3CPQA

Crystal structure of l30e a ribosomal protein from methanocaldococcus jannaschii dsm2661 (mj1044)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
MDVNKAIRTAVDTGKVILGSKRTIKFVKHGEGKLVVLAGNIPKDLEEDVKYYAKLSNIPVYQHKITSLELGAVCGKPFPVAALLVLDEGLSNIMELVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Crystal Structure of L30e a ribosomal protein from Methanocaldococcus jannaschii DSM2661 (MJ1044)
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
total genus 33
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cpqA00
2LBXA 2VGMA 2OTJF 3WXMB 1GO0A 1VQ9F 1GO1A 3PAFA 1Q81H 1Q82H 3LWRC 1E7KA 3GYQA 5G4VC 3ON1A 1Q86H 1VQ8F 2JNBA 1KC8H 3CMAF 3CCRF 5GANK 3LWQC 3CG6A 1H7MA 1YITF 2FC3A 2LBWA 1GZ0A 1X7OA 3CCQF 3LWVC 1W3EX 3CCVF 3I55F 1CN7A 3N4ZA 3V7EA 1X52A 3NK6A 3LFOA 5EO3A 4X3MA 3I56F 2QI2A 5A2QM 3CD6F 3NVKE 3OBYA 1YJWF 3CCSF 3VMFB 1VQMF 3JAMM 1K8AH 1T0KB 4BW0B 3SIUA 5FJ4C 1VQ5F 3NK7A 4LCKA 1QVGF 3OBWA 1PXWA 1CK2A 1W2BF 3CC2F 3G6EF 3OW2F 1VQOF 3MCAB 1YHQF 5GINC 1KD1H 3NVIB 1RA4A 1KQSF 2HVYD 3CXCF 3HJWC 3LWPC 1IPAA 1VQKF 3RA6A 3CC4F 2OZBA 4C4WC 5GIPC 3CC7F 1W42A 1YI2F 3N4YA 2ALEA 3FFMA 1K73H 3CPWF 5EWRA 1RLGA 5GAPK 2OTLF 3CCJF 1YIJF 1VQPF 1VQLF 3O85A 1M90H 2AIFA 1ZWZA 3CPQA 1VQNF 1W40A 3CCEF 1VQ7F 2I6DA 1SDSA 1X7PA 3CCMF 3HAXD 3CCLF 3G71F 4TZZA 3E1YA 1VQ4F 3V7QA 5DCVA 5G4UC 3AGKA 3JCMM 3CMEF 3PLAC 2BO1A 5FLXM 2QEXF 1NJIH 2KTUA 3NMUC 3CCUF 1VQ6F 5IT9M 1QVFF 3G4SF 3J7AR 1YJNF 1S72F 1NMUB 3J81M 2CZWA 5GIOC 1W41A 4X3LA 2WALA 1JJ2F 3IR9A 1K9MH 4BY9D 1DT9A 2OHWA 1YJ9F 3LWOC 1N8RH 3J80M 3SIVA 1M1KH 3RA5A 3E20B 1XBIA 2QA4F 2VGNA 4NUTA 1Q7YH 2KTVA 3VI6A 2KG4A
chains in the Genus database with same CATH superfamily
4RQOA 3JASA 1PF5A 4I50B 1GO0A 4X20B 4ZHQA 1Q81H 3GYQA 1VH8A 2CHTA 3LWQC 4TV9A 3JAKB 1H7MA 4O4IB 1W5FA 3RYIA 2UYPA 3CCQF 3JATA 1YQNA 4X1KA 1IV4A 3S02A 3CCVF 3I55F 3WGNA 3V7EA 2ZF8A 3NK6A 1IV3A 3HKDA 3LFOA 4X3MA 3LMEA 5LOVB 3OBYA 3N2GB 3M1XA 5HY4A 4I50A 3CCSF 3JVHA 4X20A 3SIUA 5HP7A 1UFYA 1CK2A 4BVRA 4U3JA 3JAKA 3QHDA 4WBNB 3WGJA 2R751 3E22A 4NQ3A 1YGYA 3DDNA 5GONB 1KD1H 3NVIB 1KQSF 4ZI7B 3CXCF 3Q8HA 1SA0B 1IPAA 5B8FA 2BTUA 2RB9A 3WJQA 2OZBA 2GLZA 5GIPC 3CC7F 1CLIA 1W42A 5JVDB 5LOVA 2ALEA 2NMUA 1RQ2A 3N2GA 2PHNA 3VIUA 5CA1A 5HY2A 5IJ9B 3C9TA 5EWRA 3IMPA 4BVTA 2Z1EA 1RLGA 2OTLF 1OFUA 2H8EA 4XCQA 3IEWA 1ZWZA 3CPQA 1M90H 2DYYA 1QAHA 4WBNA 3KHNA 4KWEA 3IKEA 2CVLA 1XHOA 5GONA 3V4DA 3ZP7A 5LXTB 4TZZA 4ZI7A 1VQ4F 1VK3A 1SA0A 4G4YA 4BT6A 3AGKA 2HX0A 3JCMM 3CMEF 4TUYB 5FLXM 2H8CA 5LYJB 3L7QA 2YXZA 2UYJA 2GZLA 5HY1A 1JN1A 2HP0A 1JFFB 4E6EA 5IJ9A 3M4SA 1GX1A 1VQ6F 5EAZA 4G4ZA 1QVFF 3J7AR 3C9UA 4M8IA 5EB1B 3GHZA 2WALA 3ZOPA 1JJ2F 3KE1A 1K9MH 4BY9D 3V3TA 1DT9A 1JY8A 1YJ9F 3CYQA 4DRXB 1N8RH 1U43A 3JALA 3VYSC 2F9ZC 2RHOA 2Z1TA 3LDTA 4O4HB 2I6RA 5LP6B 4TUYA 5LYJA 4B45A 1TUBB 5CA0A 2KG4A 5JCOC 3JARB 4O4LB 1DBFA 2VGMA 1Q8RA 4R40B 4U39A 4ZOLA 4IHJB 1VQ9F 1FFXB 3HKCB 3ON1A 2G9IA 3D00A 5GANK 3S0YA 3CG6A 4DRXA 2FC3A 1QU9A 4O4HA 4I55B 5LP6A 3MDOA 5J2TA 3WGLA 1TUBA 1COMA 2HQSC 3FBAA 1CN7A 1U3LA 3HKEB 3JARA 3C9RA 4O4LA 3VO8A 4ZHYB 5HXZA 4IHJA 1IV2A 5FJ4C 1FFXA 3HKCA 2LBTA 4BW0B 4DXDA 4C8EA 4LCKA 3QUWA 2ZVZA 3OBWA 1PXWA 3C9SA 4ZHWA 2VAWA 2PMPA 1R1MA 3HTNA 2Q1XA 3MCAB 2RHJA 4I55A 5GINC 2HVYD 5JQGB 3WPWA 3HJWC 1VQKF 5KMGA 3CC4F 3HKEA 1QD9A 1VQVA 1YI2F 3FFMA 4EB6A 1K73H 5HP8A 3K0TA 3CPWF 4C81A 2Z1FA 5FNVB 5GAPK 3CCJF 3O85A 1VQNF 2AIFA 1W581 3FD5A 2R6R1 1SDSA 4LNUB 4O4IA 3B6NA 3CCLF 5MN5A 2Q1YA 2UZHA 3V7QA 4B62A 5JQGA 5G4UC 3RYFB 1FSZA 4X1YB 1NJIH 2KTUA 3S0HA 3LYBA 2ZVYA 1IV1A 1RLUA 3R0PA 5FNVA 1NMUB 3M84A 2CZWA 1W41A 4X3LA 3T80A 5HY0A 4O2AB 3IR9A 4LNUA 4C8IA 4BT2A 1OAPA 3I3FA 4YJ3B 3J80M 3RYFA 4EI8A 2BTQB 1M1KH 3RA5A 2HS4A 5AVMA 1KNJA 3ZO8A 5EIBC 5JVDA 2CW4A 5EB0A 3VI6A 1Q7YH 2MQEA 1Z5VA 2LBXA 3OONA 2H6LA 3PAFA 3LWRC 1X25A 4O2AA 1E7KA 5G4VC 1Q86H 3VYTC 1XV2A 2HS3A 2W8BC 3CMAF 2GVIA 3CCRF 4BT4A 5HXUA 4BT5A 1TVKB 5BMVB 5LXTA 1J7HA 5MN6A 3KJKA 1GZ0A 2ZAUA 2HRUA 1X7OA 3VYUC 3LWVC 2AMTA 3CB2A 4RHAA 5EIBD 5A2QM 3NVKE 2QTPA 1YJWF 1JFFA 4YJ2B 5ITZB 3ZP4A 3TD5A 1Z5WA 1VQMF 3JAMM 1H47A 5JCOA 1K8AH 1T0KB 5CB4B 3NK7A 4X1IB 2CSLA 4HNAB 2P6YA 5IJ0B 1W2BF 3CC2F 1KNKA 1TVKA 3D54A 5BMVA 3OW2F 3MBMA 4G4VA 3S0WA 1FNKA 1VQOF 1YHQF 4BVQA 4O4JB 2YYEA 2IAFA 4EB6B 4BT7A 2RHLA 5KX5B 4C4WC 3MCQA 2DT4A 1U40A 1NQ3A 3N4YA 2CHSA 3DC2A 3IEQA 5ITZA 3IKFA 5EZYB 1T0AA 5CB4A 4X1IA 4HNAA 1VQ7F 2I6DA 3F0DA 4TV9B 1X7PA 3CCMF 3HAXD 4O4JA 3FD6A 4EI9A 3G71F 2K1SA 4F6RB 3WGKA 5DCVA 3N2KB 5JH7B 4ERHA 3RYHB 3JATB 5KX5A 4X1KB 4G4XA 3VOAA 3PLAC 2EWCA 2LCAA 4FFBB 1W5BA 3U0OA 5HWEA 1ONIA 2QEXF 3ESJA 3WPXA 5EZYA 5MN4A 5LA6B 2HP3A 1JD1A 5IT9M 3G4SF 1S72F 2BTOA 3J81M 4NWOB 5GIOC 4G88A 3ERNA 2AIZP 4U3JB 3JAWB 2HS0A 5IYZB 3RE3A 3E22B 4F6RA 3P0ZA 3TD4A 3N2KA 5JH7A 3SIVA 3RYHA 3KJJA 2KGWA 4BT3A 3E20B 1XBIA 3GTZA 2QA4F 3TD3A 2B33A 4FFBA 2VGNA 4ZK7A 3BYQA 3S03A 5LA6A 3FPIA 2VAMA 1XRGA 5EYPB 5CA1B 2CWJA 3I7TA 1VHAA 2OTJF 2L26A 3WXMB 3HKBB 3WGMA 1GO1A 2ZOVA 1Q82H 1VQ8F 2JNBA 1KC8H 3HWUA 3JAWA 2FGYA 3RYCB 5IYZA 1W59A 1YITF 2VAPA 2LBWA 1FNJA 3WJRA 3ELCA 3CYPB 1W3EX 2Z01A 3N4ZA 4X1YA 1X52A 2OTMA 4ZHVA 5EO3A 4C8GA 3I56F 4B5CA 2QI2A 3CD6F 5EYPA 2HP0B 5C8YB 4G4WA 1W5EA 3K14A 3HKBA 3VMFB 1SZQA 2UYKA 1VQ5F 1QVGF 3RYCA 4TV8B 3G6EF 1W55A 4IIJB 3UT5B 4YJ3A 3JALB 3K12A 1RA4A 3S06A 3LWPC 2IG8A 3RA6A 4BVSA 4B46A 2N48A 3MQWA 3EORA 3F6MA 3C8LA 5CA0B 3P10A 1U3PA 4I4TB 5C8YA 3K2XA 1H48A 3D01A 4ZOLB 4PWTA 1YIJF 1VQPF 1VQLF 1UI9A 4TV8A 1W40A 1W57A 3CCEF 4IIJA 3UT5A 3F0GA 3F0EA 4EI7A 3E1YA 4O2BB 5J2TB 1W5AA 5J2UB 3F0FA 2UYNB 3VTIC 2ZODA 2BO1A 3P4EA 4I4TA 4YJ2A 3NMUC 3CCUF 3JASB 1YJNF 4ZHQB 5IJ0A 1ODEA 5LP6C 2OHWA 3LWOC 2V9YA 2IQQA 2RHHA 3VOBA 4O2BA 3RYIB 3KIZA 2HRYA 5J2UA 2UYNA 5KMGB 4NUTA 2VXYA 2Z1UA 2KTVA 4C82A 3HKDB 3WJPA 3QTYA 3VCZA 1RQ7A
chains in the Genus database with same CATH topology
2LBXA 2VGMA 2OTJF 3WXMB 1GO0A 1VQ9F 1GO1A 3PAFA 1Q81H 1Q82H 3LWRC 1E7KA 3GYQA 5G4VC 3ON1A 1Q86H 1VQ8F 2JNBA 1KC8H 2FGYA 3CMAF 3D00A 3CCRF 5GANK 5HXUA 3LWQC 3CG6A 1H7MA 1YITF 2FC3A 2LBWA 1GZ0A 1X7OA 3CCQF 3LWVC 1W3EX 3CCVF 3I55F 1CN7A 3N4ZA 3V7EA 1X52A 3NK6A 3LFOA 5EO3A 4X3MA 3I56F 2QI2A 5A2QM 3CD6F 3NVKE 3OBYA 1YJWF 5HY4A 5HXZA 3CCSF 3VMFB 1VQMF 3JAMM 1K8AH 1T0KB 4BW0B 3SIUA 5FJ4C 1VQ5F 3NK7A 4LCKA 1QVGF 3OBWA 1PXWA 1CK2A 4BVRA 1W2BF 3CC2F 3G6EF 3OW2F 1VQOF 3MCAB 1YHQF 4NQ3A 4BVQA 5GINC 1KD1H 3NVIB 1RA4A 1KQSF 2HVYD 3CXCF 3HJWC 3LWPC 1IPAA 1VQKF 3RA6A 4BVSA 3CC4F 2OZBA 2GLZA 4C4WC 5GIPC 3CC7F 1W42A 1YI2F 3N4YA 2ALEA 3FFMA 1K73H 5HY2A 3CPWF 5EWRA 4BVTA 1RLGA 5GAPK 2OTLF 3CCJF 1YIJF 1VQPF 1VQLF 4XCQA 3O85A 1M90H 2AIFA 1ZWZA 3CPQA 1VQNF 1W40A 3CCEF 1VQ7F 2I6DA 1SDSA 1X7PA 3CCMF 3HAXD 3CCLF 4EI9A 3G71F 4EI7A 4TZZA 3E1YA 1VQ4F 3V7QA 5DCVA 5G4UC 3AGKA 3JCMM 3CMEF 3PLAC 2BO1A 5FLXM 5HWEA 2QEXF 1NJIH 2KTUA 5HY1A 3NMUC 3CCUF 1VQ6F 5IT9M 1QVFF 3G4SF 3J7AR 1YJNF 1S72F 1NMUB 3J81M 2CZWA 5GIOC 1W41A 4X3LA 5HY0A 2WALA 1JJ2F 3IR9A 1K9MH 4BY9D 3V3TA 1DT9A 2OHWA 1YJ9F 3LWOC 1N8RH 3J80M 2F9ZC 3SIVA 4EI8A 1M1KH 3RA5A 3E20B 1XBIA 2QA4F 2VGNA 4NUTA 1Q7YH 2KTVA 3VI6A 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBX A;  2VGM A;  2OTJ F;  3WXM B;  1GO0 A;  1VQ9 F;  1GO1 A;  3PAF A;  1Q81 H;  1Q82 H;  3LWR C;  1E7K A;  3GYQ A;  5G4V C;  3ON1 A;  1Q86 H;  1VQ8 F;  2JNB A;  1KC8 H;  3CMA F;  3CCR F;  5GAN K;  3LWQ C;  3CG6 A;  1H7M A;  1YIT F;  2FC3 A;  2LBW A;  1GZ0 A;  1X7O A;  3CCQ F;  3LWV C;  1W3E X;  3CCV F;  3I55 F;  1CN7 A;  3N4Z A;  3V7E A;  1X52 A;  3NK6 A;  3LFO A;  5EO3 A;  4X3M A;  3I56 F;  2QI2 A;  5A2Q M;  3CD6 F;  3NVK E;  3OBY A;  1YJW F;  3CCS F;  3VMF B;  1VQM F;  3JAM M;  1K8A H;  1T0K B;  4BW0 B;  3SIU A;  5FJ4 C;  1VQ5 F;  3NK7 A;  4LCK A;  1QVG F;  3OBW A;  1PXW A;  1CK2 A;  1W2B F;  3CC2 F;  3G6E F;  3OW2 F;  1VQO F;  3MCA B;  1YHQ F;  5GIN C;  1KD1 H;  3NVI B;  1RA4 A;  1KQS F;  2HVY D;  3CXC F;  3HJW C;  3LWP C;  1IPA A;  1VQK F;  3RA6 A;  3CC4 F;  2OZB A;  4C4W C;  5GIP C;  3CC7 F;  1W42 A;  1YI2 F;  3N4Y A;  2ALE A;  3FFM A;  1K73 H;  3CPW F;  5EWR A;  1RLG A;  5GAP K;  2OTL F;  3CCJ F;  1YIJ F;  1VQP F;  1VQL F;  3O85 A;  1M90 H;  2AIF A;  1ZWZ A;  3CPQ A;  1VQN F;  1W40 A;  3CCE F;  1VQ7 F;  2I6D A;  1SDS A;  1X7P A;  3CCM F;  3HAX D;  3CCL F;  3G71 F;  4TZZ A;  3E1Y A;  1VQ4 F;  3V7Q A;  5DCV A;  5G4U C;  3AGK A;  3JCM M;  3CME F;  3PLA C;  2BO1 A;  5FLX M;  2QEX F;  1NJI H;  2KTU A;  3NMU C;  3CCU F;  1VQ6 F;  5IT9 M;  1QVF F;  3G4S F;  3J7A R;  1YJN F;  1S72 F;  1NMU B;  3J81 M;  2CZW A;  5GIO C;  1W41 A;  4X3L A;  2WAL A;  1JJ2 F;  3IR9 A;  1K9M H;  4BY9 D;  1DT9 A;  2OHW A;  1YJ9 F;  3LWO C;  1N8R H;  3J80 M;  3SIV A;  1M1K H;  3RA5 A;  3E20 B;  1XBI A;  2QA4 F;  2VGN A;  4NUT A;  1Q7Y H;  2KTV A;  3VI6 A;  2KG4 A; 
#chains in the Genus database with same CATH topology
 4RQO A;  3JAS A;  1PF5 A;  4I50 B;  1GO0 A;  4X20 B;  4ZHQ A;  1Q81 H;  3GYQ A;  1VH8 A;  2CHT A;  3LWQ C;  4TV9 A;  3JAK B;  1H7M A;  4O4I B;  1W5F A;  3RYI A;  2UYP A;  3CCQ F;  3JAT A;  1YQN A;  4X1K A;  1IV4 A;  3S02 A;  3CCV F;  3I55 F;  3WGN A;  3V7E A;  2ZF8 A;  3NK6 A;  1IV3 A;  3HKD A;  3LFO A;  4X3M A;  3LME A;  5LOV B;  3OBY A;  3N2G B;  3M1X A;  5HY4 A;  4I50 A;  3CCS F;  3JVH A;  4X20 A;  3SIU A;  5HP7 A;  1UFY A;  1CK2 A;  4BVR A;  4U3J A;  3JAK A;  3QHD A;  4WBN B;  3WGJ A;  2R75 1;  3E22 A;  4NQ3 A;  1YGY A;  3DDN A;  5GON B;  1KD1 H;  3NVI B;  1KQS F;  4ZI7 B;  3CXC F;  3Q8H A;  1SA0 B;  1IPA A;  5B8F A;  2BTU A;  2RB9 A;  3WJQ A;  2OZB A;  2GLZ A;  5GIP C;  3CC7 F;  1CLI A;  1W42 A;  5JVD B;  5LOV A;  2ALE A;  2NMU A;  1RQ2 A;  3N2G A;  2PHN A;  3VIU A;  5CA1 A;  5HY2 A;  5IJ9 B;  3C9T A;  5EWR A;  3IMP A;  4BVT A;  2Z1E A;  1RLG A;  2OTL F;  1OFU A;  2H8E A;  4XCQ A;  3IEW A;  1ZWZ A;  3CPQ A;  1M90 H;  2DYY A;  1QAH A;  4WBN A;  3KHN A;  4KWE A;  3IKE A;  2CVL A;  1XHO A;  5GON A;  3V4D A;  3ZP7 A;  5LXT B;  4TZZ A;  4ZI7 A;  1VQ4 F;  1VK3 A;  1SA0 A;  4G4Y A;  4BT6 A;  3AGK A;  2HX0 A;  3JCM M;  3CME F;  4TUY B;  5FLX M;  2H8C A;  5LYJ B;  3L7Q A;  2YXZ A;  2UYJ A;  2GZL A;  5HY1 A;  1JN1 A;  2HP0 A;  1JFF B;  4E6E A;  5IJ9 A;  3M4S A;  1GX1 A;  1VQ6 F;  5EAZ A;  4G4Z A;  1QVF F;  3J7A R;  3C9U A;  4M8I A;  5EB1 B;  3GHZ A;  2WAL A;  3ZOP A;  1JJ2 F;  3KE1 A;  1K9M H;  4BY9 D;  3V3T A;  1DT9 A;  1JY8 A;  1YJ9 F;  3CYQ A;  4DRX B;  1N8R H;  1U43 A;  3JAL A;  3VYS C;  2F9Z C;  2RHO A;  2Z1T A;  3LDT A;  4O4H B;  2I6R A;  5LP6 B;  4TUY A;  5LYJ A;  4B45 A;  1TUB B;  5CA0 A;  2KG4 A;  5JCO C;  3JAR B;  4O4L B;  1DBF A;  2VGM A;  1Q8R A;  4R40 B;  4U39 A;  4ZOL A;  4IHJ B;  1VQ9 F;  1FFX B;  3HKC B;  3ON1 A;  2G9I A;  3D00 A;  5GAN K;  3S0Y A;  3CG6 A;  4DRX A;  2FC3 A;  1QU9 A;  4O4H A;  4I55 B;  5LP6 A;  3MDO A;  5J2T A;  3WGL A;  1TUB A;  1COM A;  2HQS C;  3FBA A;  1CN7 A;  1U3L A;  3HKE B;  3JAR A;  3C9R A;  4O4L A;  3VO8 A;  4ZHY B;  5HXZ A;  4IHJ A;  1IV2 A;  5FJ4 C;  1FFX A;  3HKC A;  2LBT A;  4BW0 B;  4DXD A;  4C8E A;  4LCK A;  3QUW A;  2ZVZ A;  3OBW A;  1PXW A;  3C9S A;  4ZHW A;  2VAW A;  2PMP A;  1R1M A;  3HTN A;  2Q1X A;  3MCA B;  2RHJ A;  4I55 A;  5GIN C;  2HVY D;  5JQG B;  3WPW A;  3HJW C;  1VQK F;  5KMG A;  3CC4 F;  3HKE A;  1QD9 A;  1VQV A;  1YI2 F;  3FFM A;  4EB6 A;  1K73 H;  5HP8 A;  3K0T A;  3CPW F;  4C81 A;  2Z1F A;  5FNV B;  5GAP K;  3CCJ F;  3O85 A;  1VQN F;  2AIF A;  1W58 1;  3FD5 A;  2R6R 1;  1SDS A;  4LNU B;  4O4I A;  3B6N A;  3CCL F;  5MN5 A;  2Q1Y A;  2UZH A;  3V7Q A;  4B62 A;  5JQG A;  5G4U C;  3RYF B;  1FSZ A;  4X1Y B;  1NJI H;  2KTU A;  3S0H A;  3LYB A;  2ZVY A;  1IV1 A;  1RLU A;  3R0P A;  5FNV A;  1NMU B;  3M84 A;  2CZW A;  1W41 A;  4X3L A;  3T80 A;  5HY0 A;  4O2A B;  3IR9 A;  4LNU A;  4C8I A;  4BT2 A;  1OAP A;  3I3F A;  4YJ3 B;  3J80 M;  3RYF A;  4EI8 A;  2BTQ B;  1M1K H;  3RA5 A;  2HS4 A;  5AVM A;  1KNJ A;  3ZO8 A;  5EIB C;  5JVD A;  2CW4 A;  5EB0 A;  3VI6 A;  1Q7Y H;  2MQE A;  1Z5V A;  2LBX A;  3OON A;  2H6L A;  3PAF A;  3LWR C;  1X25 A;  4O2A A;  1E7K A;  5G4V C;  1Q86 H;  3VYT C;  1XV2 A;  2HS3 A;  2W8B C;  3CMA F;  2GVI A;  3CCR F;  4BT4 A;  5HXU A;  4BT5 A;  1TVK B;  5BMV B;  5LXT A;  1J7H A;  5MN6 A;  3KJK A;  1GZ0 A;  2ZAU A;  2HRU A;  1X7O A;  3VYU C;  3LWV C;  2AMT A;  3CB2 A;  4RHA A;  5EIB D;  5A2Q M;  3NVK E;  2QTP A;  1YJW F;  1JFF A;  4YJ2 B;  5ITZ B;  3ZP4 A;  3TD5 A;  1Z5W A;  1VQM F;  3JAM M;  1H47 A;  5JCO A;  1K8A H;  1T0K B;  5CB4 B;  3NK7 A;  4X1I B;  2CSL A;  4HNA B;  2P6Y A;  5IJ0 B;  1W2B F;  3CC2 F;  1KNK A;  1TVK A;  3D54 A;  5BMV A;  3OW2 F;  3MBM A;  4G4V A;  3S0W A;  1FNK A;  1VQO F;  1YHQ F;  4BVQ A;  4O4J B;  2YYE A;  2IAF A;  4EB6 B;  4BT7 A;  2RHL A;  5KX5 B;  4C4W C;  3MCQ A;  2DT4 A;  1U40 A;  1NQ3 A;  3N4Y A;  2CHS A;  3DC2 A;  3IEQ A;  5ITZ A;  3IKF A;  5EZY B;  1T0A A;  5CB4 A;  4X1I A;  4HNA A;  1VQ7 F;  2I6D A;  3F0D A;  4TV9 B;  1X7P A;  3CCM F;  3HAX D;  4O4J A;  3FD6 A;  4EI9 A;  3G71 F;  2K1S A;  4F6R B;  3WGK A;  5DCV A;  3N2K B;  5JH7 B;  4ERH A;  3RYH B;  3JAT B;  5KX5 A;  4X1K B;  4G4X A;  3VOA A;  3PLA C;  2EWC A;  2LCA A;  4FFB B;  1W5B A;  3U0O A;  5HWE A;  1ONI A;  2QEX F;  3ESJ A;  3WPX A;  5EZY A;  5MN4 A;  5LA6 B;  2HP3 A;  1JD1 A;  5IT9 M;  3G4S F;  1S72 F;  2BTO A;  3J81 M;  4NWO B;  5GIO C;  4G88 A;  3ERN A;  2AIZ P;  4U3J B;  3JAW B;  2HS0 A;  5IYZ B;  3RE3 A;  3E22 B;  4F6R A;  3P0Z A;  3TD4 A;  3N2K A;  5JH7 A;  3SIV A;  3RYH A;  3KJJ A;  2KGW A;  4BT3 A;  3E20 B;  1XBI A;  3GTZ A;  2QA4 F;  3TD3 A;  2B33 A;  4FFB A;  2VGN A;  4ZK7 A;  3BYQ A;  3S03 A;  5LA6 A;  3FPI A;  2VAM A;  1XRG A;  5EYP B;  5CA1 B;  2CWJ A;  3I7T A;  1VHA A;  2OTJ F;  2L26 A;  3WXM B;  3HKB B;  3WGM A;  1GO1 A;  2ZOV A;  1Q82 H;  1VQ8 F;  2JNB A;  1KC8 H;  3HWU A;  3JAW A;  2FGY A;  3RYC B;  5IYZ A;  1W59 A;  1YIT F;  2VAP A;  2LBW A;  1FNJ A;  3WJR A;  3ELC A;  3CYP B;  1W3E X;  2Z01 A;  3N4Z A;  4X1Y A;  1X52 A;  2OTM A;  4ZHV A;  5EO3 A;  4C8G A;  3I56 F;  4B5C A;  2QI2 A;  3CD6 F;  5EYP A;  2HP0 B;  5C8Y B;  4G4W A;  1W5E A;  3K14 A;  3HKB A;  3VMF B;  1SZQ A;  2UYK A;  1VQ5 F;  1QVG F;  3RYC A;  4TV8 B;  3G6E F;  1W55 A;  4IIJ B;  3UT5 B;  4YJ3 A;  3JAL B;  3K12 A;  1RA4 A;  3S06 A;  3LWP C;  2IG8 A;  3RA6 A;  4BVS A;  4B46 A;  2N48 A;  3MQW A;  3EOR A;  3F6M A;  3C8L A;  5CA0 B;  3P10 A;  1U3P A;  4I4T B;  5C8Y A;  3K2X A;  1H48 A;  3D01 A;  4ZOL B;  4PWT A;  1YIJ F;  1VQP F;  1VQL F;  1UI9 A;  4TV8 A;  1W40 A;  1W57 A;  3CCE F;  4IIJ A;  3UT5 A;  3F0G A;  3F0E A;  4EI7 A;  3E1Y A;  4O2B B;  5J2T B;  1W5A A;  5J2U B;  3F0F A;  2UYN B;  3VTI C;  2ZOD A;  2BO1 A;  3P4E A;  4I4T A;  4YJ2 A;  3NMU C;  3CCU F;  3JAS B;  1YJN F;  4ZHQ B;  5IJ0 A;  1ODE A;  5LP6 C;  2OHW A;  3LWO C;  2V9Y A;  2IQQ A;  2RHH A;  3VOB A;  4O2B A;  3RYI B;  3KIZ A;  2HRY A;  5J2U A;  2UYN A;  5KMG B;  4NUT A;  2VXY A;  2Z1U A;  2KTV A;  4C82 A;  3HKD B;  3WJP A;  3QTY A;  3VCZ A;  1RQ7 A; 
#chains in the Genus database with same CATH homology
 2LBX A;  2VGM A;  2OTJ F;  3WXM B;  1GO0 A;  1VQ9 F;  1GO1 A;  3PAF A;  1Q81 H;  1Q82 H;  3LWR C;  1E7K A;  3GYQ A;  5G4V C;  3ON1 A;  1Q86 H;  1VQ8 F;  2JNB A;  1KC8 H;  2FGY A;  3CMA F;  3D00 A;  3CCR F;  5GAN K;  5HXU A;  3LWQ C;  3CG6 A;  1H7M A;  1YIT F;  2FC3 A;  2LBW A;  1GZ0 A;  1X7O A;  3CCQ F;  3LWV C;  1W3E X;  3CCV F;  3I55 F;  1CN7 A;  3N4Z A;  3V7E A;  1X52 A;  3NK6 A;  3LFO A;  5EO3 A;  4X3M A;  3I56 F;  2QI2 A;  5A2Q M;  3CD6 F;  3NVK E;  3OBY A;  1YJW F;  5HY4 A;  5HXZ A;  3CCS F;  3VMF B;  1VQM F;  3JAM M;  1K8A H;  1T0K B;  4BW0 B;  3SIU A;  5FJ4 C;  1VQ5 F;  3NK7 A;  4LCK A;  1QVG F;  3OBW A;  1PXW A;  1CK2 A;  4BVR A;  1W2B F;  3CC2 F;  3G6E F;  3OW2 F;  1VQO F;  3MCA B;  1YHQ F;  4NQ3 A;  4BVQ A;  5GIN C;  1KD1 H;  3NVI B;  1RA4 A;  1KQS F;  2HVY D;  3CXC F;  3HJW C;  3LWP C;  1IPA A;  1VQK F;  3RA6 A;  4BVS A;  3CC4 F;  2OZB A;  2GLZ A;  4C4W C;  5GIP C;  3CC7 F;  1W42 A;  1YI2 F;  3N4Y A;  2ALE A;  3FFM A;  1K73 H;  5HY2 A;  3CPW F;  5EWR A;  4BVT A;  1RLG A;  5GAP K;  2OTL F;  3CCJ F;  1YIJ F;  1VQP F;  1VQL F;  4XCQ A;  3O85 A;  1M90 H;  2AIF A;  1ZWZ A;  3CPQ A;  1VQN F;  1W40 A;  3CCE F;  1VQ7 F;  2I6D A;  1SDS A;  1X7P A;  3CCM F;  3HAX D;  3CCL F;  4EI9 A;  3G71 F;  4EI7 A;  4TZZ A;  3E1Y A;  1VQ4 F;  3V7Q A;  5DCV A;  5G4U C;  3AGK A;  3JCM M;  3CME F;  3PLA C;  2BO1 A;  5FLX M;  5HWE A;  2QEX F;  1NJI H;  2KTU A;  5HY1 A;  3NMU C;  3CCU F;  1VQ6 F;  5IT9 M;  1QVF F;  3G4S F;  3J7A R;  1YJN F;  1S72 F;  1NMU B;  3J81 M;  2CZW A;  5GIO C;  1W41 A;  4X3L A;  5HY0 A;  2WAL A;  1JJ2 F;  3IR9 A;  1K9M H;  4BY9 D;  3V3T A;  1DT9 A;  2OHW A;  1YJ9 F;  3LWO C;  1N8R H;  3J80 M;  2F9Z C;  3SIV A;  4EI8 A;  1M1K H;  3RA5 A;  3E20 B;  1XBI A;  2QA4 F;  2VGN A;  4NUT A;  1Q7Y H;  2KTV A;  3VI6 A;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...