3CPQA

Crystal structure of l30e a ribosomal protein from methanocaldococcus jannaschii dsm2661 (mj1044)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
MDVNKAIRTAVDTGKVILGSKRTIKFVKHGEGKLVVLAGNIPKDLEEDVKYYAKLSNIPVYQHKITSLELGAVCGKPFPVAALLVLDEGLSNIMELVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L30e
publication title Crystal Structure of L30e a ribosomal protein from Methanocaldococcus jannaschii DSM2661 (MJ1044)
rcsb
source organism Methanocaldococcus jannaschii
total genus 33
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cpqA00
1YIJF 2VGNA 2QA4F 1DT9A 3NK7A 3JAMM 5GAPK 2I6DA 2QEXF 3V7QA 1VQ9F 2OHWA 1W2BF 3NVKE 2HVYD 4BY9D 1RLGA 1W3EX 1E7KA 5IT9M 3J80M 1KQSF 2AIFA 1YJ9F 1VQ8F 1VQLF 3CCLF 2BO1A 1K9MH 2LBWA 3PLAC 1GO0A 4NUTA 1YITF 1Q7YH 5A2QM 1YJNF 1H7MA 4BW0B 5G4UC 3J7AR 3CCJF 2VGMA 2FC3A 3CC4F 3CCVF 1M90H 5FLXM 3O85A 1YI2F 3N4YA 5FJ4C 1Q82H 1T0KB 1CN7A 3E20B 3CCRF 3LFOA 3CMEF 4C4WC 2JNBA 1GZ0A 3V7EA 3CCSF 3CG6A 1VQMF 1Q81H 2WALA 5EO3A 1YJWF 3VI6A 1X52A 3JCMM 2OZBA 3OW2F 1VQNF 4X3LA 3IR9A 1X7OA 1VQPF 1CK2A 1S72F 3CPWF 1VQKF 1QVFF 1NMUB 3CMAF 5GANK 3CC7F 3I56F 3CC2F 1VQOF 1W40A 3MCAB 3LWVC 3HJWC 3CCQF 3PAFA 3LWQC 2LBXA 3GYQA 1M1KH 1NJIH 3G4SF 1ZWZA 3WXMB 3CCUF 2KTVA 3ON1A 5GIOC 3SIVA 1KD1H 1KC8H 3NMUC 3CD6F 5GINC 4LCKA 1SDSA 1N8RH 3VMFB 1PXWA 3SIUA 3RA5A 1IPAA 1W42A 1YHQF 1VQ7F 3AGKA 5GIPC 5EWRA 3N4ZA 1X7PA 3J81M 2QI2A 1JJ2F 4X3MA 2KG4A 3HAXD 1QVGF 2OTLF 2OTJF 3LWOC 5G4VC 1W41A 3CPQA 3I55F 3NK6A 3E1YA 3NVIB 3G6EF 3LWRC 5DCVA 1K8AH 2KTUA 1VQ4F 3OBWA 3CCEF 1RA4A 3LWPC 1VQ5F 3G71F 3CXCF 3CCMF 3FFMA 1VQ6F 1XBIA 2ALEA 1K73H 3RA6A 2CZWA 3OBYA 4TZZA 1GO1A 1Q86H
chains in the Genus database with same CATH superfamily
4HNAB 3C9SA 5BMVB 3FPIA 3NK7A 5CA0A 3RYIA 4B46A 5GAPK 3JAMM 2QEXF 1VQ9F 4BY9D 4BVSA 3F0EA 1SA0B 3HKCA 3M1XA 1VQ8F 3VYSC 3C9RA 1VQLF 3CCLF 4X20A 1K9MH 2N48A 5MN5A 1YITF 3V4DA 1Q7YH 3WGMA 1H7MA 3P10A 5FNVA 2F9ZC 3CC4F 5FLXM 3ZOPA 4E6EA 4G4XA 4U3JA 3RYIB 5CA0B 2L26A 4ZI7A 1XHOA 1ONIA 3CCRF 3KHNA 3CMEF 3C9TA 2CHTA 2H8CA 3HKCB 1OAPA 2WALA 4WBNA 1YJWF 1JFFA 3VI6A 1UI9A 3JCMM 5FNVB 1X7OA 4M8IA 1DBFA 4EI7A 1S72F 2ZOVA 3HKEA 4X1YA 1NMUB 2Z1TA 4U3JB 2UYKA 1X25A 3CC7F 3U0OA 4YJ3A 2LBTA 4ZI7B 3CC2F 3CYQA 2UYPA 3MQWA 3IEQA 3LWVC 3T80A 4O4HA 3N2GB 3S06A 4I4TA 3F6MA 3GYQA 3HTNA 1U43A 1W581 1TVKA 4LNUA 3G4SF 4WBNB 3WXMB 4C8IA 1JFFB 3WGKA 1PF5A 5EB1B 1VHAA 2KTVA 3M4SA 3ON1A 3KIZA 3K0TA 1OFUA 5IYZA 3HKEB 3KJKA 3ERNA 4X1YB 1N8RH 4BVQA 1GX1A 3SIUA 4PWTA 5HY2A 2Z1UA 1U40A 4YJ3B 3P4EA 1IPAA 3IMPA 3AGKA 4O4HB 4XCQA 2HQSC 3J81M 4R40B 2QTPA 4I4TB 4O4JB 1JJ2F 3I7TA 3HAXD 2OTLF 2OTJF 1W41A 1TVKB 2V9YA 4LNUB 3IKFA 3I55F 4X1IB 4B62A 5JQGA 3G6EF 3N2KA 2ZAUA 1RQ2A 2HS3A 1VQ4F 3Q8HA 5HY4A 2AIZP 3OONA 3OBWA 2ZVYA 3EORA 3CCEF 3BYQA 2I6RA 3CCMF 1XBIA 1K73H 3WGLA 1QD9A 3OBYA 3RYFA 1Z5VA 3K2XA 1YIJF 1JD1A 3ZP4A 4ZOLA 4FFBA 5EIBC 1IV3A 3N2KB 2OHWA 1W2BF 4HNAA 3ZP7A 3NVKE 5BMVA 1E7KA 2HP3A 3J80M 1YJ9F 2VAPA 2BO1A 3PLAC 3C9UA 4C8EA 1YJNF 2Q1YA 5KX5B 2Z1FA 5G4UC 3J7AR 2BTUA 3M84A 2ZODA 2FC3A 3IKEA 3RYFB 3VIUA 1YI2F 3UT5A 2UYNA 3N4YA 4ZOLB 4FFBB 5FJ4C 1T0KB 1CN7A 1COMA 5EIBD 4I50A 5KMGA 4C82A 5MN6A 2HP0A 1QU9A 3JASB 3V7EA 3CCSF 1ODEA 2HS0A 2VXYA 3FD6A 5LA6A 5CB4B 4BT6A 1TUBA 1W5AA 3C8LA 4X3LA 2HX0A 3IR9A 1KNKA 3JARB 2ZVZA 1W5FA 4NQ3A 3UT5B 3CPWF 3VO8A 1QVFF 2UYNB 4X1KA 3E22A 5C8YB 1W59A 2HS4A 4I50B 5KMGB 1W40A 3JAKA 5JH7A 3HJWC 2HP0B 4BT7A 1Q8RA 1U3PA 1FSZA 3IEWA 3N2GA 5LA6B 2CHSA 1ZWZA 1TUBB 2CVLA 3GTZA 3FD5A 1VQVA 3F0GA 1XRGA 2RHJA 4NWOB 5IJ9A 5GIOC 1KD1H 2P6YA 4ZHQA 4LCKA 4ERHA 4X1KB 3E22B 4BT3A 2NMUA 3JAKB 4BVRA 5JH7B 3N4ZA 4O4LA 2QI2A 1U3LA 3JALA 1H48A 2PHNA 1IV1A 2W8BC 3JAWA 4O4JA 3NVIB 4ZHYB 4G88A 3LWRC 2DT4A 5DCVA 3DC2A 1K8AH 4G4WA 4X1IA 2KTUA 4EI8A 5IJ9B 3MBMA 4TV8A 4ZHQB 5HP8A 1IV4A 3KE1A 3CXCF 3FFMA 3VYTC 1R1MA 4O4LB 4BT4A 3RA6A 2BTQB 4TZZA 1GO1A 3K12A 3JALB 2IAFA 4DXDA 3D01A 1W5EA 3JAWB 2GZLA 2VGNA 3JATB 3V7QA 1RLUA 2HVYD 5ITZA 1W3EX 3TD3A 3HKDA 4TV8B 5LYJA 5IT9M 1KQSF 2AIFA 3VTIC 4BT5A 3GHZA 5HY1A 3LYBA 5LXTA 4G4VA 3D54A 2RB9A 4BW0B 3VCZA 3CCJF 4EB6A 5GONA 2VAWA 2OTMA 1M90H 3CYPB 4G4ZA 5KX5A 1QAHA 2DYYA 1XV2A 5HWEA 5ITZB 4O2BA 2UYJA 3MDOA 3HKDB 5LYJB 3ZO8A 1JY8A 2JNBA 2G9IA 3K14A 4C8GA 5JCOC 1Q81H 5LXTB 3JASA 5EO3A 3VOAA 1X52A 1J7HA 5IJ0A 1VQPF 5CB4A 1CK2A 4EB6B 5GONB 3JVHA 2GLZA 4ZHVA 2R751 3JARA 5GANK 5EZYA 3I56F 3CB2A 4KWEA 4ZK7A 1VQOF 3R0PA 4O2BB 1H47A 2BTOA 3LWQC 2RHHA 5JVDB 5C8YA 4I55A 3F0DA 1M1KH 4DRXA 2IG8A 3CCUF 3L7QA 4RQOA 5IJ0B 3SIVA 3MCQA 2MQEA 1KC8H 3CD6F 2AMTA 1SDSA 1PXWA 3KJJA 1FNKA 2B33A 3RA5A 5EB0A 5EZYB 5HP7A 1W42A 4IHJA 1VQ7F 3QHDA 5HXZA 3DDNA 4I55B 2KG4A 1FNJA 5G4VC 4DRXB 3HKBA 3NK6A 3LDTA 2HRUA 4ZHWA 4BT2A 5HY0A 1RA4A 1W57A 1VQ5F 3G71F 3S0YA 1NQ3A 4IHJB 5LP6C 5J2UA 3TD5A 4O2AA 2CZWA 3WGNA 3WJRA 3S02A 1Q86H 3HKBB 2PMPA 3V3TA 4EI9A 2QA4F 1DT9A 5EYPA 3S0WA 3WPWA 2I6DA 3LMEA 5MN4A 4TUYA 1RLGA 1W5BA 3JATA 5B8FA 4X20B 3RYCA 2GVIA 3FBAA 3ELCA 1SZQA 2R6R1 2LBWA 1GO0A 2HRYA 3QUWA 4O4IA 4NUTA 5J2UB 4O2AB 5A2QM 2IQQA 2VGMA 4U39A 3F0FA 3CCVF 4B45A 2Q1XA 3O85A 5LP6A 5EYPB 3VYUC 1Q82H 3E20B 1RQ7A 3LFOA 4TUYB 3RYCB 4IIJA 2UZHA 4C4WC 3HWUA 1GZ0A 5CA1A 3CG6A 4TV9A 1VQMF 4O4IB 1CLIA 4F6RA 3I3FA 3P0ZA 2OZBA 3OW2F 1VQNF 2CWJA 2YYEA 1KNJA 2RHOA 3WPXA 4B5CA 4G4YA 3RE3A 4C81A 5LP6B 1VQKF 4YJ2A 3CMAF 3RYHA 3MCAB 3CCQF 3PAFA 4IIJB 3D00A 2LBXA 5CA1B 1YGYA 4TV9B 2CSLA 2LCAA 5JVDA 1NJIH 3S03A 4F6RB 2Z1EA 5LOVA 1T0AA 5IYZB 5J2TA 1FFXA 2EWCA 3NMUC 3WJPA 5GINC 3VMFB 2CW4A 4YJ2B 4RHAA 4BVTA 2Z01A 5HXUA 2H8EA 1IV2A 1YHQF 1W55A 1VH8A 5GIPC 3RYHB 1JN1A 1Z5WA 5EWRA 1X7PA 4X3MA 2VAMA 1QVGF 5JQGB 3LWOC 2RHLA 3CPQA 5AVMA 3TD4A 5LOVB 3E1YA 2ZF8A 5J2TB 1FFXB 1YQNA 3ESJA 5EAZA 2YXZA 3WJQA 1SA0A 1VK3A 5JCOA 2FGYA 3QTYA 3LWPC 3WGJA 2K1SA 1UFYA 2H6LA 1VQ6F 2ALEA 3B6NA 3S0HA 3VOBA 2KGWA
chains in the Genus database with same CATH topology
1YIJF 3V3TA 4EI9A 2VGNA 2QA4F 1DT9A 3NK7A 3JAMM 5GAPK 2I6DA 2QEXF 3V7QA 1VQ9F 2OHWA 1W2BF 3NVKE 2HVYD 4BY9D 1RLGA 4BVSA 1W3EX 1E7KA 5IT9M 3J80M 1KQSF 2AIFA 1YJ9F 1VQ8F 1VQLF 3CCLF 2BO1A 5HY1A 1K9MH 2LBWA 3PLAC 1GO0A 4NUTA 1YITF 1Q7YH 5A2QM 1YJNF 1H7MA 4BW0B 5G4UC 3J7AR 3CCJF 2F9ZC 2VGMA 2FC3A 3CC4F 3CCVF 1M90H 5FLXM 3O85A 1YI2F 3N4YA 5FJ4C 1Q82H 1T0KB 1CN7A 5HWEA 3E20B 3CCRF 3LFOA 3CMEF 4C4WC 2JNBA 1GZ0A 3V7EA 3CCSF 3CG6A 1VQMF 1Q81H 2WALA 5EO3A 1YJWF 3VI6A 1X52A 3JCMM 2OZBA 3OW2F 1VQNF 4X3LA 3IR9A 1X7OA 1VQPF 1CK2A 4EI7A 1S72F 4NQ3A 2GLZA 3CPWF 1VQKF 1QVFF 1NMUB 3CMAF 5GANK 3CC7F 3I56F 3CC2F 1VQOF 1W40A 3MCAB 3LWVC 3HJWC 3CCQF 3PAFA 3LWQC 3D00A 2LBXA 3GYQA 1M1KH 1NJIH 3G4SF 1ZWZA 3WXMB 3CCUF 2KTVA 3ON1A 5GIOC 3SIVA 1KD1H 1KC8H 3NMUC 3CD6F 5GINC 4LCKA 1SDSA 1N8RH 3VMFB 1PXWA 4BVQA 3SIUA 4BVTA 5HY2A 3RA5A 5HXUA 1IPAA 1W42A 1YHQF 1VQ7F 3AGKA 5GIPC 4BVRA 5EWRA 3N4ZA 4XCQA 1X7PA 5HXZA 3J81M 2QI2A 1JJ2F 4X3MA 2KG4A 3HAXD 1QVGF 2OTLF 2OTJF 3LWOC 5G4VC 1W41A 3CPQA 3I55F 3NK6A 3E1YA 3NVIB 3G6EF 3LWRC 5DCVA 1K8AH 4EI8A 2KTUA 1VQ4F 5HY4A 3OBWA 2FGYA 5HY0A 3CCEF 1RA4A 3LWPC 1VQ5F 3G71F 3CXCF 3CCMF 3FFMA 1VQ6F 1XBIA 2ALEA 1K73H 3RA6A 2CZWA 3OBYA 4TZZA 1GO1A 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ F;  2VGN A;  2QA4 F;  1DT9 A;  3NK7 A;  3JAM M;  5GAP K;  2I6D A;  2QEX F;  3V7Q A;  1VQ9 F;  2OHW A;  1W2B F;  3NVK E;  2HVY D;  4BY9 D;  1RLG A;  1W3E X;  1E7K A;  5IT9 M;  3J80 M;  1KQS F;  2AIF A;  1YJ9 F;  1VQ8 F;  1VQL F;  3CCL F;  2BO1 A;  1K9M H;  2LBW A;  3PLA C;  1GO0 A;  4NUT A;  1YIT F;  1Q7Y H;  5A2Q M;  1YJN F;  1H7M A;  4BW0 B;  5G4U C;  3J7A R;  3CCJ F;  2VGM A;  2FC3 A;  3CC4 F;  3CCV F;  1M90 H;  5FLX M;  3O85 A;  1YI2 F;  3N4Y A;  5FJ4 C;  1Q82 H;  1T0K B;  1CN7 A;  3E20 B;  3CCR F;  3LFO A;  3CME F;  4C4W C;  2JNB A;  1GZ0 A;  3V7E A;  3CCS F;  3CG6 A;  1VQM F;  1Q81 H;  2WAL A;  5EO3 A;  1YJW F;  3VI6 A;  1X52 A;  3JCM M;  2OZB A;  3OW2 F;  1VQN F;  4X3L A;  3IR9 A;  1X7O A;  1VQP F;  1CK2 A;  1S72 F;  3CPW F;  1VQK F;  1QVF F;  1NMU B;  3CMA F;  5GAN K;  3CC7 F;  3I56 F;  3CC2 F;  1VQO F;  1W40 A;  3MCA B;  3LWV C;  3HJW C;  3CCQ F;  3PAF A;  3LWQ C;  2LBX A;  3GYQ A;  1M1K H;  1NJI H;  3G4S F;  1ZWZ A;  3WXM B;  3CCU F;  2KTV A;  3ON1 A;  5GIO C;  3SIV A;  1KD1 H;  1KC8 H;  3NMU C;  3CD6 F;  5GIN C;  4LCK A;  1SDS A;  1N8R H;  3VMF B;  1PXW A;  3SIU A;  3RA5 A;  1IPA A;  1W42 A;  1YHQ F;  1VQ7 F;  3AGK A;  5GIP C;  5EWR A;  3N4Z A;  1X7P A;  3J81 M;  2QI2 A;  1JJ2 F;  4X3M A;  2KG4 A;  3HAX D;  1QVG F;  2OTL F;  2OTJ F;  3LWO C;  5G4V C;  1W41 A;  3CPQ A;  3I55 F;  3NK6 A;  3E1Y A;  3NVI B;  3G6E F;  3LWR C;  5DCV A;  1K8A H;  2KTU A;  1VQ4 F;  3OBW A;  3CCE F;  1RA4 A;  3LWP C;  1VQ5 F;  3G71 F;  3CXC F;  3CCM F;  3FFM A;  1VQ6 F;  1XBI A;  2ALE A;  1K73 H;  3RA6 A;  2CZW A;  3OBY A;  4TZZ A;  1GO1 A;  1Q86 H; 
#chains in the Genus database with same CATH topology
 4HNA B;  3C9S A;  5BMV B;  3FPI A;  3NK7 A;  5CA0 A;  3RYI A;  4B46 A;  5GAP K;  3JAM M;  2QEX F;  1VQ9 F;  4BY9 D;  4BVS A;  3F0E A;  1SA0 B;  3HKC A;  3M1X A;  1VQ8 F;  3VYS C;  3C9R A;  1VQL F;  3CCL F;  4X20 A;  1K9M H;  2N48 A;  5MN5 A;  1YIT F;  3V4D A;  1Q7Y H;  3WGM A;  1H7M A;  3P10 A;  5FNV A;  2F9Z C;  3CC4 F;  5FLX M;  3ZOP A;  4E6E A;  4G4X A;  4U3J A;  3RYI B;  5CA0 B;  2L26 A;  4ZI7 A;  1XHO A;  1ONI A;  3CCR F;  3KHN A;  3CME F;  3C9T A;  2CHT A;  2H8C A;  3HKC B;  1OAP A;  2WAL A;  4WBN A;  1YJW F;  1JFF A;  3VI6 A;  1UI9 A;  3JCM M;  5FNV B;  1X7O A;  4M8I A;  1DBF A;  4EI7 A;  1S72 F;  2ZOV A;  3HKE A;  4X1Y A;  1NMU B;  2Z1T A;  4U3J B;  2UYK A;  1X25 A;  3CC7 F;  3U0O A;  4YJ3 A;  2LBT A;  4ZI7 B;  3CC2 F;  3CYQ A;  2UYP A;  3MQW A;  3IEQ A;  3LWV C;  3T80 A;  4O4H A;  3N2G B;  3S06 A;  4I4T A;  3F6M A;  3GYQ A;  3HTN A;  1U43 A;  1W58 1;  1TVK A;  4LNU A;  3G4S F;  4WBN B;  3WXM B;  4C8I A;  1JFF B;  3WGK A;  1PF5 A;  5EB1 B;  1VHA A;  2KTV A;  3M4S A;  3ON1 A;  3KIZ A;  3K0T A;  1OFU A;  5IYZ A;  3HKE B;  3KJK A;  3ERN A;  4X1Y B;  1N8R H;  4BVQ A;  1GX1 A;  3SIU A;  4PWT A;  5HY2 A;  2Z1U A;  1U40 A;  4YJ3 B;  3P4E A;  1IPA A;  3IMP A;  3AGK A;  4O4H B;  4XCQ A;  2HQS C;  3J81 M;  4R40 B;  2QTP A;  4I4T B;  4O4J B;  1JJ2 F;  3I7T A;  3HAX D;  2OTL F;  2OTJ F;  1W41 A;  1TVK B;  2V9Y A;  4LNU B;  3IKF A;  3I55 F;  4X1I B;  4B62 A;  5JQG A;  3G6E F;  3N2K A;  2ZAU A;  1RQ2 A;  2HS3 A;  1VQ4 F;  3Q8H A;  5HY4 A;  2AIZ P;  3OON A;  3OBW A;  2ZVY A;  3EOR A;  3CCE F;  3BYQ A;  2I6R A;  3CCM F;  1XBI A;  1K73 H;  3WGL A;  1QD9 A;  3OBY A;  3RYF A;  1Z5V A;  3K2X A;  1YIJ F;  1JD1 A;  3ZP4 A;  4ZOL A;  4FFB A;  5EIB C;  1IV3 A;  3N2K B;  2OHW A;  1W2B F;  4HNA A;  3ZP7 A;  3NVK E;  5BMV A;  1E7K A;  2HP3 A;  3J80 M;  1YJ9 F;  2VAP A;  2BO1 A;  3PLA C;  3C9U A;  4C8E A;  1YJN F;  2Q1Y A;  5KX5 B;  2Z1F A;  5G4U C;  3J7A R;  2BTU A;  3M84 A;  2ZOD A;  2FC3 A;  3IKE A;  3RYF B;  3VIU A;  1YI2 F;  3UT5 A;  2UYN A;  3N4Y A;  4ZOL B;  4FFB B;  5FJ4 C;  1T0K B;  1CN7 A;  1COM A;  5EIB D;  4I50 A;  5KMG A;  4C82 A;  5MN6 A;  2HP0 A;  1QU9 A;  3JAS B;  3V7E A;  3CCS F;  1ODE A;  2HS0 A;  2VXY A;  3FD6 A;  5LA6 A;  5CB4 B;  4BT6 A;  1TUB A;  1W5A A;  3C8L A;  4X3L A;  2HX0 A;  3IR9 A;  1KNK A;  3JAR B;  2ZVZ A;  1W5F A;  4NQ3 A;  3UT5 B;  3CPW F;  3VO8 A;  1QVF F;  2UYN B;  4X1K A;  3E22 A;  5C8Y B;  1W59 A;  2HS4 A;  4I50 B;  5KMG B;  1W40 A;  3JAK A;  5JH7 A;  3HJW C;  2HP0 B;  4BT7 A;  1Q8R A;  1U3P A;  1FSZ A;  3IEW A;  3N2G A;  5LA6 B;  2CHS A;  1ZWZ A;  1TUB B;  2CVL A;  3GTZ A;  3FD5 A;  1VQV A;  3F0G A;  1XRG A;  2RHJ A;  4NWO B;  5IJ9 A;  5GIO C;  1KD1 H;  2P6Y A;  4ZHQ A;  4LCK A;  4ERH A;  4X1K B;  3E22 B;  4BT3 A;  2NMU A;  3JAK B;  4BVR A;  5JH7 B;  3N4Z A;  4O4L A;  2QI2 A;  1U3L A;  3JAL A;  1H48 A;  2PHN A;  1IV1 A;  2W8B C;  3JAW A;  4O4J A;  3NVI B;  4ZHY B;  4G88 A;  3LWR C;  2DT4 A;  5DCV A;  3DC2 A;  1K8A H;  4G4W A;  4X1I A;  2KTU A;  4EI8 A;  5IJ9 B;  3MBM A;  4TV8 A;  4ZHQ B;  5HP8 A;  1IV4 A;  3KE1 A;  3CXC F;  3FFM A;  3VYT C;  1R1M A;  4O4L B;  4BT4 A;  3RA6 A;  2BTQ B;  4TZZ A;  1GO1 A;  3K12 A;  3JAL B;  2IAF A;  4DXD A;  3D01 A;  1W5E A;  3JAW B;  2GZL A;  2VGN A;  3JAT B;  3V7Q A;  1RLU A;  2HVY D;  5ITZ A;  1W3E X;  3TD3 A;  3HKD A;  4TV8 B;  5LYJ A;  5IT9 M;  1KQS F;  2AIF A;  3VTI C;  4BT5 A;  3GHZ A;  5HY1 A;  3LYB A;  5LXT A;  4G4V A;  3D54 A;  2RB9 A;  4BW0 B;  3VCZ A;  3CCJ F;  4EB6 A;  5GON A;  2VAW A;  2OTM A;  1M90 H;  3CYP B;  4G4Z A;  5KX5 A;  1QAH A;  2DYY A;  1XV2 A;  5HWE A;  5ITZ B;  4O2B A;  2UYJ A;  3MDO A;  3HKD B;  5LYJ B;  3ZO8 A;  1JY8 A;  2JNB A;  2G9I A;  3K14 A;  4C8G A;  5JCO C;  1Q81 H;  5LXT B;  3JAS A;  5EO3 A;  3VOA A;  1X52 A;  1J7H A;  5IJ0 A;  1VQP F;  5CB4 A;  1CK2 A;  4EB6 B;  5GON B;  3JVH A;  2GLZ A;  4ZHV A;  2R75 1;  3JAR A;  5GAN K;  5EZY A;  3I56 F;  3CB2 A;  4KWE A;  4ZK7 A;  1VQO F;  3R0P A;  4O2B B;  1H47 A;  2BTO A;  3LWQ C;  2RHH A;  5JVD B;  5C8Y A;  4I55 A;  3F0D A;  1M1K H;  4DRX A;  2IG8 A;  3CCU F;  3L7Q A;  4RQO A;  5IJ0 B;  3SIV A;  3MCQ A;  2MQE A;  1KC8 H;  3CD6 F;  2AMT A;  1SDS A;  1PXW A;  3KJJ A;  1FNK A;  2B33 A;  3RA5 A;  5EB0 A;  5EZY B;  5HP7 A;  1W42 A;  4IHJ A;  1VQ7 F;  3QHD A;  5HXZ A;  3DDN A;  4I55 B;  2KG4 A;  1FNJ A;  5G4V C;  4DRX B;  3HKB A;  3NK6 A;  3LDT A;  2HRU A;  4ZHW A;  4BT2 A;  5HY0 A;  1RA4 A;  1W57 A;  1VQ5 F;  3G71 F;  3S0Y A;  1NQ3 A;  4IHJ B;  5LP6 C;  5J2U A;  3TD5 A;  4O2A A;  2CZW A;  3WGN A;  3WJR A;  3S02 A;  1Q86 H;  3HKB B;  2PMP A;  3V3T A;  4EI9 A;  2QA4 F;  1DT9 A;  5EYP A;  3S0W A;  3WPW A;  2I6D A;  3LME A;  5MN4 A;  4TUY A;  1RLG A;  1W5B A;  3JAT A;  5B8F A;  4X20 B;  3RYC A;  2GVI A;  3FBA A;  3ELC A;  1SZQ A;  2R6R 1;  2LBW A;  1GO0 A;  2HRY A;  3QUW A;  4O4I A;  4NUT A;  5J2U B;  4O2A B;  5A2Q M;  2IQQ A;  2VGM A;  4U39 A;  3F0F A;  3CCV F;  4B45 A;  2Q1X A;  3O85 A;  5LP6 A;  5EYP B;  3VYU C;  1Q82 H;  3E20 B;  1RQ7 A;  3LFO A;  4TUY B;  3RYC B;  4IIJ A;  2UZH A;  4C4W C;  3HWU A;  1GZ0 A;  5CA1 A;  3CG6 A;  4TV9 A;  1VQM F;  4O4I B;  1CLI A;  4F6R A;  3I3F A;  3P0Z A;  2OZB A;  3OW2 F;  1VQN F;  2CWJ A;  2YYE A;  1KNJ A;  2RHO A;  3WPX A;  4B5C A;  4G4Y A;  3RE3 A;  4C81 A;  5LP6 B;  1VQK F;  4YJ2 A;  3CMA F;  3RYH A;  3MCA B;  3CCQ F;  3PAF A;  4IIJ B;  3D00 A;  2LBX A;  5CA1 B;  1YGY A;  4TV9 B;  2CSL A;  2LCA A;  5JVD A;  1NJI H;  3S03 A;  4F6R B;  2Z1E A;  5LOV A;  1T0A A;  5IYZ B;  5J2T A;  1FFX A;  2EWC A;  3NMU C;  3WJP A;  5GIN C;  3VMF B;  2CW4 A;  4YJ2 B;  4RHA A;  4BVT A;  2Z01 A;  5HXU A;  2H8E A;  1IV2 A;  1YHQ F;  1W55 A;  1VH8 A;  5GIP C;  3RYH B;  1JN1 A;  1Z5W A;  5EWR A;  1X7P A;  4X3M A;  2VAM A;  1QVG F;  5JQG B;  3LWO C;  2RHL A;  3CPQ A;  5AVM A;  3TD4 A;  5LOV B;  3E1Y A;  2ZF8 A;  5J2T B;  1FFX B;  1YQN A;  3ESJ A;  5EAZ A;  2YXZ A;  3WJQ A;  1SA0 A;  1VK3 A;  5JCO A;  2FGY A;  3QTY A;  3LWP C;  3WGJ A;  2K1S A;  1UFY A;  2H6L A;  1VQ6 F;  2ALE A;  3B6N A;  3S0H A;  3VOB A;  2KGW A; 
#chains in the Genus database with same CATH homology
 1YIJ F;  3V3T A;  4EI9 A;  2VGN A;  2QA4 F;  1DT9 A;  3NK7 A;  3JAM M;  5GAP K;  2I6D A;  2QEX F;  3V7Q A;  1VQ9 F;  2OHW A;  1W2B F;  3NVK E;  2HVY D;  4BY9 D;  1RLG A;  4BVS A;  1W3E X;  1E7K A;  5IT9 M;  3J80 M;  1KQS F;  2AIF A;  1YJ9 F;  1VQ8 F;  1VQL F;  3CCL F;  2BO1 A;  5HY1 A;  1K9M H;  2LBW A;  3PLA C;  1GO0 A;  4NUT A;  1YIT F;  1Q7Y H;  5A2Q M;  1YJN F;  1H7M A;  4BW0 B;  5G4U C;  3J7A R;  3CCJ F;  2F9Z C;  2VGM A;  2FC3 A;  3CC4 F;  3CCV F;  1M90 H;  5FLX M;  3O85 A;  1YI2 F;  3N4Y A;  5FJ4 C;  1Q82 H;  1T0K B;  1CN7 A;  5HWE A;  3E20 B;  3CCR F;  3LFO A;  3CME F;  4C4W C;  2JNB A;  1GZ0 A;  3V7E A;  3CCS F;  3CG6 A;  1VQM F;  1Q81 H;  2WAL A;  5EO3 A;  1YJW F;  3VI6 A;  1X52 A;  3JCM M;  2OZB A;  3OW2 F;  1VQN F;  4X3L A;  3IR9 A;  1X7O A;  1VQP F;  1CK2 A;  4EI7 A;  1S72 F;  4NQ3 A;  2GLZ A;  3CPW F;  1VQK F;  1QVF F;  1NMU B;  3CMA F;  5GAN K;  3CC7 F;  3I56 F;  3CC2 F;  1VQO F;  1W40 A;  3MCA B;  3LWV C;  3HJW C;  3CCQ F;  3PAF A;  3LWQ C;  3D00 A;  2LBX A;  3GYQ A;  1M1K H;  1NJI H;  3G4S F;  1ZWZ A;  3WXM B;  3CCU F;  2KTV A;  3ON1 A;  5GIO C;  3SIV A;  1KD1 H;  1KC8 H;  3NMU C;  3CD6 F;  5GIN C;  4LCK A;  1SDS A;  1N8R H;  3VMF B;  1PXW A;  4BVQ A;  3SIU A;  4BVT A;  5HY2 A;  3RA5 A;  5HXU A;  1IPA A;  1W42 A;  1YHQ F;  1VQ7 F;  3AGK A;  5GIP C;  4BVR A;  5EWR A;  3N4Z A;  4XCQ A;  1X7P A;  5HXZ A;  3J81 M;  2QI2 A;  1JJ2 F;  4X3M A;  2KG4 A;  3HAX D;  1QVG F;  2OTL F;  2OTJ F;  3LWO C;  5G4V C;  1W41 A;  3CPQ A;  3I55 F;  3NK6 A;  3E1Y A;  3NVI B;  3G6E F;  3LWR C;  5DCV A;  1K8A H;  4EI8 A;  2KTU A;  1VQ4 F;  5HY4 A;  3OBW A;  2FGY A;  5HY0 A;  3CCE F;  1RA4 A;  3LWP C;  1VQ5 F;  3G71 F;  3CXC F;  3CCM F;  3FFM A;  1VQ6 F;  1XBI A;  2ALE A;  1K73 H;  3RA6 A;  2CZW A;  3OBY A;  4TZZ A;  1GO1 A;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...