3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
5CA0B 4O4IA 1Z5WA 4WBNA 4B45A 4I4TB 4EI7A 5LP6A 3JARB 5KX5B 1FSZA 1JFFB 1SA0B 2BTQB 4O4LB 4I55B 4X1IA 5JH7B 3JASB 5EZYA 4EI9A 2XKAA 4DXDA 5JVDA 3HKCB 5EYPA 5J2UB 3E22A 3JAWB 4I4TA 5CB4B 4EB6B 4ZI7B 5CA1B 5KX5A 3M8KA 2BTQA 1RQ2A 1W5AA 3HKEB 5LA6A 5EZYB 4O4IB 4WBNB 2XKBA 4IIJA 5LP6B 5LYJA 4DRXA 3VO8A 4O4JB 4X1IB 3RYFA 5EIBD 5JVDB 5EYPB 3JATB 3E22B 3WGNA 5LXTB 1W5BA 5JCOC 4O4JA 5ITZA 5LA6B 3C8LA 4YJ3A 3ZBQA 3N2GB 5IYZB 2RHLA 4IIJB 5IJ9B 2RHHA 3WGLA 3JATA 5LYJB 4DRXB 2VAWA 5LXTA 2GVIA 5JQGB 3RYFB 4TV9A 4EI8A 2Q1XA 3N2GA 5IYZA 5IJ9A 4X1YB 4X1KB 4U39A 5EIBC 3M89A 2VAPA 5ITZB 4O2BA 5JQGA 4O2AA 4LNUA 2R751 4E6EA 4YJ3B 2BTOA 3HKDA 4TV8A 3VO9A 3ZIDA 3RYHA 3UT5B 1OFUA 1W581 1W5EA 4M8IA 5M7EA 4X1YA 4X1KA 5KMGA 3RYIA 5GONA 3HKBA 4TV9B 4ZOLA 5LP6C 5IJ0B 5LOVB 1RLUA 2R6R1 4HNAA 3R4VA 4ZHQB 3WGMA 2Q1YA 3UT5A 4O2BB 2RHOA 4O2AB 4LNUB 5LOVA 3HKDB 5IJ0A 1W5FA 4B46A 4TV8B 2VXYA 3V3TA 3RYHB 4ZHQA 3RYCB 4U3JA 3VOBA 5MN6A 5C8YA 5KMGB 1FFXB 5FNVA 3WGKA 3RYIB 5GONB 3HKBB 4O4HA 4ZOLB 4YJ2B 4TUYA 5J2TA 5MN4A 4HNAB 5JCOA 3CB2A 4X20A 3VOAA 5MN5A 2RHJA 3RYCA 4F6RA 3N2KA 3JALB 1RQ7A 1TVKA 3WGJA 1TUBA 5BMVB 3VPAA 1FFXA 4I50A 5CA0A 4FFBB 4YJ2A 1Z5VA 4XCQA 3JARA 1W59A 4KWEA 3RB8A 4U3JB 1JFFA 1SA0A 4IHJB 5C8YB 4O4LA 4I55A 5JH7A 3JAKB 5FNVB 3JASA 3JALA 4O4HB 5J2TB 4TUYB 5BMVA 3ZBPA 3HKCA 4FFBA 5J2UA 3JAWA 4X20B 5CB4A 4EB6A 4ZI7A 5CA1A 4F6RB 3N2KB 4IHJA 2VAMA 1TVKB 1TUBB 3HKEA 3JAKA 4I50B
chains in the Genus database with same CATH superfamily
3I04M 1ORWA 2KB1A 3L7IA 2VSFA 1SERA 1CS0B 4HNVA 1BVUA 4QBTA 1QGED 1N2GA 1U7PA 2XEXA 4D45A 5T41A 5HWSA 4ZVKA 2V96A 2XQVA 3EQ8A 2AJLI 2R97A 2NO6A 1RHRA 3ZJ5A 3TIXB 4ADSG 4FT2A 5K5EA 3PUIA 1UPBA 1ZN2A 1QBZA 2QDOA 4R69A 4NEGA 2P5TB 4OPHA 3KUKA 2FQQA 4EQ6B 2RG1A 1GA6A 3AR8A 4XUCA 5DLQC 3WMXA 4NYIQ 2I55A 1P0FA 5MDHA 1ZGAA 1XDSA 3I62A 2R6R1 3GW8A 3O74A 3AFHA 4WOCA 5BSGA 1V25A 1ZJZA 3EGIA 2XR1A 3RLIA 5JSZA 2VDRB 5DLPA 1GAWA 1R5OA 3CF4G 1PX0A 4TKUA 2PD3A 1KI4A 1NWHA 3TKYA 3HKCA 4F4CA 3NVDA 3QFFA 3U7QA 2YXZA 5DTJA 2EQAA 2GVDC 2XUMA 5JSYA 1FDSA 3Q8XB 3JASB 3A6PC 4FZJA 5KSOA 3WKAA 3FD6A 1BWQA 3DXRA 2DTEA 3ESZA 1UFVA 3Q8KA 2I1QA 4Z0PA 2C3YA 2ISCA 2GO1A 4MKIA 1GV1A 4QHTA 5JFTA 3QQPA 5JI2E 4IV8A 2UYYA 5DASA 4ZCLA 1WCIB 3FFWA 3H2IA 1L4GA 4B4VA 2IYPA 3FZYA 4IZ6A 2O4UX 4ZO6A 5JW6A 4WCFC 3ETCA 3OQHA 4OGWA 4K6FA 4EGQA 1DKPA 3F5MA 5T64A 1DJNA 2W4IA 5DGIA 1JDNA 2EX1A 3H01A 3FKSG 3G71F 2FSVA 3CUVA 2QRUA 1N33B 1WDTA 3R20A 4RH3A 1RXCA 5AW3A 4DUGD 1NUAA 1VBFA 2UVPB 4QC2A 5AOBA 1KBHA 4KW7A 2PV0A 2WMDA 4QBFA 2JCXA 1Y1TA 5LN1A 2H11A 1J39A 2B4AA 4C0HA 3EYAA 4UAJA 4PO8A 3D02A 2CNWD 2RC6A 2YL2A 1RACA 3O7WA 3S44A 4TYYA 2YHUA 2YMPA 2BMVA 3DF7A 1HRKA 1KUQA 2LZ0A 4PW0A 3H16A 4DWVA 3NQ41 1N5DA 3ZHBA 3C2QA 2J67A 2VG8A 3HADA 4C4SA 1I3LA 1HKUA 5DOZA 3V7UA 3O92A 1P0QA 2KJQA 3E5NA 2E4YA 1Z8HA 2D3OW 3IEVA 2QNRA 4D26A 3OZSA 3ZI0A 1G16A 3UAVA 2GTHA 2H6EA 4HEHA 5TEVA 1KKDA 3G5MA 3NH6A 4U1RA 3BDAA 4V0MA 4TM7A 4ZMRA 4Z9AA 2OAGA 3AP1A 2WUFA 4R1TA 3T9EA 1K88A 3RB8A 3I76A 2OCCB 1GO3F 3W7VA 2Y4OA 4YMGA 5CA1A 5AXBA 4UCRA 4ESHA 3H9QA 1YS7A 1TK3A 2Q9LA 1P29A 4GUAA 2I76A 3FAVB 5CA1F 3MJHA 3V00A 3BZUA 1WWKA 4HWKA 2ZBRA 2YIBD 4C9BA 2M98A 2G40A 2GSMB 4TWAA 4RD6A 3DOFA 4IT5A 1YITF 4TS3A 3CRQA 1X7XA 2HT6A 4HB3A 1CDEA 4KITB 1NJ2A 3B48A 1G8KA 3ACBA 4G8JA 4YUYA 4FCVA 2R1TA 4YALA 2BFDA 4HDSB 1M1KW 4Z4FA 1I13A 3SHVA 2IS2A 5J1TB 3P9ZA 2Q6KA 1M7BA 2I6TA 4YPVA 1Y4MA 4ZPXA 3KCXA 2DY1A 1N6RA 1YZLA 5B7QA 4NFSA 2ODAA 3G0DA 5JZSA 1FDVA 2F55A 4HG2A 4BC1A 4G9EA 2CCJA 5F51A 4G4VA 5CHYA 4PDLA 3QI2A 2AOXA 1SFRA 3UB3A 3F3KA 2EULA 4A5OA 5ALGA 2BGUA 1RA4A 3CEPB 1SESA 2QTZA 3IUBA 4EGAA 2FWAA 4YRJA 4G0QA 5LP6B 4K9QA 4MSUA 1OYOA 4O5OA 4YACA 1HEYA 3BMNA 5HCIA 1AO0A 4IVPA 4EHKA 2P30A 3DV0A 3PUJA 2HZBA 3P94A 3RFUA 1ZIDA 2ZRPA 1BXZA 3RHFA 1Q57A 2V5UA 3KQOA 2QPOA 1C9YA 1JVNA 2P5OA 4QFDA 3GLHA 3W7XA 4C06A 4LDZA 1B7GO 3T3OA 1KZGB 4DR5B 2I6RA 3QVGA 3W2IA 5B2ZA 1U04A 2JRIA 1O97D 1SR8A 2RIPA 1QDLB 2K2QB 4R6XA 1UBJS 1Z29A 4Q3OA 1Q7GA 1OAKA 2QQ5A 1VXRA 2C0PA 3BHNA 1GJRA 4IRXA 1H2BA 3A27A 4YDHB 1JXQA 5D3MA 4YYEA 3PNYA 4B40A 2GHYA 3BXEA 2VTDA 4QYTA 3SQLA 1RYBA 4C4OA 4LNHA 3RJ9A 4RE5A 1XEXA 1DG3A 3KKLA 4RK4A 1FFGA 2PSHA 2FRDA 5BXYA 2D06A 4BFWA 4NQRA 2VYNA 3R0PA 1X70A 4ND8B 4H77A 2PY5A 1JV2B 2QG9A 1K73W 1AHPA 1YA4A 4TZKA 5IJZA 3DE3X 1UMBA 1U28C 3PT5A 4PO3X 2XIQA 1FK8A 4Y6QA 3NTVA 3T5DA 4QM6A 2AJDA 5IN4A 1Z6XA 1YIJF 2GZLA 1OXXK 1JBKA 2J9FB 4ZGGA 7REQA 3AIMA 3BE8A 3O31A 1R6BX 1ZS9A 4BT3A 2WPDG 4RXMA 3LDGA 2GJSA 3EDCA 2KQUA 1UBKS 1T2UA 1VYHA 3OEED 1ZOOA 4CDRA 3PYXA 1P8AA 2JS5A 1YS2X 4CF5A 2UDPA 3S3TA 3S8MA 4Y7DA 1US8B 1MQSA 5CCEA 1NYTA 3FVWA 4KE7A 2FVXA 1QRAA 2XKBA 1TQ6A 1NURA 4BEWA 3WIBA 2D59A 3N2YA 2Q9BA 3H5NA 4OUKX 2ZAGA 1TO6A 4OKIA 4B7CA 1MAVA 3BJIC 3IS3A 4C7XA 3LDDA 3WJ1A 1U5AA 1I7SB 5CX1B 1JHUA 2MMGA 3LW8A 4KCGA 3CF0A 2HFKA 2P8SA 4MUAA 1ZSNA 2FPIB 2G07A 1Y9ZA 4ISBA 1GYQA 5BZBA 2IU4A 3Q7RA 3JSNA 4KFRA 1F1BA 4U0JA 3T5CA 2YWFA 4JUCA 1JDSA 2YWCA 4GQIA 5A5FA 3S99A 1KOGA 2VATA 3IILA 5KVVA 3LC2O 1WMSA 1DFGA 4KBGA 1W48A 3IHKA 2A5YB 3R4CA 3WYBA 1DZIA 3L18A 5K3CA 3RW9A 3QFCA 3HXQA 1K98A 1ST2A 4RDCA 3AUTA 2UYHA 4IFTA 1CUEA 1XQ1A 1H2YA 4ERNA 1V3TA 4LF7B 2OK7A 3PTAA 4AKEA 1DELA 3QX9A 1QVZA 1RWVA 3ILSA 1SHLA 1PPJH 1FXVA 4MGHA 5F2KA 3NG1A 2MK3A 3GIDA 4GW3A 1JEQA 2BPOA 2J9YB 5B37A 1K7XB 4NPAA 4DV6B 5DW0A 2XT0A 1HTWA 3PPWA 1YRYE 2WQZA 1DCMA 4G0VA 1JVSA 3JSAA 2CFOA 3C0KA 5JAUA 4E7OA 3L92A 4OUDB 2BGGA 1QRRA 4OK6A 4LJKA 4CG0A 3T61A 1IPHA 1Z9BA 1G42A 3VO2A 3HPLC 2BDEA 3TDNA 3VDNB 4H0FA 1WVGA 1TZJA 1SZCA 2N42A 4HWGA 2AG5A 5KOYA 4FN4A 3HP4A 1E3WB 4GR5A 4HX5A 3MAGA 5HUHA 2XWJI 4NCBA 1F3OA 1DJOA 1OWMA 2X2OA 3HFRA 3I2KA 4Q4LA 1UAGA 2W6PA 3SC6A 3H05A 3KD2A 3RVQA 1GNQA 1SZDA 3K0GA 1URFA 2FN7A 1HE1C 2WJZB 2P8JA 3N58A 4RC9A 2RK3A 4EAQA 3CMAF 4PBTA 3SR0A 1G9SA 1JU4A 1YQ9A 2OT3B 1WLEA 3P4EA 2R72A 3LQYA 3IXQA 4GZ3A 2NUAB 2ZVQX 3KZIZ 4YO7A 1MX5A 4NQZA 3AW8A 4X44A 1BD4A 1XCLA 1BA3A 1MQ9A 3O9VA 3ZRWA 1PGOA 4Q9NA 1U4NA 2H17A 2H7CA 2Q9CA 4G5XA 4FFDA 2UYQA 1XQ9A 4JK3A 4QHYA 5H2FZ 2W6MA 2C42A 4XE5A 4OQ4A 4BATA 4Y3UA 4E5DA 4RVUA 1PEDA 3B2QA 3B9RA 3BZBA 3RC3A 4L5BA 3ETEA 4DIBA 4WFAV 3LXRA 4KR9A 5TRTA 4X9QA 3M6VA 1TAQA 3DOOA 4XDLA 2AQHA 4CIVA 3CCRF 1SG9A 1PP9H 2HVYD 4AILC 4E12A 2ZJAA 1NUQA 2A59A 1KAMA 3B2EE 5K1ZA 2H92A 3PU6A 4YRQA 3BAZA 2KG7A 4D44A 2CHEA 4IZOA 1F3LA 1LZKA 3IT0A 4BVGA 4MARA 1A82A 3M1IA 4TMFA 1OX4B 3DBRA 3LDAA 3A9CA 4B5LA 2AI2A 3GELA 4LWOA 4WWHA 1P5RA 3UGQA 3NAMA 4MCAA 3IAS6 3T3NA 1LNQA 1COWA 1JLLA 3U5ZB 4J7XA 1VG0B 1E1QD 3RSHA 2WFZA 3AM3A 2Y1FA 1HDZA 4PAOA 3KT8A 2PZGA 3WB9A 4X7PA 3QU7A 1GCOA 3BCHA 4HT3B 3CUYA 821PA 1Z5GA 1A5AB 1YL5A 4YP7A 3GGJA 2NZ8A 3ESRA 1O5IA 3WLRA 3L0DA 5KKAA 1C9EA 2VXCA 4PN3A 2HR1A 3MCTA 1ZVJA 3IBSA 2F8SA 5AK0A 3I3SR 3ORFA 4DTCA 4PYOA 3ND5A 1ORRA 4L0DA 4P35A 5BSWA 3CBQA 4WLOA 3D8CA 1BHAA 4RVNA 3CZMA 3QPAA 3KQTA 3PQDA 2VP5A 4K9KA 4MCHA 2XMBA 1YT5A 3FRHA 2ICAA 4DLYA 3E1SA 3F73A 1BS1A 3GJ6A 1BYIA 5DEDA 1MW8X 2ZYSA 1CHDA 4UCVA 1T25A 5F2VO 1P7PA 3C6KA 2BHLA 2Z4TA 1R9GA 3I30X 2P62A 3ISTA 2IF2A 3SOZA 1E8MA 1QVGF 2IJGX 3WK8A 1U7XA 4HXFB 4D4GA 4EFNA 1ZK3A 3ANNA 2QSZA 3FVQA 1SKQA 1G9TA 1TRKA 1MENA 2AX3A 2NZXA 2I78A 2MJLA 1TLFA 5GIPC 4BEJA 2EIMB 4WZBA 1LGYA 2QX6A 1YNOA 2O1WA 3PKIA 4U9HS 4MYTA 2N1BA 1V1RA 4FYPA 1Y82A 4AJEA 3GZTB 4G4ZA 3H5IA 1L5MA 5EK0A 2Q4EA 3J7AC 5DYTA 4YWJA 1JXOA 2UXDB 3FROA 3O8LA 4ETWA 2YVQA 4JLUA 2W2VA 4TYMA 2FPSA 5KTKA 3ZEIA 3TLEA 4B8ZA 5ALSA 1FEZA 2JAWA 2IIBA 2WWHA 1XKXA 5MN6A 2HSZA 4CM4A 3MAAC 1GNSA 2QXTA 3KOZA 3RUEA 4MB2A 2OV3A 5DJ5A 3VSCA 4WEQA 1FFTB 4Z3KA 4ISCA 3R5HA 4P4SA 4L9SA 5FFNA 2ZSEA 3I56F 4IHJA 2X0IA 4DOMA 3TG8A 4HQRA 4J75A 1JR2A 1Q44A 1GTG1 1FTWA 2VLBA 3M4XA 3NHJA 4MWBA 2YV2A 4G4WA 3MT8A 3ECAA 3TOZA 1G64A 3DGEA 3C6MA 1UZLA 3I9KA 4WD3A 2GBLC 1E3IA 4GO1A 4RZIA 1AK1A 1UKZA 5GJVC 2GCPA 4C7VA 4WBSA 4DBLC 4HR7A 3PWTA 1V5FA 2AW5A 4HRXA 2FSHA 3M4ZA 5H5JA 2AX4A 5CVEA 5L95A 1EGQA 1Z2EA 3MT9A 2CNBA 4Q34A 1D1TA 3SAJA 2ZAIA 1C7FA 2PD6A 4DQXA 3ENNA 2NV2B 1M34E 1RWNA 1CEEA 1R0SA 2FSIA 2QTWB 4JMLA 1WP4A 3PCRB 3T06B 3S2ZA 3ZHOA 4FT4A 3CSDA 3C74A 5FOQA 5T4HA 2F00A 2H9YA 2HJVA 1VQPV 1J95A 1TVKB 4XYLA 1GMGA 4M1SA 4AD8A 1M2NA 3SXUB 2C4KA 4RKQA 3LLUA 4PXSA 1QH1B 4XR9A 4RE6A 2QUBA 2CMFA 3VYTB 4LF4O 4M76B 4M3NA 4IIBA 1ECCA 3WV5A 4RK6A 4BQIA 3B6MA 3DC2A 1KY5A 3OQIB 4XD7A 4DT1A 2OFPA 1XTRA 5C34B 3X2SA 3JQAD 1IXRC 4UD2A 1QVFU 1CF4A 1WS6A 3H2HA 4L15A 4KAAA 4C2AA 3LDFA 4L0QA 1A2BA 3FFAA 3IKMB 3QELB 1B15A 4MDEA 3UMBA 2IW1A 4UTXA 2QA4V 3BRWD 5LUAA 2ZJOA 5KA6A 4OX9B 4BU1A 4P0PB 3RVRA 1ZLXA 3JALB 3G6KA 4YMUA 4UUNA 2G5TA 2JG3A 1G20A 1Y6JA 2ZT8A 4R9UC 5CB0A 1M1YB 1F0NA 4ZVQA 1W30A 4IQ4A 3TIVA 4KRFA 2BHRA 4URFA 2YVKA 2NUTB 2ZYTX 2EZTA 3K9BA 4KFTA 5REQB 2DG2A 5JWOA 4HTAA 1RTKA 5E7JA 1SVIA 2OORA 2ZE5A 2O2DA 4OHVA 3ANXA 3NJRA 4Q39A 3V8BA 3CR7A 1LBTA 4ZQBA 2Q27A 1J0DA 2QZZA 4RL4A 1JAXA 3AG1B 2W6CX 2H06A 3ASZA 2HXYA 3EAQA 4P2BA 1P62B 4MR9A 4OJTA 1X7GA 5DYWA 5FBLB 5H81A 2O1EA 2XCOA 4C3VA 1J5EO 4ROSA 1OXMA 4IGAA 2YYYA 5ER6A 1J0AA 3S68A 1BN6A 1SUEA 2BP7B 2GOYA 3DLIA 3HU3A 2WLTA 1P0PA 1G66A 2YZ7A 2EW1A 2YWEA 4JI0B 1E2PA 1B0UA 4LWQA 1I2MA 4V2IA 3ZTWA 3OESA 4C76A 1KTIA 3NEPX 1PYGA 4XFJA 1NVGA 4KN6A 2FQ1A 2WWFA 1FNMA 4TWRA 3ILYA 1I01A 2RHDA 3VH1A 4KPUA 3ESQA 4IOLA 4KKVA 1N2ZA 3GR6A 3UHOA 1K5DA 1CIVA 3DUWA 3TMKA 2GHQA 3H99A 1J97A 5E1OA 3FKSD 2HS0A 1EUDA 3TZKA 1J5PA 2HHCA 3CONA 1S0UA 3AUUA 3F90A 4NG4A 4NV3A 3PLAE 4MHTA 1M1ZA 3P8ZA 1F6WA 5JMWA 1OB5A 3B4SA 3QO7A 3S1AA 4QU8A 1O94D 2OVFA 1D2HA 5KU7A 4G5YA 2B0CA 3QKTA 4EECA 4GLBA 4ZXFA 4WDQA 2GARA 4D3FA 3ZEDA 3KWMA 2CSUA 3MCZA 1GOTA 1FDUA 3KCQA 1B1CA 4DMGA 4YIKA 1R00A 3M49A 3I8XA 5KJFA 3Q4HB 4ND5A 4HUQA 2WU3A 3OLXA 3PHBE 1MB9A 1M0SA 1HE4A 3I04A 3MYRA 1EVQA 3SR2C 1D03A 4JI4O 3IELA 3SF0A 3FUWA 4MVQA 4DMKA 4B62A 1R3LC 4ER7A 3K32A 2YC0A 1ZHOA 2P1ZA 5AQEA 4HYOA 3ENKA 1D0VA 1WZCA 2J3KA 4TQ9A 4UPVA 4M0CA 4X9XA 3KS9A 3OFND 3IBGA 1NUSA 1U0HC 1JG3A 5BSHA 1UH5A 3K58A 3EG5A 1AJEA 4BMNA 5AVYA 1FUEA 2F59A 2HK8A 1VJCA 3WDMA 5AJUA 3SXJA 4B83A 1U94A 2B35A 3K1JA 4OQNA 1NZJA 3NHBA 3GQBB 1PJRA 1UADA 4M7OA 2V1XA 1Z0KA 4YV7A 4KR7A 4NFYA 1JQ3A 7MHTA 1UPUA 3WLPA 1YOVA 4X20B 3HXLA 5IPFA 3M5DA 5FHQA 3H4VA 5EWJB 2CUKA 2FH5B 2CJXA 1CNEA 1VCHA 3HM9A 5JIBA 2WYIA 2J48A 4DUZB 4K3AA 4ND2A 1M8GA 3HBJA 3QLEA 5DECA 1YTFD 3EAGA 1MSWD 4FZ0A 1C0KA 2IH3C 3RFRA 4UM7A 1G18A 4EHAA 1GSOA 3CJQA 5CDFA 1P1CA 3ZCVA 1YAHA 1GUBA 2C04A 2ZULA 3DDHA 3GJQA 5ESRA 4OV6B 2NOAA 3D2BA 5EZ5A 4QXQA 1Q0UA 1UFQA 4YUWA 3VU3A 5AJTA 3T0IA 5FOXA 2EF0A 1W5EA 4FDMA 1QR2A 2AN4A 3LHIA 5E4TA 5DTQA 1NLMA 2NU8A 2PZLA 1ZYUA 2R11A 1E5XA 1NR7A 5KMGB 1WA5A 4ZICA 4QJFB 3OEWA 5I8PA 2WU0A 4LQDA 4BL5A 4V3BA 1SKBA 4UXIA 4DDHA 13PKA 4Z4IA 4D8XA 3RAPR 5CNKA 5JFOA 3WG7B 2ZRNA 4GGOA 4M9CA 2Q07A 3E9YA 3ZWOA 1WMBA 4XUEA 1Q81W 3M8KA 1FP4B 3B36A 1T0UA 4CQLA 1BGYH 5D5QA 5TDHA 1GFWA 1P1IA 5DBOA 3MT0A 2I2BA 4AN4A 2VHTA 1NBIA 1W34A 1ND6A 2G5PA 1SUBA 2OC9A 4Q4CA 3BPZA 3C4VA 4EEZA 4D25A 1AHHA 4MW2A 3U7GA 2VOJA 1F51A 3NHKA 4PAMA 3RS7A 1FNBA 3FZNA 4K35A 3B3JA 4C6SA 1F8YA 2NX2A 3PUZA 1H2RS 2GBFA 1X80B 4UFPA 1N6NA 1UAYA 1DX4A 5FFMA 3DR5A 3CCUV 4MLCA 3QMWA 2ZR0A 3I2YX 1PWXA 5C37A 1HNXB 4ESVA 3CO5A 3H17A 4M6WB 4EEQA 2VZLA 1CS4C 4AY6A 3RBZA 4NZZA 2JH9A 5JS8A 1TXGA 1PQ4A 2ZRGA 1QF7A 3U3XA 3UJPA 2G9UA 2XVMA 5IW8A 1WTAA 4YDRA 3P2OA 2DUNA 3AKYA 4GPZA 3GBVA 5HY1A 1S8NA 3P9IA 5KWVA 1OFIA 4ZFNA 3MIIA 4CCYB 2WPDD 1NI3A 4FFPA 3KHTA 3K9WA 1OTHA 3P3NA 3U0VA 3LUKA 2IODA 1P7BA 4E30A 1VLLA 4FNMA 5K0BA 3AI1A 4RADA 3PDHA 3ORYA 1BEEA 1BQ4A 2KTUA 4CM6A 5GINE 1WQ4A 4AZ3B 3L1VA 3KXLA 1W0CA 3QNUA 4C30A 5BN4A 5AHXA 1PQUA 4ACBA 1YFKA 1KPHA 2LE0A 5H70A 4YMHA 2BJHA 4ZCRA 4GSLA 2C98A 4MR8A 1ANKA 2P4SA 2Q3JA 3NZEA 1YR8A 1ZKDA 2FX2A 4G89A 4X1OA 2DE0X 4CBCA 3IJPA 3W7WA 5JJCA 3PITA 4C2BA 1G8PA 2QUAA 4BVAA 2WT4A 4XSHA 4N40A 4M1YA 3KSBC 4J0CA 4BE9A 1XKQA 3FCAA 2ZODA 3F7MA 3OT4A 5LZ7A 3KPYA 4M60A 3KUUA 2V6FA 5ICMA 3JYLA 1XD2B 2QLTA 2O3SA 3CKKA 2EVWX 1KMIZ 3MUFA 2XWBF 1RLUA 3HXOA 1W2WB 2Q1UA 4OB8A 2CHSA 3INRA 4GVPA 4GLLA 3FNEA 6GPBA 1OGJA 4C6RA 5DBFA 5LKRA 1BH2A 2ZXFA 4DR6O 4XIJA 4F9TA 4XB1A 1SQQH 2H0QA 3NYQA 1JHYA 3PJEA 1A27A 1XQXA 3PEFA 1B0AA 2YC4C 3O94A 2I2WA 3CV3A 3GT3A 4MQEB 3OD5A 2QW1A 4BNMA 1SA0B 4FM1A 3L70H 1IZ9A 1O0SA 2X1LA 3F7OA 3D8HA 1K9MH 4C05A 3DEYX 5IF3A 5AR1A 1KI7A 2WJYA 1U0BB 2FPPB 2ZI6A 1ZD4A 3RROA 3OE7A 4LJSA 3U3KA 3M8AA 4WTOA 2B1RA 3RASA 1K08A 1U3DA 4DLVA 3D3KA 1UEJA 1K75A 3GJ0A 1COMA 3CG4A 4ESEA 2Z08A 3R7WA 4C78A 4OU5A 4UU1A 2Z2YA 1DBIA 3GH1A 5EINA 1PF5A 2Z1FA 5I7RA 421PA 2ZM6B 3UHPA 5T4BA 3HRHA 3NHMA 3VTFA 3FNRA 5CLGA 4P86A 4RJLA 1JE0A 2XSZD 4IDFA 3V2HA 3O4JA 2CK3G 1ZAUA 1N2OA 2JI8A 2JFQA 3A1NA 1HDRA 2I4MA 3LCMA 4HGYA 1FNNA 3EPPA 1OU0A 4NE9A 5K6AC 4EJ0A 4GC5A 1DDGA 4HAOA 5BWLA 2QSAA 1NL3A 5LZ9A 3EZLA 3PQ5A 3N0WA 1WUIS 3MMXA 3STUA 2PSSA 3SLKA 5C5IA 4PJ0Z 5K99A 1UK8A 4ER0A 4X1IB 5FWXB 3QTTA 2Q5HA 3I55V 4WI1A 1IM8A 2AUNA 4NAVA 2C2OA 3CIFA 4H7FA 5TJHA 3LC1O 3A1UA 1JSRA 4CMEA 1YL6A 2PGJA 1C4XA 2W5UA 3NCHA 1GGEA 1M5TA 3VBEA 2PUTA 3FOCA 1PNRA 1P2BA 4JB2A 3KBOA 1VG1A 2O7SA 1QPBA 1R74A 4ODIA 3AVVA 1RAFA 3OCCA 4KZPA 3Q2IA 1E1MA 1GZDA 2ZNJA 4CKXA 3L8EA 1DF5A 2F66C 3P5BA 2LXNA 1U3CA 1BJKA 3WSVA 3U0OA 3ILXA 2IYNA 4RXTA 4RWZA 5HGXA 4NUTA 1NVVR 3EW9A 1ND5A 2P0EA 1XEWX 3FTQA 1XOIA 3WYFA 1RC8A 1QYVA 4UU0A 4RLHA 5LBQA 3MWLA 4QD3A 3LCJA 2CHFA 2PKQO 3SZRA 2JFZA 1DO2A 4XPIA 3VXKA 1I3KA 3AK4A 4FOOA 1TD9A 3UQ8A 3VU0A 4EWLA 3QOYA 3TB4A 1S2MA 1P0MA 3CVUA 3NOOA 3H8VA 4BMYA 1XQVA 1JXMA 3U44B 4C8EA 5FO0A 1ZUQA 4ARUA 3KTOA 2H1RA 4YX9A 3NB0A 5LXTA 2HEIA 4UAGA 3BD8A 4R9SA 1F38A 4RESA 4QUDA 5HIMA 1YAJA 4MVJA 5HRUA 5I47A 1BXRA 1DBSA 1XYYA 4U7JA 1GPMA 2HPVA 5LXTF 3AHCA 2IVFA 3LP5A 4G4SP 4E3WA 2VP9A 2DUUA 3HB0A 3JTEA 2V58A 1H0SA 4YUZA 1GEGA 2VGMA 3QFRA 2B4TO 1VJGA 2XE6A 4MYCA 4K9SA 4BRUA 5BR1A 5K7SA 4ZOQI 4AF8A 3LS2A 3WB2A 1KKMA 2JEZA 1CJVC 2PX5A 1XTQA 1WPQA 4ZU1X 5LDHA 3CXCU 1P7VA 1YCDA 1W1WA 4R2KA 1MXFA 3EUFA 1GUDA 1IN1A 3ZBPA 3PV0A 4EFKA 5E38A 2WHPB 3GEPA 4DMFA 3F74A 3HRKA 1QHGA 4RIFA 3KB8A 1PFUA 1H3NA 1NDUA 2DFNA 2YHIB 3OLZA 4FQ7A 3F5QA 1JJIA 5E3HA 4A8HA 2AK3A 4EG7A 3CGGA 2QZPA 4P4LA 1T3LA 1RLOA 5D3ZA 4W1RA 3WKCA 5BQXA 4MS1A 1CU1A 2WM9B 4A4DA 1HYBA 1UT5A 2XMQA 1TTTA 2VAXA 1E1CA 1YTLA 5DGTA 1VMGA 4L85A 3IE2A 3ICEA 4E2WA 3E18A 4Q9KA 1VHAA 1H2NA 3I28A 4QG7A 3OO1A 5EP1A 3ZPXA 4ZTZB 3B09A 4FLFA 2X4IA 1BW9B 4X6YA 1SZQA 3K06A 5ERXA 1YC5A 4GFDA 2TMDA 2FPGA 5ELMA 2EIHA 4GVXA 2DHQA 2QUZA 1ZX3A 1H48A 3ZN0A 1PO7A 4NABA 1R1BA 1RRFA 4IDNA 5LLTA 1B3QA 1QS0B 1C1HA 3FUTA 4KH0A 2FSUA 3AI3A 1HTBA 2YMQA 4PCUA 1T9HA 4NR1A 5IK2A 4EABA 2QPAA 2W83A 4TTVA 1NF8A 5TX7A 1QJCA 4BZPA 3NH9A 2PUHA 3QSGA 4KQ2A 2ZR7A 5LMUO 2P5SA 1GPLA 1SU8A 1P5ZB 2O3RA 3TW6A 1CE8B 3SYNA 1QYRA 4IM7A 1UM9A 2HWYA 4MEJA 3CKMA 2P77A 1Y5NA 3N2IA 3EZ9A 4GI3A 3RU9A 1EB8A 2GD0A 5FL7A 3O7MA 1T0BA 2WEKA 1I7PA 4BQFA 3T5PA 2HSDA 4LJRA 1OBFO 3G4SV 1KDRA 4YFYA 3JVDA 5IYCO 3B6EA 2FDRA 5AXAA 1HE5A 3WYGA 1R0XA 2FW8A 4B6PA 4EI7A 5T8KC 3H1TA 5CT5A 2XMPA 3JARB 3J80N 1XLVA 3B8NA 3KCNA 4YAFA 5FUXA 3I8SA 2BSQA 2M6RA 4GEKA 1YFLA 1XWWA 3VR5D 3EZGA 1OU4A 4RHTA 4L2IB 1MEOA 2PUDA 2OHWA 1K7FB 2J3DA 4LV6A 5G0VA 2DMXA 1V54B 9ABPA 1M5RA 3M9XA 5D00A 3D7LA 4LBWA 3GLIB 4MV5A 3AX6A 2H08A 1DTEA 2YN4A 2LCFA 4NS1A 3S5UA 5LOVB 1VBKA 1M90W 3PBKA 3KSAC 3E27A 2H4HA 4U2GA 4MITA 1V8PA 4MV3A 2EC5A 2KWIA 4BB9A 1X9IA 2G8NA 1IPFA 3I2GA 3Q3CA 5DMHA 3TQRA 4MW0A 3ISVA 4NU5A 1C3LA 3SEZA 1A4UA 4BB5A 3S2GA 3T80A 3JZAA 4GGPA 4ZV9A 1MC8A 4DA7A 1M7GA 5BWCA 4E1BA 4ZRDA 4AS2A 1U1EA 1QTIA 3MTBA 3DS8A 1AHIA 3IMPA 2VSQA 4XYBA 5AVRA 2G3YA 5C0OE 3K2BA 1GL3A 3HB9A 2OCCC 1I08A 1NN3A 4WESA 2O4CA 1NBMG 2YYAA 3TCUA 5ULLA 1K97A 4B82A 4DR1B 4QGBA 1NNSA 2PVPA 3UFXB 1OKKA 3NRCA 1Q3KA 1USKA 4ZN6A 2GSDA 3UM7A 2OB1A 2P79A 3QVJA 3OBWA 1H2AS 3LVFO 2XE4A 3QO5A 1T2FA 1TF5A 3ICQB 3JQ9C 3BGOS 4TVKA 3FMIA 4C4RA 3VDRA 3RK4A 2PWAA 2SNIE 1H2GA 2H2IA 2QN7A 2EF1A 5I3CA 3K20A 5B7NA 2YIDA 1VDZA 5CAEA 1LB1B 3PXCX 1J23A 4K8RB 1QF6A 1JFFA 2TECE 5FBZA 3ASYA 4KQ6A 4L9WA 3CZRA 3Q72A 4URUR 3C85A 1YSCA 2QR5A 2P2ZA 3ADPA 4RFSA 2YV3A 3UT6A 5HE8A 1V5GA 5CB4B 3TSWA 3H9EO 2QN2A 1YRQA 1KEZA 4XYGA 1REQB 2X5XA 3AUSA 4L8YA 2WLIB 1N0UA 3BT7A 1DEXA 2ZTVA 4HLUA 3VUFA 4WNAA 1QRSA 5IAOA 3ECCA 4I2VA 1M75A 3H8WA 1V96A 1YD7A 2BGRA 1H2ZA 1IDOA 4CR8A 3X1XA 3L0ZA 5E8JA 2QTSA 3L5OA 1G60A 1HOTA 2G83A 3BIFA 7GPBA 5LP6C 4GYKA 1VK3A 3AKCA 4Q4JB 1STOA 3CLRC 4NLLA 3BE6A 4O2AB 4YRBA 1WKCA 3WGOA 1VA5A 3A6JA 3R7AA 1MG1A 4KQGA 3RWRD 3X43A 3SIRA 1DARA 1JKJB 4XDJA 2R44A 1KQNA 4W6QA 3ZQJA 3NBXX 3FI9A 1VEWA 1CJUC 3VBCA 4A0QA 1JJBA 2A9JA 4UEOA 1C9NA 1QF9A 2GBGA 1MVOA 2VC2B 3I4FA 3D7NA 3IUJA 4N21A 1DXOA 5LBIA 2NO1A 3B3AA 3HQ4O 2JGIA 4HQNA 4MIEA 4RQUA 3C7DB 1MD9A 1NMQA 4LA4A 1CUHA 2RKOA 2CLLB 3UTDA 2AV6A 4QJBA 3WB1A 1MB0A 4KX3A 3OETA 1YASA 3U39A 2FW6A 4AS3A 4PA9A 3N2GB 1MGPA 4B34A 1ZOIA 1SKYE 2IM9A 1KNKA 5BWOA 2HPAA 3DOEA 3VQYA 3W3AA 4I99A 5L3SB 2OZLA 4LHXA 3HJBA 4QIWF 3IDOA 3ABMB 3UO3A 5IC4A 3D1LA 4I19A 1U0NA 4NCHA 2MW2B 3GWKC 1J2RA 5AK3A 3QLVC 4DNPA 4IHAA 2ONJA 1WUYA 3S2YA 2XCRB 5COBA 5LZ5A 3EFOA 2VPTA 1K34A 2O8DA 2FUEA 3LLMA 5LD2B 5T6BA 4DZZA 5DHUA 3LWVC 4PFKA 3ANLA 3ROXA 3F78A 1XXHA 3OWXA 1UBHS 1NXXA 5IJAA 4U0KA 3E7DA 1SBNE 3V4VB 3OPYA 3MCWA 1TM5E 3TQQA 3WB0A 2AFIB 4ZA2A 5GGXA 2PT5A 1D0IA 1V8OA 1LWNA 2YFKA 2ZBPA 4MRSA 3J7AR 1S0VA 3ZWMA 3SSNA 2UZ1A 1C41A 4H59A 2WJHA 4JDUA 3C3AA 2HCFA 2A78A 3AIKA 2OTLF 1IHPA 1KE2A 3OI7A 2EP7A 2O20A 3UOWA 1DQNA 2QZ9A 2ZRDA 3FX7A 3V2IA 2LD4A 4P81A 2PXXA 4WPGA 1NMSA 5I7WA 2P1DA 1BRTA 3QJ5A 4BO7A 1F4MA 5EFOA 3A0RB 2IXAA 2N75A 4B43A 4AECA 3HKEA 4KXXA 1B2RA 5FYQA 5DBEX 1SHUX 3CW9A 1VLZA 2WIAA 4EI2A 2FUG6 1NH2D 1DC3A 4ZIRB 5EN4A 3PC6A 1WBJB 4EJFA 5GAPK 3HCCA 2UZIR 3DXFA 1GRRA 1WA8A 1ORHA 3UV6A 1HLFA 3O5AA 4LCBA 2PLWA 3DE0X 4H7KA 3R5TA 2XUAA 2EFGA 3G80A 3RN4A 3K53A 2O2EA 2CEAA 5ITVA 2FRVA 5ES3A 2C7OA 1WNFA 4Q1CA 2DWUA 2J3JA 4UB6Z 3G5UA 1ULTA 4X66O 3C9SA 3CMMA 2UUCO 1SCKA 3WOHA 1BMFG 2B82A 3IKJA 4LY3A 5JAQA 2C2MA 3MHTA 3K1AA 1IUNA 4PC6A 4X90A 1Q3EA 2PO7A 4BV8A 1PGQA 3L6CA 5I7SA 5FNVB 2MIIA 3LH5A 4L6AA 2IW3A 3UMYA 4HQ0A 2FETA 1YZ3A 3AOGA 2PIDA 3DZGA 1ZBDA 2OHHA 2ZCJA 3UOAB 1DAGA 3F2IA 2AMYA 3OD1A 4Z6KA 3RRMA 5K05A 4YAUA 3IRUA 1VQ9V 2CV2A 1XZIA 1FPMA 2CUZA 1G59A 4A26A 2VPQA 3QBDA 2JIDA 1TDJA 4DB4A 3W2FA 4UDXX 1CETA 5D85A 1CUGA 3WLSA 1A5TA 4WFFA 2ZYRA 5TMDA 4O2RA 3M5CA 5F5LA 3R4VA 3RU3A 3M1YA 2HT1A 3AHEA 1FXKC 1V95A 5B5EZ 4EHBA 2QTRA 3V3TA 4BBJA 1E0KA 1W2BF 1J2TA 3VTZA 2WLKA 1RADA 4EZBA 5EC2C 2WSBA 4TTPA 4LFBB 1EFRG 1GM8A 3L41A 3I9MA 3GROA 2XOKG 1U2DA 1D5WA 2ECOA 4M1TA 4BP8A 3F8SA 1I4TD 4WBNA 3I61A 1EU1A 4H6VA 5JADA 1EG7A 2XZLA 4JVLA 3X1WA 4P82A 1P4AA 4WBNF 4B6QA 4MINA 1X94A 3EYWA 3EEIA 3BWXA 5CVJA 5EJIA 4WCVA 1BSVA 1NI8A 3E3AA 3DTVD 3E7PA 2B3TA 1C5KA 5BR4A 2YVAA 2H5JA 1LSOA 4KL1A 2A86A 3TF5A 2C5FA 3MJEA 3JQBA 3DAOA 5KKNB 3PWKA 4INPA 4FUQA 4N6NA 4U7WA 2HVKC 1NVWQ 3WICA 4OAQA 1PJ4A 2IH5A 5K4GA 4JI2O 3SCZA 2BE7A 2OTJV 1R37A 5TQ2B 1GEEA 4UBMA 1QORA 5DNAA 1QR6A 4LWSB 5BYBA 2OXFA 3R74A 3UZUA 2L42A 1JZSA 1X1SA 3UUEA 2R1VA 3WLNA 2PDAA 2AFHE 1UXOA 5EKTA 5AKYA 3V1YA 3N86A 1N2BA 5IBCA 3E9MA 5F64A 4PGGA 4ARAA 4L6CA 4JITA 2AHRA 2J59A 3T1VA 4AULA 1JKMA 4FSHA 3E3MA 3CJRA 4OXKA 1GZ4A 4FQ5A 4L72A 4MVJM 1P39A 1DBQA 5ERGB 1Z0ZA 2PKRA 3UWMA 5C53B 3NBAA 4EJ6A 3PC7A 2E21A 2RB4A 4M89A 1U0OC 2NV6A 4EKNB 1UPAA 1R3JC 1F6BA 2M32A 4EHIA 3UC9A 1RI2A 1GTRA 2MDTA 5DMXA 2CW4A 2LTAA 1PWYE 1FS0G 1NZDA 5A2GA 4QUHA 4H1UA 4PG6A 5L51A 3RF7A 3GYBA 4ZU6X 5AW5A 2IG8A 3LX4A 4MI9A 1QLNA 3BGIA 5BXZA 3WHLA 2KE5A 1DWOA 1YVDA 4V02A 2JS7A 1CUSA 3PA6A 3RBAA 3IC7A 2XE8A 1NBWB 5JSZB 1D04A 2X0JA 3ZLVA 3CVJA 1FXKB 3D5TA 2LGQA 1EKXA 4TKUB 3D8TA 4MS3A 1BOOA 2IUUA 4L0MA 3OF5A 1E2KA 3HKCB 4IGKA 3GQVA 3U7QB 1UDBA 4DV3B 4DKJA 1QLJA 2BMWA 1R0RE 2I3BA 2R8ZA 5DYGA 2B2XA 5EAIA 4ITRC 2HXGA 2WMNB 4AL4A 2CK3D 1P72A 4LZLA 3FYEB 2VNHA 1UIMA 1U6IA 4MPPA 4IF6A 4CL3A 2DOKA 2YJTD 1M7HA 2B1IA 3GLVA 1ZAKA 1Z3CA 4M8IA 1LF5A 4ASUA 1N7HA 4S1WA 4LW8A 4UHBA 3W8FA 5FD8A 3IPAA 2EIMC 5EUBA 5L7WA 1N0NA 4B4KA 2QRJA 3NNNA 3DPSA 3CB2A 1NMYA 3GYGA 2RE8A 1RYHA 4MS2A 2ERXA 3KALA 5EUMA 4MRAA 1UOOA 4YMTA 1NV9A 1X87A 4WEOA 2H8EA 1D7OA 3TQSA 3ML1A 3IQHX 5BURA 4FCTA 4HYEA 4J4TA 4QARA 3NWJA 3L8CA 2FZ5A 3FFTA 1I6LA 4UVDA 4AMVA 3TPFA 2CCGA 4WZAE 1YTUA 4RQTA 5BT8A 1A9ZA 4M0PA 1FU8A 5JHHB 3RUPA 5DNWA 1V6SA 2CZGA 4UAVA 4YT4A 1NSYA 5HKAA 3ENVA 3OUZA 1O95C 2JPDA 5HIJA 3AONB 1AQIA 2C0QA 2XNKA 2JCYA 3Q9NA 5AK5A 1F06A 3M6UA 3AC0A 4QWMA 5TPZA 1YR6A 1YK1A 4Z9XA 2VHUA 3P20A 5CBPA 1EM6A 2CV1A 1DADA 3RA6A 2AVNA 2I1LA 1FYFA 4GZMA 5IT9N 4KGVA 3IGFA 3AWDA 3BKWA 3N7UA 1RHUA 2NUPA 5BUSA 2VHVA 4HWOA 3RS4A 4ZHWA 4LJLA 5E6SA 2LW1A 2J9GA 4EB8A 1LQUA 2Y67A 4FHFA 4F8EA 4D9BA 4X3OA 3C3MA 1F9AA 5CA1B 2BZ0A 2G63A 1JJOA 1S7CA 5KHIA 4X8AA 3ZUGA 3QVSA 2RHRA 3L0YA 1DQSA 4BFXA 4TV9A 1KFBB 1JFVA 4UM8B 2EJCA 2R6DA 4IQGA 1X7XB 3VYTC 2YH2A 4TV9F 4Z3OA 4JGSA 1Y4ZA 4KR0A 2R1TB 5T67A 3KKZA 5BR7A 3AFMA 2OFFA 4N76A 5DGDA 4O4HA 1X8KA 3L8HA 1R12A 2D54A 1E5LA 1NATA 5FTKA 1IOLA 3ZD7A 4L1KA 1UMKA 4MVJH 2JJ1A 4O4HF 3VAYA 3C8MA 2ZUSA 3RRZA 1P0IA 3HNOA 1KGDA 1TCBA 1DUIA 1KJ8A 2PKCA 3PIDA 4C7KA 2QMHA 1YGPA 3VU9A 3OFKA 2JCBA 1CFZA 3HYSA 3GD7A 3GPIA 5AKJA 5KVAA 2Y99A 4XVRA 1Z75A 3Q0TA 4EJ2A 2YJ3A 2R5NA 3IDSA 1F2TA 3FUXA 1XX6A 3CUUA 1WP9A 5B3JA 7AT1A 3N39C 1YULA 4F4HA 2ILTA 1GN9A 3G88A 2QG6A 2NXJA 2CF6A 2VUTA 1Z2CA 2IA5A 3N8KA 4HAYA 3KK0A 3RQIA 3IEPA 3ZNQA 3K0DA 2AYXA 3DV0B 3QV1A 3ABKB 1JR3E 4E2ZA 4S05A 5C3MA 1V0JA 2HW8A 5MGNA 1Q1NA 3TTYA 2PH5A 5HJ2A 4FC7A 4I0XA 1ULBA 3AG1C 2K7ZA 5FOSA 3H42B 4XIYA 2PWPA 5A4MS 4O29A 3EVTA 2ADQB 8LDHA 4IHJF 3RKUA 1YR2A 1HLGA 3K0CA 3KOYA 4D3SA 4K9LA 1AB6A 1P1FA 2Q2QA 4ZJYA 5D3MB 3TJTA 2GAAA 1XEXB 4J3FA 2XHBA 4TTJA 2YN0A 3Q7SA 1XMQO 4CR6A 4ZVUA 1JQLB 4K46A 1E92A 1I3OA 3K2XA 3OC6A 1QB8A 2ZUTA 1QK5A 4UBIA 2ENUA 4RF2A 2QX9A 1K4KA 3SHWA 2YQ5A 1FVXA 1BCRA 1ISFA 1T6ZA 4M83A 7YASA 4OD0A 2BMFA 3K0FA 2I4NA 2VHJA 1UMBB 2Y76A 4ZKIA 4IXWA 4ONEA 5IDWA 4FHDA 1P2VA 2IE0A 2RGEA 3T1TA 2OESA 4C89A 1S7GA 4OA5A 3TRFA 2W2NA 4EATA 1EP3B 4D2IA 5CA0A 2IDKA 2Q6OA 3I01A 3TX2A 1UIRA 4JELA 7REQB 4QO7A 2H7VA 4YPFA 5ECDA 2BH2A 1A50B 2CUNA 2D1SA 4EB6A 3N1UA 2ZE8A 3FYIB 4HPJB 4ZOCA 5CA0F 3BFRA 5KX5B 1M67A 1KK3A 3HCWA 4MV4A 3S2EA 2Q0HA 3E8BA 3N8HA 1NVBA 1EFHA 4MV6A 3LZDA 1PSDA 4N49A 3I1IA 3FKJA 4GBJA 3GRCA 1Z17A 4J0JA 2PL3A 4A2QA 4OIMA 4C0XA 1M93A 4JOSA 1O6ZA 2F9MA 3ZBHA 2I1VB 2JA1A 4BT5A 3SSAA 2QI9F 3MF4A 1T29A 2XMZA 3DDZX 3FMVA 1LK0A 3ZGNA 3GPBA 1YVEI 5DM4A 1Y9EA 1SOMA 4CTJA 1XMOO 4GOXA 1M6HA 4Q9JA 5G4LA 4LKOA 4CDGA 5HXZA 4NESA 5E4FA 3VVLA 2I6SA 1NBMD 2YDXA 3UMSA 4J1QA 3VDQA 1QDEA 1GQOA 4D8WA 5TISZ 2R85A 5B3LA 3TAHA 1A9PA 1EVZA 1XLTC 3VVCA 4LF9B 2ZB4A 3C5CA 4EY6A 5E9JA 1TJ4A 4II3A 4QUKA 2DAPA 1IV2A 1ZR4A 1LTHR 4LOJA 4HFRA 2HV9A 5K8TA 3CCQV 1W5BA 1J1ZA 4WJKB 4UTNA 3ELYA 3HCAA 1ONIA 1YJ9V 1XQYA 3QYFA 3KLNA 1M54A 3VPGA 1IBLO 2B3DA 1BQ3A 1TVEA 3RC8A 1NJ8A 4O3FA 4KDFA 2D8AA 1VQ7V 1Y67A 4K86A 2QXUA 2A0YA 2VP0A 4G25A 2WJIA 5CYFA 1T9ZA 4QM7A 2SKDA 5KOHB 3OOYA 3UAGA 2O05A 4M98A 3JS5A 5CEEA 1ZJ4A 3B9BA 3WQQA 1GG2A 2EATA 4ZZIA 3MDOA 3FYHA 5FBHA 1GUZA 4QVKA 4C01A 3LM8A 1H47A 4IUCS 4QL3A 1PR6A 3AY6A 3Q0EA 2IZ5A 5KCMA 4Q3AA 1LEHA 2J7PA 3GXBA 2WHRA 2HLDA 3REOA 3OA2A 3EEOA 3TD2A 1E3QA 3V1NA 2WILA 4NYJQ 2OLEA 3VTIC 2IL1A 1YJCA 3QKRA 3AZPA 4NCIA 5BQ3A 4Z0NA 2WNHA 4RPJA 4PLVA 3B7GA 4B79A 5KSWB 3SKXA 3OJEA 4DG8A 3UA3A 3WG7C 3QE3A 5K0JA 3VJMA 1NHGA 2J0UB 3CJHB 3JXEA 2BGIA 4D9GA 3ZY6A 3E48A 2P9TA 1QIHA 4CFSA 1DEOA 1K27A 2I9PA 1HL7A 3CRNA 1FMFA 1LPPA 1BDBA 2XF2A 3M34A 2YRFA 2BEVB 3JSLA 4H60A 5EIEA 3G0GA 3TLJA 5IKEA 1A9XA 5HP8A 4YRNA 1QE3A 2A33A 4MRVA 3ZRWB 1WZEA 4RZXA 5AI8A 1E4EB 3ORQA 4J03A 2I7XA 2FW1A 2VSXA 3E2PA 3URKA 5IVDA 3N76A 4J76A 4B31A 3ZGZA 3LUTB 1PQWA 3A4IA 4BKPA 4INJA 1N2HA 2E1PA 3F6MA 3AKZA 2BE9A 4AG3A 3FW1A 2F9FA 1V11A 1OPRA 5K0SA 1J0BA 4MKFA 1RABA 3PX2A 4ZYXA 5CYOA 1RBYA 3QNWA 1DC5A 4BLWA 2BEWA 2Z8XA 2WUVA 2A1TS 4ZVSA 3PQEA 5U4XA 3QEOA 4BGIA 4HADA 1EA7A 2QKCA 5BWMA 3QWAA 4HXYA 2TYSB 2C4HA 2VJKA 2GLZA 2ZJ3A 5LWQA 2KG7B 1GN3A 2JIPA 2UU9B 2BIFA 2WLMA 2O50A 5IT4A 2CCKA 2VBIA 3J81k 4YQEA 3ROKA 3MQ2A 1EFUA 2IYXA 3LY8A 4QQNA 4XQEA 3NTOA 5A7GA 2QEXV 3OCXA 4JENA 3QKWA 1CP2A 3BL6A 2P9YA 1L4FA 3QEMB 2HGSA 5KAFZ 4Z0HO 3AUKA 5C32A 2QM4A 2Z0MA 3W3AH 4C4XA 3D8NA 2G36A 4CS2A 1KMHA 4QUBA 1JLLB 3PNKA 3CR3C 4C0JA 1R0ZA 3BTOA 2P9CA 1JECA 1VP3A 2P06A 2F1MA 4U2CA 4F21A 3VYSB 1TK2A 3KEGA 3L82B 1XN1A 2O9JA 4HBZA 4ZVMA 4Q7KA 2FR8A 3MWDA 4IGEA 2R3SA 4PHHA 2ZWMA 1UPGA 4DKXA 3KL2A 1F0PA 4FBLA 2Q2OA 4O2LA 2G1JA 2X9NA 4EMBA 1AQJA 2LO1A 1POXA 3WK6A 1Z2AA 5IJXA 5EA2A 3PHHA 1E2JA 4OM7A 3CPWU 1TGOA 4CMHA 1P84F 2GZDA 4XM2A 1Z2NX 4YUAA 1L4UA 1HDEA 2QWQB 1N5IA 1DL5A 3WL6A 4BEVA 4BTLA 3NAQA 4UFOA 4MTFA 3EXIA 4F5YA 3AKEA 4ZEWA 3TSAA 1CUBA 1OX5A 3NOXA 1XTVA 1QWSA 5BR8O 2Q28A 3DMNA 2H7XA 4OX9O 3E0QA 2GNAA 1MC4A 1ZHFA 2W0XA 5KNCD 3C87A 3ZJVA 4DBZA 2NNUA 4CT5A 2B4YA 1Q0ZA 2QGFA 1WMFA 3OY7A 3A3YA 3T5BA 4UULA 3Q5GA 5KOIA 2CNLA 3T8YA 5FRDA 4AY4A 4L50A 2QTFA 1BMFD 4EUHA 1O2DA 1EJ0A 1GL7A 4FYVA 4L4XA 4OHKA 2W4MA 1HYEA 3LHFA 4WZBB 3ZLUA 5CK4A 3N28A 3T9CA 4Z54A 5I4KA 4JEHA 5EGSA 2Q8QA 3RRNA 1V1RB 3L9XA 1BQ0A 4J4BA 1TW3A 5C8VA 1A2KC 1K5PA 1M0EA 4JYAB 1K4CC 2HLPA 2DQ4A 4EGSA 3BPSA 3AF6A 2Y0EA 3F6CA 2A5GA 2DPLA 4HGNA 1NXWA 2ORED 1XBLA 3QLUC 1DAEA 5CH8A 5G4VC 2Q49A 2P69A 1P9LA 4CM4B 3C7TA 4Z1VA 4AO6A 2PJDA 2AW3A 2RSLA 4ZZ3A 1AKWA 4KDRA 3RVPA 2ZVYA 4LV8B 3H1PA 4ZVNA 1KMIY 1T0IA 1K8AH 2B34A 4P4SB 2VK4A 2LDXA 3MPUA 4KNYA 3AKDA 2WA3A 4DLTA 3AUXA 1G21A 1FX1A 4KKXB 4C3ZA 2AYYA 1JDJA 2QUKA 4B0PA 3AINA 3N59A 1WXFA 2G1KA 4O63O 3I6YA 3RWMB 4IMJB 4MUJA 1JPNA 3N7AA 4RVCA 1L8DA 1AQYA 2P9EA 1EFRD 2QAGA 3D8BA 2XOKD 5G41A 2BE3A 1A5ZA 1S3IA 1E6MA 4M8KA 3UJHA 3GG2A 4HLCA 4RD0A 4LQLA 3Q6NA 4YRAA 4U7GA 2O8EB 2I91A 3DGFC 3IP5A 4JL6A 1RXVA 1EJBA 1NT2A 1YI2F 1EHYA 4DV0O 1KVQA 3CNLA 3FVRA 4L08A 4IEFB 1PBTA 3IQIX 4MP3A 3RC2A 1OFHA 3ZDZB 5ITWA 2WIKA 4A1FA 1N6IA 1NX6A 4MMZB 4ZEVA 1IJKA 4P3KA 2QTLA 2IDZA 2EWWA 2WJWA 1E79G 3LBYA 5CK5A 1XP5A 3QW4B 4U8HA 1VL8A 2OCKA 3PQ8A 1NXVA 5JJNB 4D4KA 2HRDA 3IT3A 1KS9A 1OWPA 5JZVA 1T2NA 5GP1A 5KQMA 4OM8A 2C54A 4G24A 2O59A 1OLOA 3TOCA 3RRFA 1S2NA 1Q90D 3RSGA 5DVZA 2X0RA 3R3SA 4BIMA 3COPA 3P97A 4C5CA 3EFFK 4MV7A 3K5IA 4W4TA 3OGCC 2BMAA 3WI7A 2KX7A 3ZZNA 5FEMA 3QTCA 1NGSA 3CUTA 5A5VA 3DZFA 1G1MA 3JCMM 1PL7A 4Q9LA 4DT1B 2FUCA 3B8EA 3DULA 5BPHA 1TU0A 5FJJA 2ZBVA 2ZW9A 1AXEA 4G0OA 3ZRSA 3PICA 1RYMA 4TT3G 2XUQA 3P2EA 3R9IA 3IOMA 4DIFA 1OCZB 1ELOA 1Q22A 2PHNA 2HFJA 2NV0A 1NF3A 1W4RA 2AR9A 3COWA 1GAQA 4ZAYA 2DB3A 3CEIA 2V7QA 5K03A 4E6PA 2GK4A 3NUQA 1G20B 2PU7A 2INGX 2NAFA 3IBFA 1ZM2A 2EKBA 1DEHA 4EO9A 3BRQA 1MDBA 3KETA 5DO9A 4ZD6A 5K3AA 4X6XA 2Y48A 2AJTA 1EYZA 5ELLA 1THGA 2ODMA 4RXUA 5A71A 1VJTA 3IUYA 5B58C 2BBTA 4EYQA 4J2TA 4KGXA 3REGA 5BOSA 3KZOA 1G8FA 2HQRA 3TE6A 2WA1A 4MR9B 1DT9A 1KIAA 4PLPA 1YDWA 2QF7A 1HDYA 4MTCA 2O2ZA 1TYCA 2XAHA 3BGWA 4QUJA 4U6NA 2OKGA 5HXUA 4JQYA 2P6YA 5TF4A 4P8RA 4YMIA 4RSMA 2FAXA 3EPKA 3A14A 2RHBA 3FRIA 4TWZA 1PF7E 2UZ3A 1HX7A 4FFMA 3UG7A 1ENZA 5JWPA 3ONNA 4H3VA 1W6RA 2QRHA 1UPXA 3D6HA 4BZWA 1SXJE 2J9ZB 2BKXA 4KPUB 4I1IA 3FSGD 1VHQA 3N2NA 4ZGWA 4RY9A 4ZCTA 1QUEA 2Z2JA 2JGRA 1U96A 1D2AA 4AJOA 4PHGA 4TWBA 5FA8A 2E5LB 1P17A 4CKBB 5JHGB 3SHOA 1V6AA 5CB8A 3HB5X 4PC3A 1WDLA 5ICCA 3D8UA 621PA 2M6SA 4HZ3A 2I4TA 5TF0A 1FQJA 4Q1BA 1O0BA 2GT1A 4AZVA 2Q2WA 2WUWE 2Q5EA 1NW3A 1RKVA 2UYOA 5B30A 2Y4TA 5D2CA 4BFYA 5K3EA 1UQTA 3I9FA 1VE1A 1SOAA 5IDYA 3QXCA 4MVXA 2RAPA 2GR9A 1NC3A 4WNYA 5ALUA 4J90A 1VL6A 4HUQB 1QJ4A 2H31A 5DB4A 4HDQB 3SSOA 3ZVRA 4DLSA 3IP1A 1OV6A 4W5RA 5LGTA 3CE2A 1W73A 3PKZA 1OCOB 2ISQA 5F98A 2P9QA 1E3MA 1A2OA 4RHUA 1ZH2A 3I3FA 4AMYA 1AGNA 1R8QA 4MVJF 4WXRA 5JSHA 4F45A 1U3WA 4YJGA 3TS1A 4GKAA 4IKEA 4NYMR 4QSMA 5LMZA 3KSZO 1KNJA 1W41A 3CQ9A 3LK7A 3HS3A 3I01M 5HFNA 3IUSA 4OQYA 4HXEB 2QN9A 1KF0A 4HAVA 4CCSA 4P6VF 1V54C 3TBKA 2B69A 2GJ4A 1TA4A 3HHEA 2BUBA 1A72A 3IUMA 4XDGA 3I92A 3PUWA 3IAYA 1U1GA 3NP7A 2QSJA 3ON1A 1ZH8A 4FQ8A 3BM5A 3LLSA 3STLC 1LUAA 1HM5A 1WRBA 4GPIB 1E1NA 4CF6A 4MQLA 4F9FA 1YOVB 1CJTC 4MWDA 1PV2A 1U9YA 3IEXA 4NJMA 5I3ZA 1Z0SA 4EW2A 3GGOA 1LLUA 2YJZA 3U3RA 4UDYX 3SOPA 1TQ8A 3MJTA 2M6LA 3WGLA 5B2EA 4C04A 4DG5A 4YY3O 3QXHA 4QU9A 3K15A 4BVKA 4QVIA 5FEUA 2XF8A 2PMFA 3S29A 4IKPA 3JQ6A 1KU9A 1Z88A 2WE7A 2NTEA 4BW0B 4BNWA 2YW9A 1JLHA 2J5BA 4B7EA 3VR4D 2JLAA 3SS7X 1E7QA 4G26A 3MOIA 4DILA 1F4VA 2NVOA 2ARHA 3CPQA 4GP9A 1FZQA 2F9LA 1ZNQO 4BBAA 3CX8A 1QTNA 3SZMA 4YFVA 3K5NA 2HADA 1YR9A 2VXOA 4LOLA 2TMGA 3A1CA 3E9QA 1HDOA 4H1WA 5GTHZ 1FDTA 4G63A 3WBJA 1F5SA 4UVCA 3IE1A 3KB6A 4WLEA 5CTAA 5EJ4A 5FWNA 1J2EA 2WG1A 1EUZA 2IX9A 3GRRA 4JD5A 2VO1A 2BOVA 3X1MA 2EFCB 4RO0A 4NJEA 2EKLA 3AF5A 4CQLB 1N2JA 3DD5A 3ER6A 2ZIMA 2JC3A 3LQ1A 2O52A 3M4JA 2O5CA 4NC9A 5B1HA 5HW0A 4EFMA 3RI3A 1FE8A 4KG7A 1O95D 1WP8A 4YO8A 4OKSA 4QJ4A 4Q21A 2YIMA 3DZHA 3MJ4A 2AXEA 5CLLA 5TPWA 4BKMA 1YCGA 2NU9A 3EGWA 4DB2A 1A8SA 3Q8LA 4D43A 3IL2A 1RPJA 1T10A 2QQGA 3ITDA 3QTYA 3ZN1A 4HNQA 1B74A 3B5JA 3DBLA 1IC6A 1LK5A 5EQTA 5A6SA 1QG4A 1XRMA 4JIGA 3JD1A 4F04A 2BGMA 1PYDA 2IYZA 2QWRB 1TPYA 5TVKA 5EBLC 3A1EA 3KZ1E 1XNHA 2IYEA 3VR0A 1R7RA 4PC1A 1X3SA 2NO5A 3MMPA 3ORSA 5JISA 3CD6F 2BI8A 5L7TA 1KAGA 2HDOA 3ZGLA 1DPGA 2Y4UA 4LF5B 5EE3A 2PX8A 3MCAA 3DCIA 2D5LA 3FLMA 5L3VA 2XT9A 2ECKA 4FX5A 3CZ9A 3F4KA 4W5TA 3PVSA 3SMQA 2EZPA 5AHKA 5IUKC 1ZZGA 1EHIA 2UXCB 1DCKA 3WRWA 3DMTC 2P67A 4PYLA 3MJFA 4A2WA 3KJQA 2W43A 1D1PA 2ONZA 3BSYA 1BDHA 1V3VA 1TJ3A 2PQMA 2C95A 4FJ1A 4Y9TA 1PK9A 1KZ4A 1H65A 1OFUX 4PAWA 3CH4B 5FT9A 2JGDA 3B1JA 3AEKA 1WEHA 1M6VB 1L8QA 1PI3A 2JLBA 4XUDA 5BN4B 2Z95A 1GT91 2HU2A 3ABMC 5IJWA 2QW0X 5ADWA 3DT9A 3UBMA 3JR7A 4DJEC 4Q1FA 1PNTA 4FMPA 4AMGA 1S9HA 4LX8A 3P9RA 5DZSA 3T3PB 1EBOA 4YAKA 2DR0A 4DYVA 5LD2C 5IJ9B 2CJFA 1U97A 1CQWA 4UUMA 5KTNA 1Z7WA 4ZT5A 4HVCA 3A0BZ 3M89A 5GW7A 3HM2A 2BFPA 4PRZA 1L8AA 2CDCA 3AF4A 4URVR 4PG8A 2CXRA 2TMYA 4CL2A 4PCLA 3PNSA 2BFWA 5JAMA 2D00A 2RGNA 2HR3A 5IRCD 3FB4A 1N8SA 1NXOA 4N23A 1GGFA 2FMHA 6Q21A 2JFUA 2N1MA 1UK7A 3KJFA 3UWSA 2QA5A 5JALA 4QTUB 4H44B 2VDOB 1VIMA 1Y8RB 5T7BA 3WLEA 4WQMA 5J3JA 3IOCA 1SU4A 2NSLA 2OAP1 3AUAA 5ALPA 2Q7HA 5KLVH 1LV7A 1EK1A 3CRMA 2ZB8A 4RYDA 1P74A 1Q11A 6CHYA 2C9OA 3VZPA 1E5VA 3LVRE 1JLSA 1UM8A 4NBSA 2NG1A 1LSJA 2X1MA 3TQOA 1F8XA 4TMWA 2VYFA 3UCFA 2QTMA 1J9ZA 1T0HB 3HKDA 3A4NA 4INAA 1O03A 2WFMA 1K66A 3K79A 3R7WB 3IB6A 1O6CA 3UHFA 4HPXB 2OIEA 2PGXA 3AGKA 1F2DA 4LDNA 1MOZA 3D64A 4DZRA 4N65A 5IE9A 2HWXA 4G5HA 3RU2A 3VR6D 1BAPA 4FGSA 1GAEO 1EXNA 4PYRA 4IP0A 3WBBA 2O8BA 1XMVA 1ZMRA 4KU4A 3EIWA 4QUGA 2H1LA 3LUAA 3QTBA 3BCUA 3RDPA 2EEZA 1Q77A 1NMXA 1VL0A 4EEKA 1VE3A 3ELWA 2HQ1A 2IZ6A 2QM7A 2JIQA 2A9KA 4ALNA 4UVAA 1GPAA 1RHKA 1XZJA 3HH8A 1T24A 4GU5A 1J9EA 3H5WA 3GP5A 4QYXA 3PKJA 5EEHA 1JP7A 4M54A 4EYGA 5KYNA 1NHWA 3CX3A 5A7HA 3FFQA 4LRXA 3N6VA 4XB2A 3QM1A 4BIIA 1GGNA 1YUBA 5IY5B 4BGDA 5ES4B 1OUMA 4MUEA 3P9PA 3HXTA 1Q82W 3GNLA 4CIAA 5BV8A 1V9PA 3FMOB 3ZCXA 3ZEAA 1MABA 4JGIA 1WP7A 4KSBA 2W4QA 4GBMA 4KIFA 3VH2A 1D9XA 4ZQFA 4FFKA 2XVAA 4RZHA 1WV0A 2GXSA 2G70A 5H0IA 4C0SA 3L8FA 1N9ZA 2DH6A 2VHCA 2ZZKA 2RBGA 4HD8A 1IXMA 1Y7LA 1EX1A 4RTPA 4IWYA 4MR7A 1U1FA 2E2WA 3Q41A 3QUWA 1AZLA 1HL3A 4RCZA 2ZOSA 1U3TA 4JT4A 3D5EA 1BJTA 2C59A 1LX6A 4ZKDA 3KE9A 2G71A 1Z37A 4XPIB 2O3QA 1Y98A 4BDTA 5GGYA 4P53A 4HB0A 1HGXA 2LKDA 1HETA 1FJGB 4M22A 3WMEA 3UMRA 3NDBB 2VAPA 3WAGA 1ZN9A 3HO1A 2PX6A 4QVGA 1XTUA 4AM8A 2WWXA 2OCLA 3OZTA 3AEYA 2WJJA 3D6NB 2H4XA 1BXRB 3JD0A 1T6BY 4LYEA 5JJEB 4DARA 2EWCA 4BO1A 1X86B 4OKNA 5LC1A 4QA9A 1ZRNA 3HRIA 2OV6A 3R0QA 1YB1A 4QPDA 3R40A 2J7KA 2YXPX 3G6EV 1QV7A 4OREX 3DNFA 3DJFA 1JWAB 2OM6A 2AEJA 2PO5A 3LXMA 4CM3A 2ITCC 1G5FA 4NU8X 5JY1A 1LI4A 1SJ9A 1EDZA 4O6VA 2GD6A 3HMQA 3LL7A 3D4NA 4GMDA 4H17A 1WXXA 2GAJA 2J41A 3CCBA 2X8JA 2JHFA 1LW7A 2IXFA 4KL8S 3WGGA 4LJ7A 1IZZA 1RTTA 5DNVA 3OY2A 1OJ7A 1E9VA 1Q43A 4I7ZB 1G3UA 3JWHA 3QOFA 3KKYA 1GITA 1E1CB 3HA5A 1I0HA 1NVUQ 3T5MA 4U2BA 4L78A 3REQA 4B84A 3RC7A 2XB4A 1KD1W 4IHQA 1ESNA 2RMKA 3M2PA 2ATXA 4I8XA 4UMDA 2AEFA 3C97A 5H5NA 1AT1A 2BM1A 2IELA 1S02A 1E58A 2XD9A 4MYDA 2FPGB 1IQUA 2G0NA 3TFQA 1H42A 3RVMA 4F2DA 2X9QA 2PZFA 1HNZB 1HDXA 3EMKA 2OFOA 5LYJA 3H3JA 4EG4A 5BQ5A 3K1YA 1JSLA 4U9IS 4LV5B 4UOZA 1YS4A 3A1FA 3BRCA 3HLKA 4IEEA 1V45E 1XU4A 5LYJF 1T2AA 3PRKE 3PJDA 2NADA 3MJDA 1LW6E 3FTNA 1FF9A 1Q19A 1E94E 5E1DA 3U9LA 4Q3BA 4D0LB 1QK4A 4XGNA 1USUA 2DTDA 4PA3A 3PNOA 2ECQA 2WUDA 3BZWA 2C1EA 3PT9A 5KTYA 1N33O 3A7DA 2ATVA 3WJPA 2PQ0A 4Z9YA 1MIHA 3DMYA 1Y4AE 2VZ0A 4IMIB 4AWXA 1I2AA 3LTNC 5F5XA 2JLYA 4DIOA 2XBUA 2ZLBA 1H4VB 3WQHA 5I7HA 2BHSA 1FLDA 1HDJA 5JLAA 3IC9A 3TD4A 1EVYA 1NZFA 1V9LA 1XCBA 4DXDA 5KU1A 2P2NA 3LDUA 1JHVA 2WY2D 2FSVC 3GIWA 1SEVA 4GOMD 2VNAA 4GG1A 1E79D 4P9OA 4Y1RA 1IU9A 4IG9A 1FW6A 2HA0A 3G9QA 1KI3A 3WYNA 2X9LA 4X65B 1AF4A 2R8PA 3T4PA 4JBLA 3MVEA 2J5QA 3R9KA 3UMVA 4YV2A 3WK9A 4U7HA 2DWOA 1D6MA 2KG4A 2YXBA 1DQYA 2DH5A 4UBNA 1INLA 3BDVA 4KR3A 3M83A 1M3SA 2JAPA 1K5GA 2A06H 5JDCA 2ZYAA 3PSAA 3TEMA 4RWUA 5EMHA 4B4UA 3FMFA 1V5WA 5F1YA 3MMSA 4RAOA 2ET6A 1T5BA 3EVFA 4MICA 5CDGA 2ZI4A 1FB5A 3BWBA 3ZP4A 5F77A 3K1TA 2FUKA 4RD4A 5I45A 3U7EB 4FHGA 2RARA 1X14A 1G8AA 2JI7A 1YB7A 4LYJA 1ORVA 3FPHA 4WESB 2CXPA 5BN3A 4PVDA 5CGQB 2J3QA 4K0RA 1RWPA 4YR9A 1P75A 3PXUA 5EJ5A 1J8VA 3TZLA 3I5XA 5JS7A 4LXIA 1VDMA 3R7NA 2O19A 2HDHA 1RXUA 3EORA 3IKVA 1KKUA 3CFYA 1HT1E 2CMHA 1IIRA 4EW1A 4QE9A 1VECA 5A4DA 2ZETA 4IIFA 1BA2A 3OHMA 3TW0A 3PDIA 2XGOA 2P27A 5EQDA 4HJRA 1N1MA 4MS4A 1KZ7B 3DXRB 1JFFB 3LQRA 3SI7A 2JJ2A 2FWRA 3UV3A 4MJ7A 3BHJA 3D4LA 1KP9A 4RFSB 3IFSA 4I5SA 3P0HA 4GOKA 4RBNA 1WU8A 2VK2A 3WLJA 5C1IA 1FP6A 2WBLC 3EGEA 2NSDA 4IXNA 4PFSA 4CF4A 1SXHA 3KZMA 4KXNA 4OBBA 4D9MA 2JLWA 1LSUA 3APOA 2V3VA 3PLRA 1OJHA 4W82A 4DR5O 1W5SA 1ES9A 1KQPA 2FP4A 4GMFA 1BC5A 4DNOA 1E5TA 3OR6C 3HCOA 2CJWA 1XBTA 1CUVA 2HLHA 1JU9A 2R8RA 3ZLTA 2XJ9A 1BE0A 4TTQA 2F4VB 5FUVA 4W9MC 5IAEA 2FMUA 4X41A 2MYUA 3TUJC 4JT8A 4IWXA 1XTSA 3B9QA 3FNGA 3PLNA 3ABKC 1RWMA 4KNWA 4QEKA 1SKMA 4J0HA 1ILWA 2O2CA 4D6TH 3A1DA 1B93A 2QU7A 2QR2A 5K3DA 1MCZA 3L2OB 2G08A 5BV7A 4MO9A 3H83A 5E95A 4L9RA 3F6SA 5DI9A 1T2VA 2YUAA 3TXSA 2ODEA 4E3ZA 5C1DA 4MMYB 8ADHA 1ZSYA 3PXGA 1JMKC 1SC9A 3OIWA 4Y30A 2Q41A 1CUDA 4HEA1 4R0NA 5EOVA 2OQVA 4P3XA 1KJWA 4HQKA 4JBYA 3CVYA 2MSCB 4DIUA 2FRDC 1PGNA 4YAGA 2XOEA 5HJ7A 4RUFA 1RHMA 1IMOA 1JIVA 4HN4B 1K8RA 3KHKA 2OZLB 3ZP7A 4OHPA 1ZJYA 3SC4A 2Q7GA 2PI5A 3GXOA 2JKVA 1G17A 3FPLA 1R3IC 4LDAA 4KBYA 1MJNA 3SFZA 1IM5A 3A6DA 2GN4A 2PMEA 1E7RA 2CVFA 3S7ZA 2IEDA 2ZS9A 3EK2A 1AZWA 1UBNA 5CFOA 4LYGA 2XXJA 4DLLA 2H2DA 1SN7A 1GGJA 4RY0A 5HF8A 1Z7GA 2UZ0A 3QLJA 4KV7A 2B9EA 5AKEA 1XXHB 3R65A 1XZPA 4UB8Z 4BKQA 1NVPB 5KNBA 1JEYA 1DKRA 5KC9A 4TROA 3LDTA 5CVDA 1K6MA 3FYDA 2BFDB 1QGYA 5EJ7A 3RUCA 1AILA 4GWGA 4J43A 2X8LA 4UD6A 1ZL2A 3I4CA 4P36A 2B30A 1N1EA 2XZTA 3CCMV 4XEUA 4BNVA 2UZ1B 1F7VA 3AVOA 3PPYA 1KYZA 1HDGO 3VHRA 4BO5A 1URPA 3U56A 3EDQA 1QM5A 3JPYA 3SM9A 1XJQA 6ABPA 4ZDWA 3K0KA 4RGBA 4D4LA 2VP4A 2VR1A 4GYWA 1ZI8A 2Z57A 2ZVZA 4MKGA 2QMQA 4LF7O 2B61A 3L5KA 2ZB3A 2AKEA 1R9NA 4DJAA 3HKEB 2EW2A 1IOVA 1RCTE 4FNOA 3RJZA 3UWPA 4EPYA 2P6MA 3OJ0A 3M4YA 3BMNB 1DTOA 4RVGA 4X61A 2QJWA 2QIOA 4KWIA 4PZLA 2QDKA 4DV6O 2H1IA 3BWMA 1T4BA 2ADOA 4AZTA 1WA8B 1AR5A 3GLHB 3VMMA 1U7DA 3HUEA 2HNBA 1YHYA 3QVGB 3CVOA 3O3NB 1XD8A 1I7DA 1Y63A 5AI5A 3SX2A 3ZY2A 3SFTA 3TUZC 3DT6A 4OSEA 5DBIA 2SKCA 3Q9SA 3UKDA 3HJGA 3KC2A 4UHJA 2F3SA 2OZEA 3C3JA 1NFFA 1MUUA 1IDN1 1XNQB 3K1AB 3M5WA 1XK6A 1VLMA 1AHNA 2HI0A 2R79A 2F4NA 3JVUA 4I66A 1BHQ1 4NYKA 2Q50A 1EFPA 1VJ0A 3G9TA 2DBVO 4O08A 2NU7A 1RWXA 4H37A 2MHCA 4WINA 4BNKA 3RSZA 4EITA 2Q3DA 3ZOPA 3B6ZA 4X8LA 4B6OA 3I4LA 4E1VA 3EBOA 5AM1A 3FE2A 1WPGA 3HEBA 4IFIA 4DYLA 4L7VA 4ZZ1A 2ZAOA 3DL0A 1JPXA 2BRUA 3TRIA 2YXLA 3ZS9A 3OKAA 3MRSA 2JCSA 2O0MA 2EQBA 1ABEA 1UZNA 521PA 1VE7A 2PH3A 3K6KA 1NONA 5IFLA 4CETA 2C03A 5EUCA 3FYSA 3MUOA 2GTSA 3OX2A 4H3SA 1Q83A 2XDWA 3D6MA 4X3PA 4QE3A 3WGUA 1EAMA 4DQUA 3GT7A 1PFYA 1R3UA 1YIOA 1CUXA 1YKGA 5FOVA 2NVUA 3TBHA 2FL4A 2W48A 3OOJA 1DWPA 2QMZA 2QEQA 1JKIA 4CVNA 1NYLA 3RUIA 1S8OA 3LDEA 5DLYA 4IHKA 4WBNB 2JIBA 2X40A 2IP1A 1XTZA 4ZK7A 2QHXA 1N5KA 2BGNA 2ZTLA 5ABPA 2KLBA 4QYIA 3PFHA 3QEAZ 1XVLA 4PX9A 2C57A 2EDAA 5DEIA 5BUQA 1Y6QA 1ZVKA 1Z5PA 3WL3A 1OWNA 5CDHA 1RVDA 4X91A 3FB5C 4JQSA 4MWEA 5K0ZA 1KYIA 4PQFA 5DTMA 4ZDJA 3NOVA 1ORIA 4LCEA 4L5YA 4JL8A 1NQUA 4KOEC 3EA0A 2ORVA 1EE2A 1UKVY 1YRHA 1RP3B 1XU7A 1VQKV 2JKYA 3QY9A 1C7EA 1HT3A 1MX3A 5DH9A 3I32A 3AL3A 3N87A 4Y98A 4NB5A 1EBBA 4WK2B 3ANYB 1GPH1 3AR7A 1JL3A 2F8TA 2Y6UA 4A5SA 4PNEA 3HU2A 5AM4A 3F5WC 2D2XA 2Y93A 4WW0A 3MJSA 1YIDA 4LYFA 1TAEA 2VJCA 1FRZA 1SM4A 4GWLA 4NXNB 1YQQA 1DBPA 5I6DA 2QTVA 1JEQB 4YA6A 4XCXA 1JZQA 1VMIA 2D8MA 3HR7A 3OPQA 4ETIA 3AV3A 2QZJA 3MAJA 2XLCA 4HS9A 3JVVA 4XLZA 4K9NA 3VYSC 2PU5A 3WPWA 2X6BA 2CGOA 1JDVA 1FU7A 4LUCA 4LGYA 4YI5A 2DF8A 2J5RA 1QHNA 2DUJA 1O6GA 5IWCA 4POOA 3V8QA 4JT9A 4DAOA 2BMEA 2B7BA 3G5TA 3T95A 4L3OA 2NNWB 4P5EA 4YRSA 3TE7A 1YI0A 3IAAA 4EW3A 4Q6BA 2L26A 5H9VA 4L02A 4WA7A 1ILEA 1XVVA 3X3HA 2DETA 1R5NA 3HA2A 4C88A 5L3ZA 4MS3B 1COZA 1WZIA 2ID8A 3AG4C 1JDTA 4JH0A 2GPTA 3J81A 1KFJB 3HSKA 4R8RA 3BC1A 3GT4A 3RWBA 2UXDO 1E9EA 3N2ZB 4LNUA 4IXMA 1FLAA 4G4SO 1LLDA 2GCIA 1NBEA 1OZ0A 3M1XA 1QX4A 2VJAA 2DKOA 3G9XA 2PV7A 4MVJP 3KQWA 4R8CA 4PCVA 5A05A 1SPBS 4QXOA 4V2UA 4M49A 4BNXA 1H4SA 2ZRMA 3AHGA 1S5HC 3HFSA 2LUOA 3AMVA 3E7FA 4LEIA 3A06A 1YKFA 4E5UA 2QA4F 2IZOA 2VPWA 2QSUA 1U3PA 2ZRBA 4BP3A 2P9BA 3T3MB 1F0KA 4DK1A 3FBGA 4BGEA 3QEKA 2NXNA 1HYHA 1RZVA 3SJBA 4I4CA 2VVTA 4OLFA 4O1HA 2UXXA 3S03A 3CZAA 1I14A 3HACA 4TKLA 1A2QA 5BQOA 1OX6A 1YACA 1E0SA 4N0QA 2OTCA 2OXRA 1L1QA 1K2WA 3Q15C 3LVQE 5TNXA 4TXNA 4ZALA 4GX5A 1ADYA 3P9CA 4FSDA 4X5OA 3AHIA 3DBRB 3ANMA 2ZUDA 4DHWA 4LBYA 1NNLA 1VBNA 4Z4CA 2YS8A 3RFCA 1OXVA 4WCEV 4UNQA 5THQA 1L7PA 4LJ8A 4N3CA 3OIUA 1VRWA 4CTMA 1H93A 3BX1A 3GDHA 4ZCPA 4NCJA 5CBPB 3DGEC 3BWVA 4EA7A 2HJSA 3VSAA 5DK4A 4K2HA 4PG7A 4CIYA 1X7PA 2PMBA 3DEKA 1COWG 5JPCA 4HS4A 4ZI7A 1U0JA 1GPUA 3K57A 4AJIA 3EG9A 3ANSA 2C2ZA 4R8VA 2NUPB 3E58A 1IXKA 1NRWA 4J0IA 3STWA 3BWYA 3LSSA 4TMKA 5F9FA 3DDNA 4ZI7F 2YS7A 1JUDA 4FFNA 3FB1A 1QFJA 9GPBA 2K6GA 2NPIA 1D0SA 3QWFA 2PGNA 4RK5A 4H7EA 4U7PB 3CLRD 4KODA 3TEFA 4FIPC 3B70A 3U09A 3NGMA 3OCJA 4CFYA 3UHAA 3SY8A 3UATA 4XQ9A 4YVFA 4TV9B 3WYDA 5JJ5A 3R0ZA 3E70C 2FWNA 3AG4B 3QPCA 3K5WA 3EFEA 2A0XA 3L74H 4AF7A 2IIPA 1EVJA 1VIVA 3DZ8A 1U5BA 3WQBA 4OMFG 3WO0A 1BYUA 2RH8A 5TC4A 2FQWA 4LBZA 3N6XA 4KWCA 2AQIA 3AR5A 4O4HB 2OGUA 2OGTA 1NM5A 1OBVA 2ZJ1A 5IZCA 1J6UA 2M1ZA 3LDCA 5DYNA 3PQ4A 1OCZC 1VB5A 1G2IA 3L4BA 2XTNA 3ZLJA 4BAGA 5EY5B 1NKDA 1V37A 3VU9B 3RK0A 1GNPA 3FYUA 3IR6A 4MB0A 4HAMA 2WTBA 5ALYA 4E15A 2ZD9A 1JHAA 1RXWA 1TM4E 3R5XA 2D5CA 2V0CA 8GPBA 5CYGA 4GCZA 1MAUA 3BQ9A 1RLGA 1T8YA 3NM5A 4M0LA 2PI4A 3RC9A 2IOFK 5G1OA 1PEKE 3D4OA 5U4QA 3QA9A 3U61B 5IMBA 1LDBA 2ZWIA 1M2FA 3U4IA 5KVCA 2VHZA 4L5AA 2OORC 4P3OA 2REQA 1E96A 3QX8A 4DS3A 3I5UA 4JI0O 3LY7A 4LDRA 5BT9A 1R1MA 3F5FA 2FF5A 4CMIA 4WGFA 1Y42X 2JVDA 2P5YA 3B13B 1QIGA 4OAPA 4MEAA 3VPAA 3EZ6A 2HA4A 4LVNA 1CDDA 4ECEA 2AR7A 2QVLA 4IHJB 1E8NA 4P30A 3OONA 4XZ3A 1LQ2A 1NOKA 2P4VA 1T0JB 1DAHA 4PSKA 3N07A 3CUWA 3V8NA 1X7ZA 1X3LA 5AK6A 3BK1A 2VEOA 2WSSG 1N7JA 3DE6X 1A9OA 2DPXA 3MJRA 2HX0A 1VQNV 2J9XB 2VTKA 4KFUA 2QE7A 4G28B 1X42A 4W7IA 3UGTA 4RH1A 2IOYA 2WVHA 4D9CA 4H1TA 2X3UA 3KO8A 4RLFA 5MFZA 4IDQA 2V1DA 4Y1FA 3CLUC 4HN9A 4NU0A 4F84A 2HSEA 4KVGA 4CGZA 4QPNA 3Q3GE 4XGQA 2ZS8A 5JEDA 5BW4A 4DNFA 3F5SA 1T3SA 3PWZA 4YJHA 5JMOA 1IXYA 1CWUA 1BCRB 5SICE 1MZVA 3DB2A 3VPDA 1R8JA 4FLVA 5EIXA 1NVVQ 3DH0A 2MSEB 3VM6A 2DJVA 3G2IA 2BHNA 3ZNOA 3OIGA 3TGPA 3A28A 5KBYA 2IEYA 3F8WA 4JTDB 5CA0B 4FZ3A 5KTTA 3DV9A 1XRNA 1OGYA 2ZIXA 4BE7B 4EB6B 3RJMA 5LNK1 1XRPA 3MINA 4L87A 2GPYA 2ZOVA 4PI0A 2GFQA 2WFAA 3AG6A 1OXSC 4MUBA 1E9CA 5CDUA 1Z8DA 4Q4AA 5ISMA 1Z16A 3PEWA 2OCBA 2BCCH 1Q3TA 1G8MA 4F3CA 5IYZA 1WN7A 2E82A 1DCTA 4AUKA 1X15A 4V1CI 1USVA 3VKFA 1PJSA 4GBED 1OCOC 3PJGA 1K1EA 5AJZA 5EQJB 1VKOA 2XNDG 4E88A 4NMXB 3FGOA