3HKCB

Tubulin-abt751: rb3 stathmin-like domain complex
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 123
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkcB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkcB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkcB01
4B45A 4I55B 4TV8A 3JATA 3RYFB 2VAMA 1FSZA 3N2GB 4I50A 5JCOA 2VAWA 5CA0B 4ZHQB 3JAKB 4ZOLA 3WGMA 5IYZA 3M8KA 4X1IB 5BMVB 4XCQA 4E6EA 3JATB 3RYFA 3RB8A 4I55A 4TV8B 5EYPA 4KWEA 5EIBC 3JAKA 4O4HA 5KX5B 3VOBA 3N2GA 3WGLA 4FFBA 4I50B 3V3TA 2BTOA 3JALA 5FNVB 1JFFA 4IHJA 5JQGA 1TUBA 1W5EA 2RHHA 3N2KA 3VOAA 4B46A 1FFXA 4O4JA 4TUYB 4U3JB 3RYCB 3HKEB 2VXYA 5CB4B 4TV9B 2R6R1 4I4TB 2BTQA 5LYJB 3WGJA 3VO9A 4X20A 1JFFB 4IHJB 5FNVA 4WBNA 4EI9A 4IIJA 5GONB 4O4LA 5ITZB 3HKEA 4F6RA 2RHJA 4O4JB 5LP6B 3JAWB 2XKAA 5IJ0B 4EI7A 1RQ2A 2RHLA 2GVIA 3ZBQA 4LNUA 5JCOC 4F6RB 4X1YB 4YJ3B 4DXDA 5LA6B 4X1KA 3RYIA 5CA1A 4ZOLB 4O2AA 5LOVB 4ZI7B 2BTQB 5LYJA 3VPAA 3VO8A 4HNAA 5JH7A 5IJ0A 2Q1YA 1W5AA 5LP6A 3WGKA 2R751 2Q1XA 5MN4A 5C8YB 5J2TB 5ITZA 4EI8A 5IJ9B 3HKBB 4IIJB 3RYHA 1W5FA 1W59A 2VAPA 3WGNA 4M8IA 5JQGB 3JALB 1TVKA 4FFBB 5LXTB 3RYCA 2RHOA 5M7EA 3UT5A 4EB6A 3HKBA 3RYHB 5C8YA 5J2TA 1W581 5LXTA 3M89A 3CB2A 5KMGB 5MN5A 3ZBPA 4ZHQA 5CA0A 5J2UB 1Z5WA 5EZYB 3E22B 5IJ9A 5EYPB 4YJ3A 4DRXA 4X1KB 3RYIB 5LP6C 3HKCB 5BMVA 4X1IA 3UT5B 5IYZB 4HNAB 3JAWA 5JH7B 1SA0A 4ZI7A 5JVDA 5LOVA 3R4VA 4O2AB 5LA6A 3E22A 4O4IB 5CA1B 3JARB 1W5BA 4LNUB 5EZYA 4U39A 4X1YA 5J2UA 1SA0B 3HKDA 5JVDB 1RLUA 2XKBA 4TV9A 3ZIDA 3JASB 5EIBD 3HKCA 4TUYA 1RQ7A 4U3JA 4DRXB 5GONA 4O2BA 4O4LB 3N2KB 4YJ2B 4WBNB 1FFXB 3C8LA 1TUBB 3HKDB 4X20B 4I4TA 3JARA 5MN6A 4O4IA 1TVKB 5CB4A 4O2BB 4YJ2A 1OFUA 5KMGA 4O4HB 5KX5A 3JASA 4EB6B 1Z5VA
chains in the Genus database with same CATH superfamily
2A5FA 1M5TA 1U98A 4TSKA 2A1UB 3IEKA 4G0UA 1PR6A 4RDHA 4QSMA 1H1DA 2JCGA 5DWDA 4GDMA 4A1FA 1Q0QA 1TU0A 4OH1A 2K7ZA 1JTEA 5JCOA 2HNKA 2ZBVA 4RVSA 4TMXA 3QOFA 3JTEA 3G5UA 1FQOA 1T0HB 4MZDA 4RS4A 4ZOLA 4UMFA 2VNAA 3DR5A 4B6QA 4KV9A 3GJ3A 3EORA 2ZYIA 3ZHXA 5KA5A 2XBLA 1Y1LA 2XOKA 4E6EA 2E18A 3R3WA 1Y7TA 1ZD2P 3B1FA 3OQ1A 1NKDA 1V7CA 4NKRA 2FPKA 3JQPA 1T2NA 3KUKA 4O2RA 5ELMA 1O6ZA 4P4UA 3VOBA 3ZYCA 1OVGA 1V4VA 3C5EA 5DM60 1G3QA 3E53A 4WPGA 6CHYA 3EG9A 2I9PA 1JFFA 4JASA 3C90A 2ZI6A 4D3SA 3W2TA 4LGVA 5I3ZA 4OL0A 1H85A 4KUGA 1RAFA 5G1NA 4HDCA 4UD6A 5L3FA 1XMSA 1EQUA 5FD8A 1XALA 4RSGA 1OX4B 2XXBA 5B6IA 3AP3A 1G6UA 2HH9A 2PKRA 3AEIA 1XAHA 3BIWA 5P21A 3VXKA 4ARIA 3U4AA 5JZSA 2VDKB 3W4JA 1Z0AA 1YJQA 3OW2F 4GOND 2C03A 3D3JA 1JB9A 1BT8A 2C9MA 3AGKA 2F00A 1KYXA 4FKZA 4CI9A 5H81A 4YXWD 3VM6A 1XDDA 1VG8A 4BS9A 3X1XA 4GPTA 1R4NA 1THMA 1RABA 1OU0A 1X1BA 2AFHA 3OC0A 3PIRA 1QCEA 1L5WA 2YZ7A 4H59A 2BGJA 4MUBA 1KE2A 3SN6A 3L4BA 1J5EO 4F92B 5JCZA 1HLFA 1XZAA 4LHSA 6AT1A 3ZX4A 5E4JA 3AF4A 3SJUA 2GUWA 3DE5X 1NI4A 3GLSA 4FSDA 2ZTSA 1G42A 4CN9A 4RO2A 4CTNA 2EBFX 1FQKA 5EQJB 1J99A 4L6IA 1IHUA 1UBUS 4IYHA 2GRJA 4LI3X 3RR2A 4DWVA 4YT8A 1R5BA 4NBRA 4Y2HA 5AKLA 2V9YA 3W8FA 5C8DA 3L4JA 2FSGA 3K6SA 1ZOLA 4MB2A 4BZPA 4MPRA 1VCOA 1E5LA 1ZGJA 4LCEA 1MPXA 3GVXA 1EM1A 2GN6A 4ARCA 2F9ZC 2EWWA 3K4PA 4K7JA 4F04A 2QR3A 1T6NA 2QVXX 1NU8A 2QTAA 1PNQA 4JQOA 2IBZH 3FAZA 4ZO7A 3VVCA 2J9GA 4FE7A 3DKPA 4II3A 3DFUA 3GLRA 3HDJA 1M2WA 3CLTD 2PZBA 2VHQA 3LKBA 2FEOA 5BN3A 3MJTA 1PKEA 2FRVA 2DC1A 4J0EA 4P3NA 4YCCA 3PFKA 2NXWA 2NO9A 5LYYA 3FTDA 2AFHB 4J0HA 2WF9A 2XDYA 1H2KA 2B92A 3TJTA 3U3JA 1AB5A 3IDZA 3MTBA 3UMCA 3HCFA 2M6LA 2OA0A 4NG5A 4NY1A 1P9LA 4JB8A 4DLVA 4JJ6A 4FZ3A 2XWPA 4G0VA 5LA6F 1BG6A 3CLHA 3SYNA 1CRWG 1JAYA 2OGWA 3T1YB 1Y42X 2FEWB 2I55A 3VZSA 1QTNA 3ZZTA 3A7DA 1DQPA 3KKNA 1P4SA 4IPTA 1C0KA 3D4PA 4OP1A 4TT8A 4K05A 3E7PA 5JAQA 1UXHA 2AGVA 5KTYA 3ABSB 5DSZA 3KOOA 4QUGA 1EXNA 5A4MS 1CU1A 3B5EA 3C45A 1GZ6A 2OGTA 4TV8F 5EHGA 1I2BA 3WWOA 2LXNA 3B9BA 3EEYA 3AVYA 1W1IA 5DCWA 4CC5A 3BPSA 3UIEA 3A9UA 4BPRA 4IJWA 1WDMA 1ND5A 3BKXA 3HY6A 4KIFA 4DLYA 1WAMA 2QR5A 3MRVA 3VDQA 1LFDB 2EYUA 2P4SA 2VI5A 4HUQB 1IC6A 2VAMA 1RLOA 2R00C 3EG9B 3GB9A 1C8LA 5BV0A 5KOIA 2P9JA 1S76D 3ACDA 3EA5A 4MVJD 4DAEA 4LFBB 2FAXA 2JJ2D 2X8BA 4NZNA 4NVRA 1SBIA 3H4IA 3NU1A 1EXDA 3JQAA 4GPIB 4FC6A 5ALKA 1A8UA 2VKTA 1H48A 1E3JA 1XQVA 3MGCA 4JZKA 4F9FA 4ZHYB 2CHQA 3C87A 4L5AA 5G02A 1EB8A 3LQ1A 1NE2A 1VG9B 4L7VA 1QDEA 4LHVA 4RTMA 3CCSF 1ZH0A 2B3DA 1R6KA 2EIKB 2HWKA 2J31A 2PGGA 4I08A 1N1MA 2VGMA 3W05A 5J4LA 4LF4B 1EWQA 1RPAA 3GFGA 4ZD6A 3FTEA 3I4CA 2P9BA 3D31A 1QV9A 3R4CA 3NTUA 2UKDA 1M0SA 3K0HA 2B21A 1VQLV 3FRHA 4G81A 2PANA 2NU6B 3DMNA 4R7GA 1IIRA 4WEOA 2CE2X 5TF0A 3CX6A 5JRJA 4OQEA 2JCVA 3H9CA 1VMKA 1MUUA 4IHJB 1BGXT 2VNIA 4IS2A 5TPWA 1XMXA 2PLFA 1N1GA 1CJUC 4YIPA 3GNLA 1Z6PA 3C2QA 4R8VA 3ZZUA 3LC0A 1HDEA 5HKBA 4E2YA 3BQNB 4JWKA 1L5HA 4UM9B 3MAQA 2XKAA 4CR6A 1PYOA 1ETHA 1O5TA 5I9SA 5BNIA 1LDBA 1P2GA 2VNKA 4LNUA 1IVNA 1K97A 1M72A 2UUAO 2HCRA 2QUZA 4AQDA 1XZFA 3P27A 3UENA 3V00A 3P10A 5K45A 5GV8A 2X5NA 1EK6A 3N3AC 3JSXA 3ZLTA 5C8YB 2CJWB 1N2OA 3AV0B 3GRAA 1C9KA 3QE3A 4MHTA 2FSUA 4IIJB 2EJRA 3PYMA 4Y7CA 3SJBC 4MWTA 5K2MA 5HIKA 2P22C 4DNQA 4ESEA 3FMOB 1WS6A 2Q8PA 3ZD9A 3I53A 3ZHRA 3MB8A 4CGYA 2IYUA 3IJPA 4HGYA 5JMOA 4IS3A 3UN1A 3PC4A 1LBEA 4JL8A 1A77A 4LK3A 4QPDA 4MUGA 3VPXA 4HDRA 1GG9A 1K7EB 4INJA 5E1MA 2X0EA 2PCJA 3QTTA 4CM7A 2DFKB 4D56A 5J2TA 2H52A 1XZGA 1JJVA 5E7MA 5KMGB 5I8PA 1FDVA 2VJNA 4R84A 4KL1A 1ZMOA 2XUAA 1CR1A 1PBTA 2ACKA 4M8NE 1MAHA 2GYUA 2HRBA 4O59O 521PA 1U3VA 1UBOS 3NPMA 2JI6A 2KW5A 3LBIA 1PK8A 3QLTA 4Z9YA 2UUBO 3QOXA 4J80A 1PSDA 1I1QB 1LZLA 3VZPA 3WL5A 4CKEA 1OU4A 3EZGA 5D3KA 3P9PA 1P61B 4GSYA 5DXFA 4RLQA 2QIPA 2EL7A 4BWYA 1MGPA 5CHYA 1CNFA 4EOGA 1S1MA 2HI0A 1P60A 3PUVA 4YDHB 1SQBH 2QM4A 4MQFA 3RC7A 1GZVA 3D5QA 2PUGA 2RHTA 3RS8A 3EWAA 3AF0A 1PL7A 2FE1A 2WU1A 4OQMA 4B3XA 4BJ5A 1YZYA 2FEMA 3IYLW 3H0EA 3L43A 4B6OA 4B7AA 2ZFUA 1HETA 2PMKA 1E1LA 3GFFA 3KR9A 4LF8O 1VQKF 2B1RA 1S3IA 5DNEA 3U4HA 3UOWA 1UBJS 1RTKA 3QUWA 3ZXXA 1QP0A 2ZG6A 3F96A 2J9ZB 4IUBS 3RWBA 1Q7CA 3PQEA 2XE8A 3SZOA 3X0DA 1G18A 4HZGA 3MD0A 4PAWA 4M36A 5CT4A 4ZAGA 5K2OA 1AZTA 1IQ0A 4BVRA 2PGJA 3F8TA 3H04A 2OGUA 4RA6A 4BMPB 2FDCA 1IUPA 1SKVA 5IBCA 2DSNA 1GGEA 2DHRA 2G88A 4IJ6A 2YHSA 1OI2A 1XIVA 2YOHA 3C24A 2H3EA 3PEVA 1N8SA 3DPIA 3OUTA 4D8YA 5C7OO 5K0SA 3OO1A 1N3BA 5IT4A 4HATA 4YJFA 1WP8A 2DQSA 3G2KA 3V8QA 1FD9A 4UU0A 2IEBA 5BSKA 2V5VA 1B2LA 3JZAA 4W5QA 5IBRA 3CCRF 4P9OA 4LKRA 5FJJA 3Q5DA 4C22A 1WF6A 1YJAA 2GEJA 3HWSA 4JC4A 4KQXA 4P83A 1W75A 2DR2A 3OT1A 4IOMA 4MWCA 2FSHA 3AVPA 1EJ2A 2G1KA 2ZOSA 4B7EA 1W5EA 1D8TA 3OWHA 2C58A 1FU8A 5EINA 4RMNA 2IZZA 4AX4A 1C1DA 4LWPA 4OGKA 2YEVB 2Z08A 3D0QA 5ALTA 1KDYA 3VZCA 2YMQA 1HSZA 4NG4A 2WOJA 3W34A 5LWQA 3OP1A 13PKA 1USVA 2FW9A 5F1OA 3VR4H 2Z6AA 4D0LB 4OX9Y 5LM3A 2WLMA 1VQKV 2FKNA 2QTHA 3IBSA 1NZFA 4UVHA 3T3NA 4RMIA 3OX2A 2W6QA 4S24A 5K0FA 3N8DA 1OMOA 1BS9A 1CDOA 2DF8A 3MG9A 4YJGB 1VPTA 3O8QA 5G1OA 1JG4A 3WO0A 3UJCA 4B8WA 4KR2A 3O4VA 1DG1G 1SOAA 4IIVA 2H2IA 4DIUA 3V4DA 4B0OA 3A1NA 4Q3LA 2QN9A 1BX1A 1O96B 1Y3DE 3D54D 4M0FA 4MRNA 1RQGA 1TUGA 5JXJA 3ZU6A 2UZ1A 1N8NA 4HEHA 4FR0A 4N4AA 2X2EA 4ND6A 3V1YA 3UMMA 4WFBV 1O9HA 1A1SA 2BZSA 2IL1A 3CRNA 3DL4A 3ETLA 3K05A 3BWBA 3PXEA 5JWPA 4PQGA 3RAGA 1XZQA 2AB0A 3H18A 1A2BA 4X6XA 1WMBA 2QVGA 1B0AA 1OTXA 2HSEA 2V4MA 3G2PA 4H6VA 4PANA 2ZXUA 3AUJB 2IYFA 1DIHA 1Y3FE 4FS8A 4JIGA 2DFVA 4JGBA 5DLPA 4AUMA 4BW5A 2CTRA 2X8JA 1QQ7A 4C82A 3WFIA 2WLIA 4QNHB 3KCYA 2PI5A 4PA9A 2DT5A 2FOXA 2GQ0A 5CA0A 1ZQ9A 2PKEA 2XCLA 2AEJA 3QHAA 4HX5A 4XGKA 2ZCVA 1Q2XA 4XM0A 1R9MA 3ZJUA 2YOGA 4ARZA 3VC2A 4D81A 1ESZA 5B6PA 5JCPA 4LYHA 2CWWA 3OJFA 4QU9A 2RBEA 3FWNA 1O8BA 4QRIA 3KKLA 4HNAB 4G5QA 1ODTC 2BKXA 3EE6A 4LW8A 2H2DA 3D1JA 4D82A 5AVXA 3AF1A 2YXLA 1JY8A 5EA2A 3K58A 1QH8B 2AN9A 1IRXA 3E7XA 5EZYA 3K9BA 4A4DA 4BU1A 2BHSA 2JGFA 1JA1A 3AG1B 3B2EE 3GU3A 4D9EA 1OX4A 5ESRA 4TVSA 3MT0A 3BTSA 5BUQA 1XU7A 3F98A 3HKCA 1MB2A 4PHFA 5MFPA 1O9GA 3KT0A 4O2BA 3ONEA 3QUAA 4YVFA 2Y1WA 3BK7A 3TX2A 3HWWA 1SCAA 5IVDA 1WXDA 2FPIA 2KYRA 4LDZA 1DBSA 1EBBA 3KOUA 4BE4A 4CCSA 4O2BB 1N32O 4QXOA 4C5BA 5I01A 5LYJF 2OD9A 1Z2NX 2F4NA 1JW9B 2WLLB 1X7ZB 3MMNA 1CRPA 2CZCA 3UMVA 2B9ZA 1QVGU 4NICA 4F6CA 2QL7A 3L6OO 2GBLC 3CCMF 4BXOA 1M2HA 4XOUA 4X6UA 2YHUA 1FKAO 3ILSA 3K0AB 1XEXA 1UEIA 4M9ZA 2VQSA 3DXXA 1YBFA 4QOFA 5DGXA 3T5MA 2O3SA 2A7XA 3DDUA 4BHTA 1FXHA 2ITDC 1S9DA 1T2EA 4BDSA 1JKMA 1M5IA 2HN9A 3UANA 4D80A 1RSOA 1J2JA 2GETA 1CE8A 2WE8A 3CG0A 3IBFA 1YDMA 2WPNA 3OU7A 3QE0A 4J9VA 5I5GA 2F8SA 2GD0A 1YS7A 3F2IA 5DM6V 3GJSA 4GP9A 3S2YA 3O8LA 3O8OB 3UJPA 5JXHA 2HNAA 4OFWA 3ZD6A 2JEZA 3BTOA 4LE1A 4ALIA 5H4HA 5LGNA 2YQ4A 1HTWA 3KM0A 3WIVA 4R54A 1DJMA 2CHFA 1ES9A 3WLSA 3NP7A 2NU9B 1IJFA 3W2GA 1T8RA 3P9KA 4Z6KA 3H8WA 4TYQA 3E20B 3N2ZB 3U3OA 3W7TA 4RUFA 4BV3A 1YB7A 4X65O 2AFIE 3RG2A 4Z7OB 4R1SA 2EU8A 1CY1A 1UBMS 2OY0A 1ZUD1 3TBHA 4H08A 1G4AE 3ZN2A 3O4HA 3KCXA 5HCNA 1WN7A 5HRAA 1I0IA 2VT2A 2Y4TA 4PF1A 2YXBA 1A71A 1V16B 4P3PA 2R8BA 5F98A 1AUQA 3H11B 1NKVA 3PEFA 1BXRA 4MT8A 2W6NA 4KGDA 5IVHA 1VQVA 2Z2YA 1YIJV 4FJ2A 3SICE 2AR9A 4PLPA 3STWA 4DNXA 5ALRA 5L3SB 1TQ8A 1I08A 2Q3DA 4IO1A 2JCXA 4NWOB 2G4LA 2P77A 3M9XA 1YF3A 1E6LA 1JIIA 1P3Y1 1PV1A 1EVQA 1LS1A 2GEUA 1WZIA 2JD2A 3QTYA 2OCGA 2RNBA 3U40A 1H3NA 3A6FA 4R2KA 5LXTF 3AHEA 2W2PA 3MWDB 4JMPA 3QVSA 5IKOA 3P2KA 2BELA 2QTNA 5A71A 3LUHA 3IIJA 4TMTA 4JB2A 4D99A 4EG6A 3NAMA 2YWEA 4DJDC 2W90A 2FTKE 1JBQA 1S3FA 3RUEA 1O95D 2WFMA 1JJ2F 4PIVA 2ACVA 2PS3A 2PKCA 1NI5A 3EGDA 1LK7A 3EG5A 1HH4A 3JRNA 4DNPA 1DIRA 1E4VA 1IULA 1QGYA 3GNQA 3KSAC 4NCBA 1COWG 1JJOA 1CPYA 3AOEC 3PFNA 4L16A 2QROA 1U1GA 4DR7O 1B14A 4HNGA 1JXOA 4Z86A 3GLFA 4C7XA 3AM1A 4QG3A 4XB6B 3X2EA 3DC6A 5B66Z 3DVQX 1ZRMA 4WRRA 5JNLA 3Q7RA 4MA5A 3TTUA 3KPUA 4OHKA 3PDJA 2ZTUA 8OHMA 2EINC 1F6BA 2F1JA 2WHYA 4R3UC 4IDCA 2VK2A 4CG1A 4YCLA 2JBWA 4DLXA 4Q1VA 1ESDA 4UCVA 1L3BA 5JVDA 1GTMA 5IZ4A 3FWZA 1IN8A 4DMRA 4IIGA 4X64B 3CNBA 3EHBB 4H17A 1KRHA 2A9FA 4B31A 4DC0A 2BFNA 4JJKA 4GOLD 4W8GA 2B4KA 5CXSA 3BFVA 3AFNA 4RD3A 1A4IA 1PWYE 5DBIA 4BUCA 4NIMA 4DCJA 4DDUA 1O6GA 2GD6A 1I30A 1JQAA 5DF1A 5BOSA 4YFVA 3HA2A 1ZIOA 5DEIA 2HJGA 3C8LA 5E7JA 4EG4A 4JPRA 4DE5A 3OUSA 3VCZA 1EEHA 1YS1X 3VSDA 1Y76B 2ADOA 1UQTA 2J0EA 3OTIA 2B1IA 5KPDA 4AVYA 1WDLA 3TW0A 4LZJA 2PSJA 4LF6O 2G9NA 3U5TA 2IBSA 3RE3A 3OM8A 1ZQ1A 3MLBA 4MAFA 1HUQA 4JT4A 3FETA 1O54A 4NEGA 1T5OA 5A7FA 4XDKA 1JH8A 1YQDA 3CM0A 4O02B 2ZYGA 4WOCA 4D6TH 3P0EA 5TF4A 4BLVA 1WA8B 3RJZA 2R97A 3H8VA 4GWGA 1Z6YA 1OZFA 3BHJA 1JXAA 1U2DC 2HA7A 2JDIA 3GELA 3EF1A 2PQMA 5EEGA 1XRJA 2EW8A 3QLEA 3OX3A 5AW9A 1AKYA 4DSOA 5LU8A 3QPWA 3GFPA 2NNUA 3ZI4A 3QLUA 4MGHA 5AP9A 4JYBA 3Q7PA 4MGYR 2EGHA 4CH6A 4GKKO 3RHFA 2O2GA 1TEZA 3CC2F 1JSZA 2RKOA 4JENA 2OCHA 3GPCA 1Z0JA 1D6JA 3D8BA 6Q21A 5JSZA 4FLWA 1FC0A 3CCBA 3ZG6A 2YJ4A 5IJWA 5T6BA 2CLFB 4MZXA 4FFKA 3WJ7A 1KZYC 2B9EA 4FFDA 5JALA 4S05A 2W48A 2WJ6A 3J81M 4M9XA 3SS8A 5AM2A 1GSHA 3HB0A 1XCBA 2HJRA 3T9AA 1TU4A 2O8BA 3KZOA 4DMKA 3PGVA 1I9CA 3WP1B 4O4HF 2X7HA 3I28A 4UARA 4G1BA 3KTAB 1TKBA 2POCA 1E9VA 4HYTA 1P0MA 4DUGD 3MDOA 3H8SA 4FJCC 2OQIA 1KZ6A 1SK9A 3SE0A 5IXSA 3D4LA 3HB5X 4BQQA 2YZ2A 3MT9A 4H35A 4YK7A 3ZVKA 4R0VA 3NPAA 1Y4MA 4PYNA 2AE1A 4GQBA 5LA6B 3BCRA 2EFYA 3I1JA 2XLCA 3PHIA 3L4EA 1NVPD 3ZY6A 2WJAA 3L7KA 1MB9A 2PXCA 4KXNA 5TMDA 5B4VA 5ISMA 5C5IA 1KAEA 2AIFA 1YE3A 3V6LA 4LAFA 4C3ZA 2Z57A 1A88A 3LGXA 1NXSA 4CMEA 1M1KH 1HYGA 2XTAA 4KQ6A 1J9ZA 4QGGA 5E9JA 3VC1A 1K68A 5LCXA 1F5NA 3UJAA 3T7AA 1T4DA 1Z5PA 2CUZA 4CH5A 1XZEA 4UTXA 2FEKA 3KDSE 1CE8B 2WOOA 3Q8KA 1JB1A 3SHWA 1EQ2A 2HA0A 3LHKA 1VTKA 2X8LA 1VSTA 4HGZA 5DX1A 2R9RB 3FFMA 4PC3A 5EWMA 4NBUA 2BP7A 2UV8A 1RXCA 1JIVA 2HSDA 3H4MA 3HEAA 4I4NA 4Y2GA 1XD8A 5ALFA 4JI2O 3TMAA 5SYAA 5BV8A 2NTYC 1PNRA 2RCYA 1AS2A 3UK6A 1SC3A 1T1IA 4PG4A 3DOEA 2YC0A 1O3YA 5JCXA 1H2MA 4RLSA 2FMKA 5B1BC 1DCMA 1I13A 3D7LA 4L2IA 5AXCA 5IDVA 1SNYA 4OA5A 4Q24A 3MUNA 3LF2A 3SHTA 5KYUB 2JGDB 3N1UA 2EC5A 3QKSB 5CNIA 3N86A 1P2BA 3DEKA 1KF0A 3LS2A 3OEEG 1G20A 2YJNA 4FDLA 3CLUC 2BR3A 3AI2A 4DYDA 4TYNA 4LJRA 2IBTA 2PIDA 2CYBA 2RB9A 4A1OA 2QUKA 1X8XA 2DX7A 4TTQA 1XTRA 4IYRA 3PYXA 5FLKA 3CP1A 3DWGA 4J7KA 2PY5A 4QQFA 4RWUA 4V3BA 3AESB 2R62A 3OQMA 4RHYA 3RTAA 2QV7A 3IS3A 2GPWA 3MJHA 3OWXA 3H5VA 4DW0A 4TXNA 4YPOA 4CETA 2FLKA 3SPIA 2UXCO 5COQA 1NMZA 3R76A 3S8MA 3X1DA 4M2LA 4GECA 4LTDA 2P9ZA 5U4XA 2OUKA 1EKXA 1XF1A 3HI6A 3CZ9A 4EX7A 4D57A 4FDUA 5EKTA 5DVZA 4E30A 2JH9A 5M04A 2FJ0A 3K9FC 2AYXA 4BEJA 3EZ9A 1WPQA 4ZVVA 1JLLA 5CA0B 2GHRA 2QEXV 4XYGA 3VU9B 3BMOA 3HWX1 2C1EA 4J4HA 1TMGE 2JFQA 5HOEA 5K3OA 5E0KB 3GOQA 4DG8A 3ABMB 3ICOA 4QOEA 4KWEA 2QPAA 5ICCA 2C07A 4R68A 1F5SA 3FPKA 4MSWC 3N75A 1W41A 3ICVA 2PSFA 1NN3A 1U2QA 2I2WA 3B3JA 3SM3A 1BN6A 1M2KA 2V6GA 4HLUC 3SF0A 5ES3A 4J7CA 2I91A 2D74A 3F49S 4PR3A 2PGDA 5AQEA 4F4CA 2ZPTX 3VZBA 4C8GA 1IMOA 1DHRA 2ZRAA 3FVVA 4U7HA 1R4AA 4KRGA 1MVNA 4UBMA 3T7DA 3K96A 2H1CA 2ODTX 1EDOA 1GKYA 2CMHA 3H83A 1X13A 3N4YA 2ONYA 3L7BA 3UCFA 5CYGA 1KZ1A 3MMXA 2P9YA 4U9HS 1B00A 3BOSA 1M66A 1T5TA 1V8BA 1E94E 4JLWA 4P86A 1E92A 3U39A 3TXSA 1PIWA 4ZVQA 4ZGWA 1ATZA 1ZD8A 4IFBA 4Q18A 4C6HA 1A1VA 4CEJB 5ICEA 2R1VB 3BXZA 1EK5A 1QKKA 1JIQA 1YB6A 3NTQA 4R16A 4Y3UA 3CXCF 1YZVA 4TXJA 1W0KD 2XCSB 4C2UA 2H4ZA 2BFFA 4YJDA 4ZKEA 5BT8A 3OWOA 3DL7A 2OORA 2XRFA 3OE4A 4HL6A 3GBSA 1VSUA 3RVZA 1R6NA 1TE2A 4KTVE 3HN6A 4QTZA 3VNRA 3PS9A 1ZK3A 2WWFA 4BMOB 5ADUS 4HLQB 3GZNA 4CLOB 5HNKA 4CEHB 1N5KA 2BMDA 2WM3A 3WE7A 2ZBQA 1FFEA 1GGNA 1ZX1A 1SG0A 2Q9UA 1PFUA 1NQXA 2Q46A 3EIUA 3OG9A 3QKRB 4JOBA 1A4XA 1RKQA 3V7QA 5EXXA 5HIMA 3BAAA 3Q40A 1OY1A 2C9ZA 1DQYA 1L5QA 4QYIB 4WFQA 3OCYA 3OAAA 4XFJA 5FR1A 3RJTA 1WV0A 3WRVA 4UVBA 1SC1A 1QRUA 1GQ2A 2IS2A 4LCJA 4TVOA 4RZSA 4I0XA 3GHHA 3WWDA 4LBVA 5ADVA 3ABKB 1P75A 2I7XA 1DC8A 1K5PA 1Y1RA 1FRVA 4ZMRA 2AZTA 3UOAB 2VT3A 4LZLA 3PX2A 5HX7A 1FFCA 4IQGA 4OUDA 1J2YA 2Q29A 3E0XA 3QU5A 4P6VF 5EFZA 4BNXA 1QYRA 5EWLA 1QYIA 1T1JA 3ZHUA 3CVVA 5BMVA 5TMBA 1NF9A 1N2CA 4IL5A 2QG4A 2UZ4A 1KJWA 1V16A 1IXYA 2BBTA 1N7JA 2NAFA 3L1UA 1HWYA 3LQYA 3TSYA 5LQDA 3N5KA 1II8A 1PUJA 4CS3A 2A1UA 2OZEA 1QO7A 4Q20A 2BOCC 5IAJA 1U63A 1J8DA 3G7UA 4CQLA 1R8SA 1D1QA 5L3GA 1KH2A 1F06A 1UIRA 4NC9A 1AVMA 2EHDA 3IH5A 5JAZA 2J3HA 4X8AA 1FXKA 3M82A 4N5MA 2HMUA 1NKSA 2ONZA 2V6JA 2AN3A 1MO4A 2Q1TA 3PHCA 4J16A 3WWZA 4BP9A 4WKGA 4ZREA 2QUJA 4P98A 4WTOA 3DE4X 4FOTA 1BHQ1 4JI7B 2PMFA 3ESRA 1DLBA 4E51A 1X52A 2O3TA 1XPRA 1D4AA 1A9XB 3L7IA 1TVEA 5ALLA 1DJOA 1XPOA 4LJYA 2VF2A 2C97A 1Y6ZA 4UE3S 4WY2A 4CKBA 1VMIA 2Y69B 2F3PA 2C8LA 1MTOA 4A2PA 1IZ9A 4MVRA 1W73A 2EX4A 2C3YA 2KBFA 1A5BB 1TO6A 3FG9A 3LKDA 4M99A 4FB5A 1E1KA 1T0IA 5BO5A 3P9NA 1YU6A 1DS6A 2TMGA 4IGGA 1BWQA 2D1RA 4CQJA 1QONA 4ADSG 3RANA 4NR0A 4B3RB 2IAFA 3D3IA 1S4QA 3MJSA 1RIFA 5TQJA 3UGKA 5K0EA 1JILA 3HGQA 4ESHA 1ZIDA 3KQLA 3ZZ1A 4R2MA 2Y0IA 2BIFA 1RI4A 3AQIA 3I05A 3LVFO 4K9QA 4RAIA 3O4RA 3H9GA 3S1AB 1VHLA 4KK3A 1G8SA 5FTLA 4HSEA 3D36A 5KSOA 3R7WA 3CVUA 4GX1A 3CC4V 2P91A 1WXFA 5AO9A 2K9PA 3LWQC 3EIOA 3JWIA 3RD5A 1RPOA 5DTIA 3SSNA 4C76A 4UQLA 1W8IA 1Q83A 1UJ5A 4R05A 5A5DA 2F43B 5I7UA 2CV2A 1NBHA 2UZIR 1C1YA 1DFHA 1GIAA 1ESCA 3BXHA 3EFFK 1XTSA 2P7TC 3P30A 2J4CA 1DV2A 2VSOA 3AJ9A 3GGPA 3JSAA 4JP5A 4LJAA 1XNGA 1RM1C 4Q5IA 2IHZA 2OPBA 4QGHA 1J8YF 4U4AA 3DVAA 3QLJA 5FADA 2G5TA 3ZHZA 3WC4A 1SKBA 3G9XA 3EDQA 1K8QA 1VIDA 4KI0A 4HRAA 3KWLA 2B0JA 4HWOA 4QICA 5DYTA 1H2WA 2OV2A 2ZJ2A 3DAGA 4L3WA 4ZEVA 1G55A 2GXUA 3NEPX 5AVOA 2ZNJA 3CCUF 1SVNA 2VJMA 2ZSKA 1V1JA 4CTMA 3D81A 4Y2QA 1PR9A 2WG1A 4M0PA 1O95C 2AKEA 4PTYA 1YJBA 5ALGA 5M5BA 3O75A 5C8YF 4G4SP 5IT5A 4BNIA 1ZVVA 1FXKB 1NGSA 3R5JA 4IXNA 4BQNA 1Q0SA 5IY5B 1OT5A 1P0PA 3DTVD 3FNRA 3LI2A 2M1ZA 2GK3A 2XD9A 3T5BA 1JD1A 5JNTA 1ISMA 1Z63A 1U28C 2DJ5A 2I4TA 3E5NA 3GPDG 4IMPA 3DE2X 3CUKA 4DM4A 4H4DA 2Q6AA 2JDIG 1SXIA 4GKKB 1W6RA 2HK7A 1EX6A 3C7TA 1KK1A 3WG9A 4H3HB 5AVVA 1PP4A 5DM70 2F9FA 1E2HA 4EUFA 2EILC 4Z51A 1Y3AA 1JEYA 3LBNA 3CGGA 2QVBA 4ZTBA 4WVFA 1IXZA 1C0PA 1NQAO 3GEHA 1Z7GA 4XI9A 3ZYZA 4AMGA 1Q6ZA 1LW6E 2F1OA 3ZQKA 4Q00A 2D7JA 2XXJA 2ODAA 1Q1AA 3AH8A 4MI1A 3A9CA 4BQEA 4CQMB 1GRQA 5EWMB 3T5TA 3LSQA 4S1PA 2OTCA 1Q82H 2OFPA 3RT1A 2QD2A 4WQMA 3R0XA 2JK1A 1KFBB 4OQQA 2IQQA 1Q7BA 1UL1X 3S2FA 3I9NA 1T0BA 4RF4A 4LNAA 1M1YB 4R3WA 3E5MA 3LDHA 4MRMA 2BZ1A 2R4UA 4X00A 1Y6QA 1OWPA 4UCWA 1C80A 3T2MA 3EDYA 1T3SA 4FC7A 5DIFA 2EFJA 1VLJA 5EC2C 1M8JA 1NP7A 2XMGA 3NORA 3PIIA 5DNDA 1QTRA 4FCVA 4V02A 3D01A 4WZBE 5FEMA 2ONCA 2GFHA 2JJ2A 1SXPA 2Y4NA 3F5TA 4FN4A 3VPSA 4C1NA 4Y6OA 1FX0B 1DQZA 2AWNA 2L6LA 1XRQA 1ZL0A 3LWOC 1E9RA 1X8LA 2LIPA 2V5UA 3UG6A 1I32A 2EZ9A 3FB7C 3VOSA 4UCFA 1T0PA 5JV5A 2AVDA 1VI2A 1IEVA 2WWTA 4IDAA 4BGUA 4F21A 2XWQA 5E3JA 1W2BU 3JTMA 2Q6KA 4XUGB 3P52A 3U3DA 3X43A 3D2BA 4IDBA 1NNI1 1ZD3A 3K12A 1N3IA 3K03A 2O1WA 2ZU6A 5FPTA 2JLZA 4DGQA 1V3TA 3E2MA 1T2FA 1DUVG 1I9GA 1NR5A 3DT8A 3W2IA 4B32A 2PUWA 3W6PA 2WB2A 4G67A 1Y4AE 1RP3B 3AR9A 3EB9A 4PGMA 4KBGA 1SPXA 1HEUA 1RWNA 2A58A 2JI9A 4U7TB 3I55F 2EWMA 3LT1A 4MITA 4NEHB 2AJTA 5FLXA 2E4YA 4TKLA 1KBZA 3EVKA 1VP9A 1Y5RA 2RMKB 2QPOA 3FMVA 5CLJA 4EEZA 3U7FB 1GLGA 2P35A 3AEXA 3U3RA 2OSVA 4I9FA 3JZMA 4WFJA 4JZGA 3WPWA 1X0VA 4FNMA 1N8RW 1Z17A 3WJPA 5JS2A 3Q0IA 5FFNA 2CNOA 2WIBA 4O4JB 3X44A 1N6IA 4U2GA 2XBMA 2GM9A 1CLEA 4MIEA 4R81A 3R7SA 1KEEB 1DQSA 3VPDA 3ZDFA 4BKPA 3OPMA 5LU9A 3AHFA 1RMYA 3AX6A 2D5BA 4ZANA 2FMLA 4ZQEA 5LBTA 2B25A 4XLZA 3H6KA 4EM6A 2LPMA 3L1JA 4MQ5A 3GVHA 3QFRA 3FI0A 2BM1A 2DPGA 4L02A 4O2AF 5DBOA 4LJ4A 1ZIYA 2BD0A 5KKCA 5AVKA 1V0JA 5JD3A 2WYWA 2PX2A 1EM6A 2D59A 3JCZA 2IUYA 3U9SA 4BVFA 1OOEA 2AIZP 2VNSA 5JARA 2N9UA 4MB6A 5HXAA 2A84A 2J6HA 3SGIA 2HSGA 3JVIA 5TSDA 3PP8A 1MDBA 2IHYA 1LTQA 3E8XA 1P2FA 1U96A 3AK3A 3KLOA 4MR7A 3RJ5A 1SIOA 4YRMA 2WJ4A 1AKTA 2UUCO 5HY1A 4MIOA 3SU8A 1N8TA 2IQIA 1ZNXA 3GR6A 4JLKA 4UBIA 3DBIA 4GFDA 4OBXA 4UBKA 4F2DA 5K03A 3FCCA 2FWRA 3LT5A 4CIYA 1NNSA 2MSWA 1FJXA 3LWPC 1R2QA 4P5EA 1YZNA 2QUAA 3SIUA 4HMOA 2WYIA 3X1KA 4GM1A 4FILA 1TT5B 3GAMA 1E1RG 4M0MA 5C7IO 3QEKA 1SERA 2ZOVA 1J8FA 3TRIA 3WZMA 2WQ7A 3FR8A 1LB1B 2FMIA 3EX7C 2IU0A 1IM2A 1F1JA 1NOKA 2E82A 2EHJA 2PX6A 4GXQA 4HDQB 5E7IA 5CFNA 3TL3A 2JAUA 3HKCB 1ORDA 2Q21A 5FUQA 1PYGA 1Y4ZA 2KSDA 1VKOA 2HS0A 3QV2A 5A1JA 1CYEA 1Q1NA 3LC7O 4MKIA 3ZIUA 5HUHA 3I2KA 3M6FA 1WMAA 2VQEB 1K8ZB 3K08A 3ZDBA 4GRIA 4FD3A 4RX1A 1T5BA 2FP4A 2P0AA 5F51A 1OUMA 4E31A 5I7RA 5KQLA 3NIBA 2CN1A 1CRLA 2XBUA 4DDMA 3AW9A 3WKCA 4I8DA 2PHZA 3UB3A 2QRVA 4F97A 3SK0A 2OZLA 1PJTA 5I47A 2NV6A 3N9IA 1QVFF 4EYGA 2VSQA 5E1BA 4PA6A 5CT8A 3OUUA 1A69A 1KAGA 3KRTA 4RVGA 4RXTA 2ZB2A 4TMVA 1JZSA 1M2OB 1Z0IA 3L06A 4PC2A 1TD9A 1GARA 1BWRA 1ORIA 4J3JA 3TPCA 4UM9D 3FPCA 1QZXA 5FP0A 4RK1A 4MPDA 2X14A 4FGLA 2QJWA 1KYVA 5T6MA 4DCVA 1U7ZA 2PYZA 3R9KA 5C53B 3SZRA 3ER6A 4NU5A 4LV8B 4P54A 1VFNA 4D9IA 2RH4A 1B6RA 1C9YA 3PN1A 1JLSA 1N2HA 1JHOA 1FMTA 1OPXA 1TJNA 4NUTA 2I8CA 1YI2F 2M9MA 3IVXA 1L5RA 4ID3A 4PQFA 3RSLA 3OQPA 5MGBA 1YMVA 2X0NA 1TA4A 3ONVA 3FDJA 4NAVA 7MHTA 2XOEA 4Y18A 5EZ5A 4RQTA 2W0XA 2HRUA 5LWHA 4KSBA 2CXHA 1ORWA 3DOHA 3PU6A 3OT4A 2FWBA 4UEWA 2GAAA 5KYYA 3NB0A 3Q4HA 5FTNA 5A05A 4TVBA 2J0UA 5JZ9A 3ECAA 3RIMA 3RIXA 1UMDB 5KJ6A 4G97A 3OIYA 1KZGB 1NP6A 4IDOA 4PICA 1UDRA 5J1SB 4P92A 1RXUA 1UKCA 1C1HA 3DMRA 4ZYWA 3J80A 2Y8EA 4JLVA 1QK4A 3R40A 5CBFA 1SU6A 3GJ5A 3KUDA 5CVDA 2C9BA 3NHZA 3I72A 1G6OA 4ASUG 3M4XA 3JAMA 4OJTA 3LV8A 3O94A 3RVLA 2XA9A 3DH0A 2K1SA 1L5GB 2PK3A 4CMBA 1WQ4A 3ICXA 4PU0A 1KFEB 2H65A 1RFLA 3CLTC 1WE2A 4KLZA 3ZUGA 4A91A 3EGXB 3BILA 5IJ0B 3PSHA 4PYIA 4L15A 5AM3A 2PBZA 1YTLA 5E2AA 3VZDA 4B9AA 2B8WA 2WZBA 4Z4EA 2PA3A 3X1MA 1BOFA 1MKYA 1K2VN 4OQNA 5ARCA 1SBQA 2AJDA 3ELDA 3OA2A 4BVHA 3K35A 1B3RA 1X1RA 5LKAA 3OUFA 3L02A 3ZLJA 4CM6A 2HFKA 1AKMA 3TZKA 4JBYA 2ON6A 4PHZA 2H4HA 3C98A 3EXHC 4RM2A 4F84A 4RSRA 3F6MA 1W85A 2HM7A 3KV3O 1VYVA 2RDMA 2P11A 4JXXA 4YCBA 5LXTB 1DG3A 4H6PA 3U9LA 4DAOA 1G4HA 2QD3A 1BS2A 4REMA 1KOLA 5EIXA 3OBWA 2Y1CA 3D6JA 5LMNO 3W6NA 4CMGA 1KU0A 3EFBA 2H51A 4ZI2A 3M4SA 2ATVA 2Z6UA 4BP1A 1NYQA 5C1PA 4KACA 4G84A 5UKDA 4D0RA 4ZHQA 2VNHA 2VK4A 1FFTB 5C1BA 2P4VA 5CMUA 3LPDA 4YAFA 1T29A 3AG2C 3OJ0A 2FSSA 4G85A 1JDJA 4DUGA 2QAGB 3QEMA 4ZWNA 1VLZA 3HXLA 3DA8A 4G28B 4HB3A 3QXCA 5HFNA 3UOGA 1EUYA 3EGXA 3NM4A 1DG9A 3OLQA 3PE6A 1U5BB 2C2WA 2Z98A 4MQMA 2H4FA 4PRLA 1DX4A 1V8ZA 1ZITA 1ZW1A 3AB7A 4OMDA 1RW4A 2HO5A 4ZC8A 1P18A 1NBMA 5IFKA 4D02A 3RVJA 5IWCA 2EIMC 3E22A 2CUGA 1F0NA 3BL5A 1U6IA 4C7OB 1VL8A 2GASA 4R1QA 5I9IA 3GWGA 3RU7A 5BQXA 3AFGA 3FX7A 1NT4A 1OCOC 2I2BA 3GQVA 5KOYA 3TK1A 1YZFA 3TLMA 1KWKA 1GKKA 5IRCD 1DCTA 1AZWA 4MCJA 2IU3A 3OLVA 1MJNA 2I22A 2IT1A 4Y0VA 1LNSA 2C5AA 2H16A 3FUCA 3Q2IA 3UVEA 2IEGA 1VE3A 5BQ5A 4LF8B 4BCDA 4DV1O 1Y3IA 1TVKB 2WG2A 4AAYA 5KMGA 5KC8A 5HWSA 2W2VA 1ECPA 3OJLA 1QAMA 3GJXC 3ZDQA 3FMIA 1D9XA 3HU2A 4FYHA 4HX2A 1WETA 2OHJA 2XYRA 1JAIA 1E7YA 1HT0A 5HJ2A 3HP1A 1PR1A 5JNVA 4LH7A 1K8YB 3ASZA 2DUUA 3A3YA 4WLEA 4QGSA 5CFQA 3TZBA 2J41A 3AG1C 4KWTA 4QNRA 3GVCA 2EIJB 3A3NA 3F3MA 3OZXA 4KHPO 4BYMA 3GO4A 4A0QA 1YR1A 4MVZA 3GJ0A 2NVUA 2P6PA 3LDDA 3TTSA 4MQEA 5IM4A 1NRIA 2HX1A 2ZBFA 1QAOA 2X4IA 1CUJA 4JUDX 1IN7A 2XQVA 1YS6A 1CS4C 1KL7A 2NUTB 3G2LA 3NK6A 2XTZA 3NR7A 2BT4A 3F4LA 5F73A 6REQB 2O8BB 5JROA 2DFDA 1NQUA 1PP9H 3O3OB 5BWLA 1VLMA 1FJGB 4MVSA 1ZMXA 3LVRE 2VBGA 1XV5A 2HA3A 4FSXA 4HN9A 4L0QA 4O5AA 1VIBA 1EA5A 3E9NA 4O4JA 3QVJA 1SCUA 2PZKA 1TTPB 2XA1A 1TVMA 1UM8A 1J0DA 2WLJA 2DBVO 3FCSB 2Q7GA 1FNMA 2QLBA 3JZFA 1T24A 3HJCA 3NUGA 4RAOA 3I5DA 3C1AA 2WKRA 1EU1A 2NU8B 3T4XA 2DT8A 3BK1A 2GDZA 5JLAA 2NUBA 3T3DA 3T3IA 4BVBA 5I9LA 1YIAA 3LUPA 4KSYA 5E4FA 2NU6A 3EXFA 1I6LA 1RWWA 4PZAA 3IUMA 3HBLA 5IK2D 2C7VA 3M8AA 4WJLA 2FPOA 2PEZA 3T7IA 1TKRA 4EI7A 3IO3A 2HA6A 1BE1A 4RY8A 2B1QA 2XAJA 5JCOC 4B62A 5HTKA 4D97A 1XD2A 4U7DA 1II8B 2ZVDA 1BD4A 1XEAA 2EIXA 2P6OA 3IB6A 4HEA6 4NQZA 3Q0TA 5CLGA 2Q7DA 5SZIA 5BUCA 3E15A 1XQ1A 3PXAA 1K8RA 1KORA 2V58A 1M6NA 4WCFB 3UZUA 4UDYX 2BI4A 1CZNA 2E4XA 3RVKA 4JI0B 2YJGA 4HMPA 3CC7F 3BA1A 2D2FA 3QXXA 5ER9A 1AQ6A 3GJYA 4MQ4A 2XZOA 1OH7A 4MMYB 4ROSA 3GZ4A 4KQIA 2G80A 4B80A 4PGAA 4QVKA 5ALHA 1CP9A 2JKZA 4GPBA 1M83A 1F2TA 4CRWB 3DUWA 3IESA 1UK8A 3EVEA 4ZJPA 5FYDA 3EUAA 3LRTA 4DCGA 4L1KA 3DDHA 3VYVA 1XI2A 3U1TA 3LOUA 5DGHA 5LJIA 2XUOA 3TCKA 4ZC1A 5FTKA 2ZU0C 4QYIA 5EKDA 1N4CA 3RTGA 1L5VA 2ARKA 3GV0A 4GKBA 2IBMA 1GFWA 2AX3A 2AN1A 2VHVA 1IPAA 2VZ8A 4BVTA 2BGUA 4LYYA 3AEKB 5FULA 4U8GA 4NPAA 2JAXA 2IYYA 5HF6A 1OWNA 3ADOA 4M0CA 4TXLA 5AI4A 4CQMA 1AP5A 3MINA 3DMTC 3ES9A 4J2HA 1G2OA 1M8PA 2F3RA 4DHEA 3WWYA 5BW8A 3G17A 3L0IB 3LUCA 2XYGA 2CH7B 4OU5A 2BCCH 3FOCA 1EZJA 4ITUA 1GN3A 5FOXA 1QHEA 2MT9A 5FIUA 5DTJA 3VISA 3WMWA 1E79A 3BMCB 2IEAA 3B1VA 3HA3A 4QXMA 1X15A 4B1FA 4I14A 4JVSB 3EOZA 4CKYA 5LPNA 2ZSIA 1W87A 4OHFA 4FFPA 4FHEA 4K46A 4QO8A 3VJKA 1KR5A 1L7PA 1EVJA 5LN1A 2C4WA 2ASVA 3FSEA 2B7CA 3DLPX 3H9EO 1RZUA 4NLLA 4PHHA 4QXQA 2OESA 2P8SA 4O4HB 5LR6A 5FYQA 1M0WA 3EJ6A 2H07A 1KC8H 2QAGC 3AERB 1HYEA 1CUYA 4XH9B 1LDEA 3ZGOA 4AK9A 1EHIA 4AS2A 4UTVA 3JQ7A 5CA0F 1GGJA 1E3MA 2NP7A 4MPJA 1JQLB 3D3WB 5E7QA 3EIHA 1WMSA 1YDFA 5C32A 2H1HA 4JX8A 4C88A 4BO5A 3JAKB 1KJQA 1N34B 1XCLA 4YRBA 3GGGA 4G0MA 4MMZB 5A3VA 4DNFA 4B4KA 5EYPA 3DUFA 1PGJA 2I6RA 3U44B 4Q47A 1NF8A 5H7XA 3N2GA 1K9MH 2NQ2C 1XUOA 3Q1KA 2GEBA 3H3FA 3WU2Z 4MVJP 1VEWA 4US2R 1EB9A 2FX2A 1RXYA 1MRZA 1M2FA 2I6GA 3NX4A 4OLHA 4RXUA 4X6LA 3FCYA 3QQ5A 3DV0A 2VJBA 5I8ZA 1ISPA 4DARA 2HT6A 3SC6A 5HSGA 1G5FA 3OC6A 3STZC 1IATA 4LZWA 5T3YA 1NW6A 1CJKC 4AQYB 1M33A 1MPTA 2CUNA 2F1KA 1WCIB 2QRKA 2F6RA 2VATA 4Y2RA 4PAGA 3K8YA 4PHCA 1OCEA 3VAYA 5ALVA 5F23A 2VPQA 3T4ZA 3EF0A 1B8NA 2GPYA 2CDYA 2L35A 1D3AA 4W7SA 2VIIA 3EIWA 4MW8A 2IWHA 3RIGA 2LWIA 3T7CA 1Z6XA 1K9SA 3WK8A 2HMTA 2CMDA 2G82A 3V34A 3HM2A 3ZXYA 2QGZA 3K1ZA 1F51E 1UC8A 3E8HA 3NDRA 3SLRA 3ZLUA 4S0ZA 4WZ6A 5L6LB 1IPHA 5K3AA 1A7JA 2HA4A 5JC8A 2EEPA 3FFWA 4UM8B 1W44A 2FMHA 3BDVA 2LCIA 4J0GA 1L4YA 3P2YA 5BYAA 3HN7A 5CFMA 2QVZX 5A4DA 4E4EA 4C8IA 5ED0A 5ICMA 3AR7A 1WO8A 3BPZA 3PRJA 4HZUB 3FOZA 3S03A 4GLOA 1IPFA 1M10A 2D2IA 3G82C 1PL0A 4HQLA 4RUKA 3L7MA 3W9BA 4H6XA 1U5AA 2AT1A 2GHTA 2OCCB 3I1FA 3PPXA 4LWZA 4PQRA 4X92A 3V8MA 5K6AA 5E9AA 3CS3A 1LBQA 5E6RB 1LDNA 1X9IA 2CL6X 2J67A 3MJRA 2FHPA 2L18A 3R74A 3L0SA 3OCZA 3ZC3A 3PT9A 1IUKA 4DRZA 1NLUA 3CW9A 1NVTA 3CKYA 1XEXB 4OX9O 3BD7A 3CLRC 2VWGA 2CXSA 3KU1A 1JAXA 3MFQA 3MWFA 3E6AA 4IVQA 4IV5A 5EP1A 3HTNA 2FPPA 3QUTA 4L9SA 1ZJWA 1OTYA 2CJYA 4EW2A 1NM5C 4GPD1 2KJQA 3ISJA 1M4UA 4MW4A 4NKGB 4KOEC 4YUWA 3RAEC 2P78A 4NDAA 4OFBA 2GZ1A 4EH1A 3KFVA 5LA6A 4O4IB 4NULA 3JD2A 3GLGE 3TD2A 3K8ZA 1V4BA 2H1VA 3QKUA 4WE3A 2MW2B 1GTL1 4EABA 4NYKA 1VECA 1DBFA 4JT8A 4NE9A 5TC4A 1PWEA 1P4GA 2P79A 1E0AA 3LRPA 3IDFA 1Z0DA 3ML0A 5EWLB 4YWHA 2YWJA 1QO9A 1TIKA 2DQ4A 3PQCA 4GZMA 2PSHA 4DMMA 2NVWA 2GYVA 4E22A 2DM6A 2WTUA 1COWA 1FVFA 2IHJA 3OKPA 5CPBA 3ZGNA 1UWVA 3FMFA 2YDYA 1ZM7A 3SNHA 3ULKA 2XTMA 3OURA 3QELA 4FOSA 1P8AA 2VCEA 1DXOA 4UFNA 1P6QA 2LBPA 4IJQA 4RKQA 1TVCA 2R25B 3NTOA 4U6NA 3L7LA 3FZNA 2H8EA 5JI2E 2ZRCA 3DXYA 1BEEA 2JBAB 1NTRA 3ELYA 4BKOA 2DUWA 2GNOA 3BCHA 1U8ZA 1X70A 4B33A 4BNDA 1XXLA 2RGRA 4OPAA 1JH9A 1IY2A 3L3BA 3CO0S 4CEHA 1W2BF 2IPLA 1SRRA 1S7CA 1F23A 2ZE5A 4I55A 2NXNA 2PU5A 4MGIR 3GA0A 4JSRA 2PYLA 1CRQA 2F3TA 1C3LA 1FZQA 2P1RA 3A6LA 3IQHX 2F4VB 4L5JA 5E1OA 5T57A 3RK0A 1EVYA 3VSCA 3WGQA 4AF6A 1RM5A 1HE8B 5G2OA 1II9A 5HFAA 4ER7A 1VIVA 5LZ9A 1Q19A 5TPWB 5KAFZ 2PKYX 1DC3A 2ZR8A 4YAIA 3NO4A 3UB2A 4EG7A 1SU8A 3DMFA 3O2NA 2HJWA 4JP2A 3DC5A 4XD7D 3UUGA 4G27B 1P4RA 5H3LA 1V55B 1ONIA 2FC3A 2R1TA 4L8GA 2JFWA 4ECEA 1ORTA 2O0MA 2DBQA 1H9BA 2FSVC 4WZBB 4F1JA 3ANYB 1FP2A 3CY6A 1H2EA 4DV1B 3VO9A 4LHWA 2YS7A 5AKGA 4EF6A 2RHMA 2ZRQA 2ZIWB 4RK6A 1WP4A 3DL0A 3WHKA 5CCEA 5DSTA 3NYWA 4AO8A 3FDZA 3CIFA 3GARA 3A4IA 2H9IA 1VF6A 4JF3A 4L87A 4GCZA 1T9BA 2YYAA 3AZOA 1JQ3A 4ZAYA 1SVSA 1TD1A 1TMOA 3VI4B 4AL4A 4I5SA 1YS2X 1RAIA 2CC2A 2Z9DA 4IHAA 5FWDA 2IW3A 3ZU2A 4EGCB 2UYCA 3AUKA 3F3SA 4EVQA 1YUBA 4DR1B 3SXUA 2ZCJA 2O1EA 5J23A 1E2GA 3GD7A 1XPJA 1IZYA 3N39C 3WNCA 5KQPA 3PDUA 1Z2AA 1Z47A 2R751 2V7WA 4YO8A 3F5FA 2XIJA 2QDKA 2AKYA 2R1UA 3BULA 4MVJF 1EZZA 3STLC 3HYRA 4IL6Z 2YYEA 1JAHA 1F0YA 3BT7A 1CQXA 1LPOA 4O08A 1G8HA 3I04M 4FFMA 9MHTA 1WAZA 4UVEA 3OAAD 5BR8O 1AUOA 4BNJA 3QVMA 1GL9B 3L73H 3CMEF 1E1YA 1MZPA 3AG3C 2XA2A 4D8VA 1N2EA 2WF7A 2XDQB 2JLRA 1DDGA 1KKUA 2DWPA 3PVZA 5LUAA 1LX7A 4BVSA 2PUSA 3W7XA 1FNNA 3LDTA 2I33A 3F7TA 4UD2A 4X93A 3O95A 3RF7A 3W5UA 4BNTA 4CLOA 2XPCA 2W0MA 4TM7A 3GDGA 2O8DB 3A3KA 4Q7EA 3EMDA 1GDHA 3W5SA 1FDOA 4GX0A 1FXWA 2CEKA 1LCIA 2RJNA 4DUPA 1R3LC 4B4UA 5JAOA 4INPA 4QVIA 2QN2A 4QDJA 5J43A 3O9ZA 1AHPA 5DMHA 1NI3A 5SICE 1YONA 2QRLA 3UUEA 4KQ2A 2JS7A 1DAGA 2CHTA 3BK2A 4OXYA 2WIDA 2GAOA 3QH4A 3U6BA 1QQTA 1GAEO 5LMUO 3URMA 2FN4A 2P4UA 2Q3CA 2H2GA 2VHCA 1FP6A 3A9SA 3OEED 1KJIA 2E3JA 2ISCA 3MSCA 3CUEF 2LFSA 1G5PA 2VRBA 3F5MA 4EDHA 5C51B 3HPLC 3IXQA 3N2NA 3ELWA 4AP9A 1ZSYA 1HG0A 5FL3A 4DLTA 1P17A 2QSZA 3ZDXB 4K9LA 4Q6BA 4RF2A 3HUDA 3AINA 4EKDA 3DTTA 2HS4A 4I3GA 4EJ0A 1RXSA 3SFTA 3QVXA 2FW6A 3GJ7A 2C00A 3HR4A 1N0NA 2XF8A 2GV9A 1VBKA 4Y2VA 1K3UB 2ZR3A 5BSWA 3NIFB 2VTVA 4DRYA 1DAPA 3MJ4A 5FKJA 2OMKA 4MRSA 4TT3A 2IDKA 3IKFA 3GP5A 2ZAGA 3CC8A 5ERGB 2QJ1A 1BWPA 3JWJA 4JAVA 4WCFC 1RYFA 2C2HA 1T0JB 1L5YA 1LSUA 2BFMA 3ZY3A 1LBIA 2BM8A 2FUNB 3JVUA 3U1BA 1X80A 4MR8A 2N75A 4YLGA 3WYEA 2TYSB 3TLKA 1QU7A 4H4CA 2ZCUA 3FKSA 3TLGB 2X0IA 3JQ9A 1G9SA 5EXTA 3ZJZA 1SB8A 2R6ZA 3QELB 1JJ2U 1V1MA 1JA8A 2CGEA 4ZEOA 3BE4A 1ONBA 3FWPA 1AQYA 1V5IA 2E5LB 1BQEA 2OM2A 3L72H 1XFAA 2L26A 1IEWA 2VRCD 2WF8A 3ILYA 4IX9A 3ZNQA 2C29D 5LUBA 3QPUA 4JJ4A 2ADFA 4N6GA 4ILKA 1BN7A 3E1YA 4PSCA 3AIOA 3RK1A 1NE7A 1XK6A 5TXGA 221PA 2J5RA 4W1PA 3M6IA 3H9UA 1O7JA 4C3OB 2BR5A 2H08A 3GFSA 3GGSA 2GN9A 5CB4B 4OHZA 1W4BA 3VYSC 3H5OA 5CDSA 3RABA 3I5AA 2ZBUA 3IB3A 3S1AA 4CC6A 1GN9A 2HJHA 3N2YA 1CQPA 3V97A 2DFNA 2PAAA 3G2MA 3KTDA 2W58A 5B1IA 2WU4A 2G5CA 3DBLA 2REQA 2G06A 4J7ZA 3MUFA 4LZPA 5AHOA 1YQ9A 1I2MA 1KGSA 1YH3A 4ENVA 4I4IA 1IV4A 5COAA 3DDWA 1DF5A 5F9MA 2ZJ6A 2JH3A 2ZWMA 3L8FA 4KDCA 1QPZA 3AUYA 3DKRA 2OCDA 1GPNA 3C3MA 4BZXA 3R44A 1HDCA 4MS2A 3ASOB 5LP6A 5KHAA 4RVDA 3U2QA 3UGQA 4EUNA 4R83A 1E1MA 4HAIA 3C9TA 1HNWB 1A4UA 1Z2PX 2PJDA 2IE8A 5FPKA 4QASA 1DEAA 1BL8A 2UXDO 2JFBA 5EE1A 4ARZB 3ZRWA 1TW3A 1ONOA 4OGWA 4M8IA 3LL4A 5CLQA 1OHHG 1N36O 1NYTA 2CVZA 3BZWA 4GLFA 4MS4A 2ZYVX 3ZCPA 4D4MA 3DCNA 5GJBA 5IKXA 3T4DA 5JSKA 3U0ZA 1K6MA 1XP8A 4BT7A 2CL0X 3DJFA 1CULC 4KPFC 1QE3A 1XVIA 4IKOA 1EGVB 1WCWA 1XL1A 2F48A 1Z39A 3CRQA 3EDRA 1VARA 4DTIA 2QMYA 3A1DA 2Z3WA 3GDWA 4UTZA 5DCLA 3S27A 2FPUA 4ZI7F 4YUYA 4YQYA 1SD1A 4EG1A 3GPLA 3NDBB 5L40A 3CLSD 2ZAIA 1QRTA 4BQOA 7REQA 1Y7IA 2YYZA 1Z88A 3LY7A 4C6TA 2JFZA 2ZRJA 1THGA 1RXEA 2FF5A 3BM5A 3R23A 4NFHA 2ZP1A 4N03A 5CCDA 5G53C 4LRWA 1DCKA 1U6KA 3OJEA 4K3AA 3L5KA 2VJAA 4LVNA 4NJMA 2W7TA 3TD4A 3RCBA 4HYYA 1JVNA 2QE7D 3FJYA 1JLKA 4I9WA 4LXGA 1WUTA 2HDOA 4QJFB 1F9EA 3FYTA 4PYKA 1DO0A 3RS7A 3FMPB 3UAZA 1XOUA 4MDHA 4MI3A 1L4EA 1MX3A 3RGBA 3DB2A 1RZRD 1KECA 5H6QA 2JGIA 5CAEB 2QB5A 3D7KA 4P4NA 3WI7A 3V1UA 1MJHA 1HNWO 3CVWA 1SZDA 1KK3A 1N33B 2G9ZA 2IDMA 2ODWA 1W6UA 3CSDA 1VJ0A 4IXTA 4D3XA 4I0XB 1JG2A 1G7TA 1EINA 2C7BA 2ORED 2OT3B 1XQYA 2C20A 2VS0A 1M7HA 3ROTA 1OKKA 1C7JA 2RK4A 4ZHSA 2C2YA 1UPBA 4IRMA 4F5YA 2AD5A 4DR6B 4UEOA 1CY6A 1NQ5A 1J2RA 2IRWA 5JAIA 3SEZA 1FSZA 4ZDKA 3U16A 1IN1A 2ZJ3A 4HAWA 5HILA 3W2EA 2XXAB 3U17A 5JDCA 1I0ZA 2UVQA 3OD5A 3L75H 4ARBA 4FYIA 5C35A 3B89A 4M0KA 2WILA 4IGEA 5A6VA 5CBHA 1AROP 1I6WA 3DDSA 4E2WA 1XDUA 3QPAA 5ULLA 3TYXA 3KFXA 1RQRA 4DCMA 3REOA 3H9VA 3H86A 3DTYA 5G40A 3D0KA 4AJ9A 4GP7A 2DPHA 2GH1A 2Z3VA 5CVCA 5IK2A 4JA2A 3VPBA 4KRXA 4EENA 4N8EA 4LZNA 3O2JA 4HD8A 1K7CA 4X7BA 2B37A 1F4NA 4ZPXA 3ZEAA 4Z4IA 1ZICA 1HLDA 1L7VC 3OR6C 2O7RA 3PFWO 2WY2D 2AK3A 2FWPA 4FBMA 4I5GA 3LZCA 4B87A 5DOZA 2PH7A 3EZLA 2CLOB 2QRHA 1L1FA 1FEZA 1UBNA 1M2OA 1M6EX 3BSFA 5FPQA 2FEPA 2C4KA 4AJOA 4KUMA 1TYCA 1L1EA 2TSYB 2FJUA 3NT2A 3BD6A 1R5NA 3WMRA 1JS1X 4E33A 4B5LA 4TS9A 3KSDO 1OE0A 5J1TB 2QQGA 2IHVA 5JMPA 3H5AA 2DP4E 1U9IA 1Q1GA 5K8JB 3HUFA 3AU9A 3I9OA 1QFXA 1SB9A 2B8JA 4ZRMA 2XB4A 4NOJA 4X3LA 1OLUB 4I9NA 3COSA 4EJFA 2IEYA 2I87A 1FFHA 1OH5A 1JLLB 1I6KA 4IDDA 3KCNA 2A35A 4KXQA 4U9IS 3BREA 1QHIA 4HJXA 5AKHA 3L1IA 1W2HA 4DIFA 2NX2A 2AMLA 5K3FB 2FXIA 3PA6A 3T1OA 3L8HA 1PZHA 3PD0A 3OTOB 1ICIA 3T1CA 1YZTA 3GDFA 4KZPA 4L5YA 2OP0A 2XR1A 2ZTMA 3USZA 4QTUB 3UHAA 1X19A 3KD3A 3NHKA 2GN4A 5BWOA 4WDRA 1N92A 3ZCVA 2OBFA 4B3SO 1FTQA 3N58A 2V0CA 2RHOA 5JTUA 4DFDA 1XREA 3PKJA 4DCNA 1JWAB 4DWOA 5L3QA 1NDUA 1PTJC 4HPXB 4C0LA 1GL3A 3VQWA 2K2QB 3A1FA 4RSMA 3W06A 1Y5MA 2JATA 1U4NA 3HDQA 2JJ8A 4E11A 3CVOA 1YVEI 4PWZA 1J0EA 4DCUA 2FSPA 3IULA 4KGZA 1SCIA 1M56B 4P5DA 1VRCA 3D7NA 3UWDA 2VPTA 3TE6A 16PKA 3DF7A 5HUQA 4FGSA 1FL9A 5BVHA 4RUEA 5KDLA 4BMCA 5CB0A 3ZMUA 4PO1A 1LI4A 1UBCA 1NW7A 3CVXA 4LF6B 1ACMA 2J5QA 1KH1A 3AZPA 3RBAA 4HNSA 3W9UA 4KMRA 4QT4A 1O5IA 2YKGA 2ZSUA 3CEMA 1H6DA 3TD9A 3DTUB 1S2MA 1XO1A 4WOBA 4W5NA 2LP7A 1K9MW 3F2VA 3L0DA 5SY9A 1GQOA 4AS3A 2IFTA 3B6MA 3CHYA 3LUBA 3OA0A 4I3FA 4G4SO 2VDUE 3ASNB 1O0BA 1BE3H 1IZ8A 1VMDA 1YBAA 3KC2A 3CCEF 3SYOA 4KQHA 4JN6B 1KSGA 1TA0A 4MQUA 4PJ0Z 2GESA 1BMFA 2H1SA 1Z6AA 4P22A 4PPFA 5AHXA 3SQDA 3BICA 3PNVA 1B8VA 4NE7A 3RVPA 1HA3A 1M2VA 3RC9A 4UBJA 1UXIA 1DDIA 5K3EA 1XE3A 2ZQ5A 4LF7B 2N0SA 2X8JB 3KYIB 3CEIA 4PELA 1KVTA 4UCUA 4IIUA 5JWOA 4G37A 3KIZA 4TRJA 3TOCA 4AP6A 1X1TA 2VG8A 2IS4A 2JANA 1Z5ZA 2J5KA 3M81A 4V0NA 1WR8A 2R7NA 4HGNA 1BA2A 1QZUA 5F5LA 4K6FA 2ILTA 3RS2A 4HTAA 2CCJA 2XEDA 4PDVA 2ESRA 3VR4A 5LD2B 1SK8A 3BE8A 5PNTA 2O2YA 3OPXA 4O29A 4RWEA 4YRZA 2A92A 3SBOA 2V97A 4FINA 3TQHA 5HQ3A 5JNWA 1NVFA 3Q3VA 2QRQA 3T61A 2MYTA 3LQRA 2D06A 5E6UB 2X3UA 1SELA 2BDEA 3M34A 5E2IA 2WFLA 2XYVA 5I4BA 5CDYA 2CSXA 4BAZA 1UBLS 1LPAB 4F5ZA 1HR0O 2XRMA 4JYZA 2JVIA 3ZIAA 1F48A 2A78A 1I7DA 1GDDA 3PTLA 4BC1A 3QSYA 2EKLA 4MRMB 1DAHA 3IQIX 3VVBA 2CZGA 2VP4A 5KYGA 4TLDA 3V7WA 2QN7A 1MFZA 4ZK7A 3M6WA 4L4XA 4YAOA 3T0GA 1JHQA 2BBWA 3U4CA 1ISIA 4Q34A 1X7YA 2TMKA 5AHKA 4OP2A 5EJIA 5KTMA 3SYQA 1H23A 1U5BA 2Q2QA 4R8KA 4RL6A 4NJEB 4PPQA 1PZFA 1PXWA 5HGJA 2Q3EA 2QY6A 4YRTA 3SC3A 1TFRA 1FXUA 2OZPA 2ETNA 3TZHA 4XDZA 4C7MA 3RYIA 4I36A 5KU1A 5J4KA 4OK6A 5BN4B 3HEMA 2BEVB 2PSDA 4XWWA 3VPAA 5EL0A 3LE8A 3WL8A 3RASA 1M8FA 1UC5B 2VZLA 4JLBA 1UT8A 4XWAA 5IVKA 2VXBA 1QQ5A 1TMYA 2WDZA 2XCIA 1NQOA 3R0JA 3L41A 3RS5A 3U4GA 1XP5A 4B2YA 1U2GC 2I6UA 4KL8S 1JFLA 5A5VA 5AW1A 2OLKA 1YVDA 5J4YA 2X42A 2IS6A 4LXHA 5JSHA 2Z6VA 1DFGA 1L7MA 1T5IA 3JALB 2JLAA 3D5EA 4RWZA 4JH0A 3WLFA 4F6LA 4YT4A 4ER3A 3MT8A 1VQMF 1E4OA 1HTTA 1NBME 3HHPA 1P2DA 4AO6A 1DEOA 3UTDA 4F2HA 3E9YA 1AX9A 3WIEA 1U3GA 1N7GA 4QXRA 3ABLB 4GH5A 4CLXA 5JECA 5IAOA 3JSLA 1KVSA 4N5IX 4D2IA 5KVAA 4YRSA 4OMFG 1GK9A 5ALMA 1UINA 4PX3A 4CMEC 4Q1DA 5EJEA 3R7DA 4QJIA 1EWTA 1GEGA 2PUDA 1NI4B 3IQEA 3GY0A 5EP4A 5ALPA 4Z3DA 1NPYA 2O2HA 1QXSA 5LP6F 3RHZA 3PFGA 2C92A 3ABMC 3ENWA 2OFFA 2OTLF 5I9MA 1FU4A 4QULA 1REQB 2VF8A 3KZCA 4PZDA 5KJFA 2GO1A 3AVQA 2A06H 4MV0A 3RTDA 2YWRA 4OVKA 4QQRA 3P0HA 4WK0B 4V0KA 3SQMA 3LXUX 3CPQA 4CH4A 3CHXA 2CDRA 1XHOA 2DTEA 2JEXA 5DH9A 2SCUB 4LQ4A 2ONJA 4KQGA 2I34A 1E8MA 2CNLA 4UVAA 1GZ0A 1SVIA 2XCQA 3BGSA 3M49A 2HYDA 1K1EA 2GWRA 1O97D 3OIVA 2OQ2A 3ORHA 4GEGA 4TTRA 4BU0A 2HSWA 3R5TA 4DR3O 3NWEA 1BU5A 2WTEA 3R7FA 3Q6IA 5H1YA 2OAQ1 3N70A 4PD4F 1WDKA 4JKYA 4LX0A 2R6DA 4C14A 1MJGA 3D3QA 2AYYA 1QU3A 3D59A 4YCNA 4UV8A 2YIJA 4GC5A 1SXJA 3I9MA 1DZIA 2HMWA 4B3RO 1J6UA 1KY4A 4A92A 5FAKA 2JLXA 1S2DA 1UFOA 4PW0A 1UQUA 4ERNA 2VP9A 1U7TA 2O07A 3KB8A 3SYKA 1A3CA 1JLHA 4XGRA 1EAMA 2RDCA 5AI6A 1P4AA 2GKSA 2TRSB 3O84A 3RUDA 1UBTS 3KTFA 4E94A 4UKDA 3UAVA 2RC5A 1X1EA 1T9ZA 2X5JO 2ZDHA 1F4LA 1ZSNA 1RM1B 2DWQA 1JV2B 2R85A 2JI4A 3BWXA 4GXNA 4R2JA 3REQA 2CF6A 3BL8A 3LUGA 1D5CA 1W36C 3Q10A 1CEEA 3HZOA 4XJVA 4ZHVA 1Z82A 2YFQA 3E4DA 3ZTTA 2OAP1 3V3TA 3O74A 4BLWA 2EX0A 2BFEA 5AUOB 1VPWA 1PKXA 2IPMA 5DECA 2J5BA 4DM3A 3IV6A 2HT1A 4MQLA 4FYXA 2Z9BA 2PLAA 2QLNA 1FDIA 2WQZA 4QZVA 4WX2B 4WUTA 3BGWA 4L28A 4MQFB 2D1FA 2NG1A 3A6DA 3T1HO 2ZVPX 4C4ZA 5KTOA 2EW2A 5SZJA 1H2ZA 2QXUA 2Q3FA 1A9QA 4RE5A 1K89A 2FLWA 5BXQC 2X5XA 1RPTA 1YOVA 2PLNA 2VOJA 1E59A 3MRXA 1AKEA 1U3TA 2OSBA 5CU7A 4Z9FA 4CF3A 1P84F 5FPSA 4DS3A 3C4QA 3ND8A 3WXBA 1EBFA 2QHXA 2QWRB 4LRUA 4YIKA 5EHQA 2O8EA 2OTJV 3G4SF 5LIPA 4Z7QB 3WMGA 2ZYRA 3CT6A 2VP3A 1K4YA 2RIPA 4Q7QA 5JBQA 3KWMA 3M33A 2VDPB 2EZOA 3KXPA 2JFHA 2G5PA 3OJXA 1KP2A 3TSAA 5L7TA 4IJKA 1RRGA 1L1RA 2AD1A 3M5DA 1B0ZA 1L7RA 3VC3A 3VV2A 5J2TB 3ZGYA 3B9RA 3C70A 3RUAA 3TXXA 1GPH1 1ORRA 3WZ2A 2C95A 1XL0A 4MUFA 1POXA 3EZXA 3FTPA 2IKSA 1DK1A 4IJMA 3GP8A 3C8UA 3IP8A 3QWHA 2XJ4A 2KQXA 1ZM2A 1J33A 2VS1A 3GD5A 4AJPA 3AJEA 4RZ3A 4DCTA 3KO8A 2E85A 3BS4A 3FRJA 4FIDA 4ALJA 4EB6A 5C8YA 3S0YA 2CJWA 2WTNA 5CNMA 1TCVA 3QFFA 3TJRA 4XD7A 1KQPA 1G60A 3PNKA 4JB0A 4EJ2A 4UJ3A 2HRRA 3DCYA 3V4ZA 1RXVA 3K9AA 1LY1A 3AFIA 5IWAB 2QNRA 3JVVA 5AOCA 1L4BA 2E1PA 5A02A 4N6NA 1PE0A 3APQA 2CKDA 1IXBA 3QO5A 1C5KA 3K31A 4D9BA 2O1XA 4C4SA 1DWOA 3TDMA 4B71A 1SXJD 4F9EA 1FSSA 2FB5A 3BFRA 4NOMA 3FD8A 4OBWA 4W8HA 3THSA 3DFMA 4BMXA 3E70C 3K30A 2BGNA 3IAEA 3CD6V 4P5PA 2X6BA 4U7NA 2O5EA 1KIFA 4B08A 4TWKA 3NJRA 1B23P 4YMIA 1Q1BA 4YECA 4KFUA 2MSLA 5E8JA 2CVHA 3GMIA 2VPZA 4ZAVA 1MABG 3ZHVA 1XRPA 4YJHB 3SVTA 4AI6A 4URWR 1RADA 5CBPA 3NBAA 2CLLB 1C0LA 1T0UA 3IKVA 3CCFA 4UTNA 4FPPA 1NVAA 2BMVA 4LKOA 1C7ZA 3DPUA 3AR2A 5J58A 4YAKA 3C3SA 4U7PB 3ZDZB 4URUR 1WU8A 1ZESA 1E4EA 2HREA 2YBDA 3OQBA 4HGPA 4US0R 3WQSB 3Q3IA 1Z5VA 2QRMA 4TLLB 5AKJA 1Z8DA 3UV6A 4S0XA 4ASUA 3INTA 1MRNA 3QPBA 1CUDA 2MMCA 3MDSA 1UJNA 1EJBA 2KE5A 1GRJA 1XTTA 4TWBA 1HY3A 3DYIA 4NAHA 2C54A 1LPSA 2BGIA 3AVXA 1FXVA 4QUBA 2HU7A 1Q0ZA 2H0RA 1K5DA 3PPYA 2C0PA 3BWVA 1VQLF 1OGYA 2FQYA 2MU1A 2OGZA 2Q3BA 2HLDG 5JAHA 2A88A 2OBXA 2R6GA 3BHNA 4FUQA 3WQQA 2NXJA 4FYPA 1WLYA 1LQTA 4I9GA 1E1RD 2Z58A 3QY9A 5KHGA 3OOYA 4X66O 5DE3A 4N54A 4R1NA 3QJ5A 1YFLA 3C3JA 2QLTA 5D7NA 4K28A 3QFHA 1G3MA 5D6OA 1RRCA 1ZXBA 4QE7A 2X5KO 2P6UA 3F7MA 4GOMD 4MHSA 1DAFA 4PLVA 1KZ9A 1P0CA 4ON9A 1PT8A 3H1GA 2H57A 3MVEA 3OD1A 5CBPB 6ADHA 2IA5A 4J90A 3E9MA 1XDBA 2MHCA 4H1WA 3H5NA 4FDMA 1B41A 4EY7A 3HCDA 1EVLA 1M5UA 1R15A 2BY4A 4Z99A 5KINB 1F0PA 1WL8A 2C84A 4JYMA 1ROPA 4TVKA 4UEQA 5EIOA 2JIDA 3BTUA 3ETEA 5BYKA 5L4LA 1OI4A 2DJVA 3H1JH 4LH6A 2Y77A 3VBBA 4F3YA 4MKRA 5CDTA 1KO1A 4LJKA 5IMSA 2GVZC 4PI0A 3DW3X 4GI3A 1C9DB 4Z53A 2KBEA 2PYDA 3GAFA 5A0VA 2QTCA 3V2HA 1US8A 2WWVD 4P7FA 1DKUA 4Q6GA 1XEQA 3QK7A 4MGKR 3VNAA 4K9MA 2W6OA 4LE2A 3D4NA 1NUPA 3ZV5A 1J9EA 1Q0HA 4R9RA 2YDXA 4FWBA 3ZWPA 2AHYA 4LF7O 2QMOA 2VAPA 2WABA 1JU4A 3IPAA 3PNOA 3PT5A 4TTVA 1V45E 1MNAA 3KKPA 4F2GA 4B44A 3I6QA 1JYFA 2WZQA 2A7QA 4RIGA 3KQWA 1X7XB 3H4TA 4LJSA 4TL8A 1UKAA 2I78A 5BV7A 3ICQB 2NQ8A 4HWRA 4DREA 2PLRA 3WRXC 3GW8A 3A9TA 3A1WA 3GUYA 2NSJA 3C3KA 2JD1A 4CNQA 3JXEA 3DTVA 1I2ZA 4L51A 4WDQA 3RO7A 1R64A 4Y7DA 1WSWA 1AJPA 2IHUA 2J3JA 2PG3A 4FGJA 4M7WA 2AMYA 2IV2X 2ZZNA 5JRDS 1WB8A 1N6LA 3G8CA 5IZCC 2W6IG 4F38A 2ZM5A 1EZ4A 3ZO8A 5T7BA 4HVAA 5FBRB 1G8AA 3C5HA 4BJ3A 1ZH6A 4IQ8A 1T25A 3LYLA 3EF3A 1CWUA 1QO0D 1BDJA 4IKEA 1YS4A 4OXQA 5EJMA 5GM1A 2O3UA 1LSOA 2I71A 2D4AA 4UUJC 3A04A 3DONA 3KHTA 3QP9A 2Y0PA 5F2VO 4Q37A 2NU7A 1TGYA 3K59A 3VDNB 3VX4A 4YRIA 5H83A 4M1ZA 3W5JA 1ZOOA 2XUIA 3R3VA 5KUKA 1H2YA 3MOSA 4G0NA 2FTKA 3PPIA 4ITVA 3CUWA 1Y98A 4ZVRA 2BJHA 3KPWA 4YRPA 1CUUA 2Y0EA 3R3UA 4W82A 4UOQA 3C6YA 3R75A 4QYSA 5MGNA 2FZKA 2Z2ZA 3OTWA 3Q87B 1N8RH 1I7QB 1U3CA 2FZ5A 2JI7A 3D6NB 3U7HB 3M2TA 3WV4A 1AR5A 4GKJO 1QVAA 1Y8QA 5DB4A 4D45A 3M3PA 4X65B 2IW1A 2RH5A 1BQ3A 1UDWA 1CG6A 1UXKA 2A9KA 4IWNA 4PO3X 3SF8B 1HDIA 4RZHA 3R77A 4MUXA 4PZZA 4UUMA 3T52A 3V80A 1QIFA 3AHHA 4BLTA 2HRZA 1AS0A 2Q1YA 2I7DA 3PUIA 1K2WA 5AKXA 2QENA 3OSUA 4TV8A 1QH0A 4FI3F 5FI5A 1SCNE 2ZBRA 3A11A 2V65A 2ZRPA 5FI1B 3AM5A 2OYCA 2QPLA 3R9XB 1GILA 4B7ZA 2ZT9B 2BTUA 3VMFA 4NR1A 1HL7A 2W4MA 1S8OA 4FEEA 4DKXA 2EFDB 4C5AA 1CJMA 2AFIA 3GA5A 1VK3A 1WNTA 1Z5NA 2A6PA 3W4IA 2DKOA 4C1BA 2GBCA 3BJMA 1WUIS 2HPAA 4XUCA 1QNMA 1SXJB 1FYEA 1HC7A 2CJPA 1SHKA 1BJTA 2I4LA 5DTMA 3AF6A 3ZWBA 4AUEA 3UCSC 4XASA 4XXHA 4BBAA 5E38A 4C2BA 3LX8A 1O95A 2PR7A 4H16A 5A7HA 1W5TA 2E2WA 4BRUA 3N59A 4HWTA 1KY5A 3JZIA 3ONFA 2B1GA 1NJSA 3WDLA 1OX6A 1PI3A 3K92A 5KU7A 4BP3A 3HBJA 1Y76A 3INNA 1N0UA 1ISHA 3A28A 3QUQA 3EMKA 3NHPA 3B8MA 3TS1A 1V11A 1HXHA 4KZKA 4Y1GA 2DMXA 4O4LA 3DDZX 3M7IA 2IPAB 1CP3A 4EY3A 2LCFA 3ADCA 4BNHA 1RHMA 3H7AA 2RE8A 1N2CB 4R50A 2J4FA 1SBHA 1SXHA 2WSSA 3AEZA 1E3EA 4OYYA 2E4ZA 1OXVA 2FJPA 4R01A 5ILGA 2X6RA 1E1NA 1F60A 1SXJE 4M87A 3MD9A 1UBRS 5CK4A 5AJVB 3WGOA 5TGZA 3JVDA 1VDZA 1K63A 4X60A 621PA 3I92A 5DULA 1RXWA 3WP0A 1FNSA 5FHRA 4AJ4A 1V47A 1XMQB 3BHMA 1V2HE 1OQAA 2Z5GA 4L74A 2JFNA 2JIPA 2OYSA 3QFCA 2AFHE 2FPMA 3QUBA 5KOJA 4OHYA 1M34B 4GKAA 4E09A 3H2JA 4FHCA 4PZEA 5IKMA 3GAAA 4ENTA 4MV9A 3GLFB 4XWGA 3BX1A 3VR3D 4XKJA 3OTQA 3RVMA 1AQIA 4XARA 4IUYA 2HR3A 1ZD5A 1X87A 2A5DA 2P9FA 2LKCA 2ZIEA 3IEPA 4HQNA 4OQFA 4XIFA 3WNZA 1OH6A 3T34A 3E2PA 3OLCX 3ROXA 3UQ8A 2CFOA 1RPNA 1SIBE 1U1FA 3PZRA 4MV1A 4Q15A 4W8OA 4EARA 3KQUA 2VBCA 1CB0A 3I01M 4TLEA 5ALJA 4DSTA 3CKMA 1NH2D 3EFOB 1YJ5A 1ECGA 1OYVA 2DWEC 2LE0A 3NRCA 4FYKA 5H9WA 2BLNA 3RYIB 1X7WB 2ORIA 2PM8A 4I9QA 5FUXA 4LRQA 3ZQUA 5JJIA 5GONF 4R7ZA 1NHWA 4IIFA 5CFPA 1QTQA 3HJTA 3MC1A 4IKPA 1Z0ZA 3EQ9A 1QMPA 1S1CA 1FU7A 4OHBA 4OKSA 4QDZA 1EN6A 1G21E 4ABYA 5CD9A 4KVZA 3MOIA 2AC7A 1Q6YA 2HF8A 5EHXA 1Z74A 3K9GA 1S5JA 1W4RA 4Z7JA 3QPVA 3TNLA 1GTZA 2FOIA 1VXRA 2VDNB 3RSFA 3L77A 4C0JA 1U40A 3QSGA 4R6XA 2R79A 4M88A 3RWRD 3R5KA 5EZQA 5DIZA 4ENSA 4BUJA 1P7BA 3CPEA 3H19A 3NHBA 4MOWA 3L6DA 4N0DA 4UV9A 1T4GA 1TO1E 2X9VA 3F0TA 3OFSA 4PS0A 4AN4A 3HYCA 4PFJA 3I1IA 3MRTA 4YJ2A 4GNKA 1FW6A 1J7JA 1T9HA 1O0CA 5B1BB 3AG4B 1QHNA 4JOQA 1EWVA 2X3FA 4XWKA 3L9XA 1DX9A 4IYIA 5COBA 3TPFA 3C6QA 4HEJA 1P7VA 2REXB 4D7TA 1RI3A 1R73A 4P30A 2H1WA 2I1WA 2WV7A 4CKWB 3SSMA 3RRFA 1JIXA 1L8XA 3VYRB 3CNHA 1WZEA 1MOSA 2DJIA 2FRDA 2QF7A 2WNHA 3DSRA 4OLFA 4CYMA 1J9GA 1N8KA 2ZIMA 3Q11A 3Q98A 3R8CA 3CG4A 4PS1A 1UF9A 2DEUA 3GT0A 4LSMA 4ZEMA 2WJHA 3A36A 3A1VA 3KKZA 4FMDB 4GLJA 1R0SA 2R1ZA 4KVGA 3I73A 2CNKA 2H2AA 2X5OA 3BMXA 1J8MF 2CD7A 4KFMA 1X14A 4RV9A 3ROQA 3THYA 3ZWYA 1U81A 4DBVO 1DTWB 1E2NA 1TUBA 4ZU1X 4AM8A 3GEIA 2VTBB 1RC0A 5C46F 1EUCA 1HFJA 2AIRA 5MHTA 3I23A 3R8FA 4YCSA 3JYLA 4JC8A 5F4BA 1DWPA 2C2GA 2XF2A 4J43A 3NWBA 2PJZA 2Q2NA 1XTVA 1NBOA 3PXBA 2ZYWX 4FLMA 1JYSA 4IBOA 1E6KA 1E2KA 4ZVOA 1KC3A 1XDWA 2JLCA 3G71V 3HCNA 3TL6A 2PA0A 4PPNA 5KYUA 3DC7A 4WZZA