3S99A 4YRBA 1DBSA 5GINE 4I9UA 3L7DA 3VR4D 4AZ3A 3PEVA 3RPEA 1MB0A 1AMNA 3OQPA 3NP7A 2KTVA 4BFTA 1V9CA 3BGOS 3SC4A 2BWJA 5FO0A 5DH9A 3FBTA 4FGUA 2QR4A 3P2IA 3C4JA 1WAZA 2UZAA 1SUSA 3G8DA 4GOLD 3IL2A 2GN6A 4NESA 5FYDA 2XGSA 4C2UA 3AERB 2H2IA 1ZKDA 4JI6O 5LU9A 4KBGA 2DJVA 3ZHQA 5JNSA 1HETA 3FX2A 4DLXA 3DKVA 4JYYA 2RHMA 1GDDA 2M6YA 4RANA 1J2JA 2D62A 3PA6A 1QHHB 1ZVJA 4FKZA 1BFUA 3D4NA 2VDUE 3C7DB 3NT2A 3HFSA 1T6ZA 1BIFA 3KZ1E 5CNKA 1OC2A 2CY0A 1FFWA 1TJNA 4E51A 2C8VA 1SIOA 3QPUA 1QHFA 3B1WA 3TL6A 2NZ8A 2QYSA 2A1UB 2Q7HA 2VF7A 1R15A 4IILA 5EFZA 1ORHA 1OFHA 1YDFA 1QR2A 2BH9A 4YRPA 1A95A 4ITVA 2WD7A 1IUOA 2E5WA 3SYNA 1WR8A 3OWHA 1M4UA 5KA5A 3GIDA 2PWYA 1FFHA 3HSYA 4BVKA 2JIQA 5KEIA 3CCQF 3LKVA 3INRA 3RG8A 2DH5A 4O59O 2OTJF 3ZNQA 4PWYA 2B2CA 1GX1A 2EWCA 2B1QA 3HS3A 3K0KA 2L17A 1PFWA 4KQ9A 1YJ9F 1OGYA 3FPBA 1K34A 3VJMA 1WW3A 2IHKA 2YWXA 1XZGA 3SYKA 2XGJA 2VF8A 3IKMB 1R0SA 1TTHA 4HH4A 1EGQA 3MUNA 1T34A 4RJLA 3WQHA 2BDTA 1QRTA 4L4YA 3F2VA 1D4AA 3O7WA 2F1MA 5F2VO 3K5WA 2C3PA 2P79A 2B9EA 2R5WA 3SSMA 1SOVA 1E3LA 3E8HA 4AL4A 3UKOA 3PL5A 1LLQA 3G9UA 1DC4A 3SEZA 2OCKA 3FPHA 4OUKX 1MC4A 5HYVA 1NSTA 1ZL8A 5BR4A 4J0IA 2AF4C 3I3FA 1WVIA 1FW8A 2QUIA 3TOSA 2ZWMA 2AZMA 3ZHZA 5BMVF 3PRHA 4JB2A 1O95D 2YIAA 2BI8A 3V1LA 2VYFA 1EX1A 3DTVB 3UAVA 2R00A 1UJ2A 2VHQA 2F3PA 4LQ4A 3DHYA 2AYXA 1JDVA 1V8BA 4HRYA 5KNDA 2ZI7A 3A1TA 1JTEA 3G0OA 1OILA 4ZOLA 1FUKA 5HY4A 2XE7A 1KI1A 4C7OA 1DC5A 3K1TA 3T7IA 5CA0B 1JMYA 3PFGA 3KWLA 2O6HA 4MUGA 1NI3A 3H05A 5BSRA 1XCGB 2O2ZA 3I37X 4BX8A 2HEIA 1E5DA 3PPIA 2EXXA 2AIRA 2OCXA 3L93A 4FB5A 2W83A 3TZQA 1D2RA 2ADFA 4A5UB 1J09A 4H7FA 3DMGA 4NL4H 3MTDA 2HJGA 5HKLA 5CIYA 2ZSAA 2PSHA 4OA5A 3V4FA 3JQ7A 3H1GA 2P9JA 3EFEA 1TADA 3KQUA 4LF4O 1ZFNA 1PPJH 3KZCA 2VSOA 3RH0A 3KQVA 2BIFA 3RFTA 3ESXA 3CURA 2E75B 1U3DA 2OWEA 3F97A 2DOKA 2PLAA 1Z7YA 3AJDA 1GZ4A 3OHMA 2EW2A 4TKMA 2ZAYA 4TLEA 3WJ7A 2D8MA 1L6RA 4JROA 1NQ5A 1WPGA 3RA6A 3M3DA 1VMKA 1BW9A 2O2DA 4NFSA 3IHTA 2RGBA 2FR8C 5YASA 3QQPA 5I7VA 3JATA 2LFSA 4PCAA 3LBYA 1XMOB 2XNHA 4XVHA 3WWPA 4XFDA 5IH3A 4FD2A 3BA1A 1VKNA 1PF7E 5AW7A 2GNAA 5F7OA 2C07A 1DFIA 4O4HB 1OZGA 1SC6A 1SPXA 1YR1A 4IF6A 4JFRA 2I6RA 1FMCA 4CIYA 2PIDA 2JFUA 3P8ZA 3AJAA 1GFZA 1T9ZA 2IS6A 4HLQB 2QTVA 2WQ6A 1U31A 5KSOA 4GE0A 1RPJA 3X1ZA 1J7HA 2O4UX 5C4MA 1FVXA 4LOKA 3RBZA 1JI3A 4RTPA 4RZHA 1XJ0A 5MGBA 1FU8A 1VQPV 3EHEA 2Y6UA 4XWAA 5EP1A 1IJFA 3IAHA 2NU9B 1A8HA 1CJBA 3C9TA 4A3SA 2IKQA 1RWNA 4HV4A 4OQYA 4DT1A 4MVJF 5KJEA 5JBIA 3J81N 1VB3A 1QANA 2QORA 3HMQA 1DQNA 3KOYA 1KI6B 1DCFA 3FTDA 3AU9A 3G17A 2RNBA 1WTCA 1YDEA 4ARSA 3NHZA 1IN5A 5JPCA 4Q9IA 3QFRA 1HR0B 2IH4A 5F3WB 4RMNA 3E89A 3CG4A 1XMQB 1CR1A 3RF7A 2TMDA 1XQYA 1NVFA 2XUGA 4YDRA 3LW7A 3P9NA 4CCYB 1NY6A 1Y1SA 4HWRA 5EJ5A 2N9UA 2Z5LA 1M1UA 4RETA 4FCVA 3IDQA 4FGLA 4C21A 2JHGA 4FGSA 4GKVA 4EPXA 2O3RA 1I5RA 1ISMA 4UHDA 4F6RB 4U7NA 2A3QA 2HK9A 2Y0PA 3C6QA 3A9VA 4IIFA 3TXXA 3TLJA 1KDYA 3GIWA 1UDBA 4LRYA 4FUQA 2CCGA 5E9WA 3IUYA 1LPAB 1G4AE 3KSZO 2BI4A 5FL7A 1CLIA 1JPNA 2WE8A 4HGRA 4YUWA 1YBHA 3JQCA 5TSDA 5DYWA 2W7TA 5EIXA 4R3NA 2WFMA 5JZOA 4M1MA 4A0QA 2ZUFA 2CHUA 4HVLA 3OTWA 2GK3A 2EGUA 4L87A 3ZE1B 4KL1A 1FTSA 3FPEA 4GZLA 4MQ4A 3K15A 1E3WB 3PQCA 1WIWA 2IRWA 1UXHA 4DV1B 3H1JH 3FXAA 4EEKA 3DMDA 4KC0A 1KJYA 2H8CA 1VJRA 1N5LA 3LFOA 4I66A 1EM8A 2Q4DA 2Z6VA 4PC2A 1WMBA 4WQMA 4FFPA 2JHCA 4EYOA 3GLIE 4A92A 1GV0A 4IG9A 3WBBA 2UUAB 5JJKA 3FPIA 4JB3A 1G4UR 5B58C 2HK6A 1T10A 4BBZA 5A05A 1ZNWA 4EB0A 2RCYA 2A9OA 4JLBA 3IIJA 5BV0A 3FCCA 1IE3A 2X7RB 4TXMA 2PYZA 3T3GA 4RADA 3SEFA 1HZZC 3O4FA 1JE0A 4CEIB 2BGGA 3OCVA 3A0HZ 3ERNA 4DFDA 3VRHA 1MOPA 1PEAA 1HYQA 1DG3A 2QY9A 1CFZA 1VG9B 2VH2A 2YTZA 3OX1A 3ZLUA 4KUHA 4S3MA 1MHTA 1VQPF 1U11A 3I6MA 1J49A 1K8ZB 1UPGA 3FKSD 3ZY6A 2FGYA 2L19A 3NFRA 1U9IC 3HV2A 2J8ZA 5DTRA 2GB4A 2HDOA 1J00A 3K8QA 2DTDA 3VKGA 1IPHA 3PUZA 4IOMA 2XR1A 4WDRA 3NHYA 1XDDA 1YUBA 3WZMA 3LM8A 2P8JA 2O8BB 3ORRA 3FR7A 4EHKA 2FHSA 2P6PA 3H9CA 3P26A 1UBGA 3AVXA 2ANBA 1E4EB 2ZUWA 3COSA 1P45A 5JSUA 3A9WA 2I1WA 1GA1A 3IPAA 4I4TF 4ER7A 1Y5RA 2JGIA 3EIHA 1U9YA 2X1LA 4QTZA 1V54B 1G8MA 2VPPA 5H2FZ 3D1JA 2UUCO 3OBYA 4LHWA 4MV9A 1N2OA 1XRSB 3LWVC 3ZNPA 2A92A 2FKNA 1FXWA 4KVFA 2HMYB 4Z49A 3GEIA 4AYTA