1J7HA

Solution structure of hi0719, a hypothetical protein from haemophilus influenzae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'MMTQIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEVPADIVAQARQSLENVKAIIEKAGLTAADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNFPARSCVEVARLPKDVGLEIEAIAVRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HI0719
molecule tags Unknown function
source organism Haemophilus influenzae
publication title Solution Structure and Functional Ligand Screening of HI0719, a Highly Conserved Protein from Bacteria to Humans in the YjgF/YER057c/UK114 Family
pubmed doi rcsb
total genus 22
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1j7hA00
2EWCA 1XRGA 2CHSA 3ZOPA 1FNKA 3KJJA 3L7QA 3VCZA 5HP7A 1ODEA 2CHTA 2UYNB 2CWJA 1XHOA 3M1XA 3ZP7A 4ZK7A 3R0PA 1PF5A 2CW4A 2UYPA 1X25A 2DYYA 1QU9A 1UFYA 3I3FA 4NWOB 3ZP4A 1J7HA 5HP8A 1NQ3A 3D01A 3LYBA 3M4SA 2OTMA 1QD9A 3I7TA 3QUWA 2UYKA 3V4DA 2B33A 2CVLA 3GTZA 1QAHA 2IG8A 1DBFA 3K12A 2UYJA 1COMA 1JD1A 1FNJA 3K0TA 3KJKA 3MQWA 1ONIA 3ZO8A 2CSLA 1UI9A 2UYNA 3LMEA
chains in the Genus database with same CATH superfamily
3JATB 3VCZA 2RHJA 3RYHA 3DC2A 2PHNA 3HWUA 1W41A 3C9RA 4EB6A 4PWTA 4BT2A 3CCVF 1QVGF 3ZP4A 4EB6B 3MDOA 1RA4A 3CYQA 3QUWA 2ZF8A 1YIJF 3FBAA 2YYEA 1W5EA 5HY0A 3WXMB 1PXWA 2QA4F 3S03A 4DXDA 2YXZA 1Q82H 2HQSC 3OBWA 3LWQC 1VQ5F 3HAXD 3MCAB 3U0OA 1TVKB 4FFBB 1NMUB 3ZP7A 2BO1A 5GINC 2HP0B 3IR9A 2HRYA 5EWRA 4HNAA 1QU9A 2I6DA 2Z01A 5C8YB 1Q86H 3E20B 3CXCF 4LCKA 1U43A 4I50B 3LYBA 1X7PA 4C8EA 3JAKB 2VAMA 1M90H 4X3MA 3VYSC 2LBTA 2Q1YA 4BT3A 3JAKA 4O4IA 1RQ2A 1COMA 1NJIH 1JD1A 3D00A 1VHAA 2CSLA 1UI9A 3LMEA 4O4IB 1YGYA 2VAWA 4U39A 3KJJA 4BVQA 2OTLF 1CK2A 5ITZB 2CHTA 2RHOA 1XHOA 2KTUA 3CCLF 4R40B 3VYUC 1SA0A 1X25A 2OHWA 3WGKA 1SA0B 3ESJA 4X1KB 1W3EX 3CPWF 4U3JB 4C8IA 5IT9M 1GO1A 3HKDA 3CPQA 4U3JA 5GIOC 2CZWA 3KJKA 1RQ7A 5LA6A 3RE3A 5GAPK 3KE1A 3HKDB 2EWCA 4B46A 5IJ9A 1JFFA 5G4VC 4TV8B 4IIJB 2VAPA 4X20B 5IJ0B 4C8GA 5IJ9B 1Z5WA 1JFFB 2HRUA 3RYCB 2DYYA 3WGNA 4NWOB 3I3FA 4BVRA 5CA0A 1FSZA 1VQ6F 3G71F 4YJ3A 4TZZA 3SIUA 1Q8RA 2V9YA 5CA0B 4O4LA 1W581 5EIBD 5EAZA 2H8CA 3RYHB 3J7AR 5CA1A 1K73H 3CYPB 3CCSF 4O4JA 3FD6A 5CA1B 5HXUA 3WJQA 3N2KA 1JJ2F 4XCQA 3N2GB 5KMGB 4F6RA 2Z1UA 3WJPA 4C82A 3N2GA 1IPAA 3CCJF 3FD5A 3K2XA 2GZLA 1KNKA 1H7MA 3WGJA 2Q1XA 2B33A 4BVSA 4BT7A 2ZVZA 2UYJA 3B6NA 1TVKA 4FFBA 2R751 4O2AB 5CB4A 4BT6A 5MN5A 3F6MA 5EZYA 3P4EA 5JVDB 4ERHA 4O2AA 5CB4B 1VK3A 5EYPA 2HVYD 1VQVA 4IHJA 5AVMA 1H48A 3M1XA 5EZYB 1DT9A 3R0PA 5JVDA 3G6EF 2I6RA 2Z1FA 2CW4A 3C9UA 5C8YA 2RHHA 4I50A 1VQLF 1GX1A 3C9TA 5HWEA 3S06A 5GANK 5FNVA 3M4SA 4ZHQA 3CCUF 1X7OA 3N4ZA 1VQ4F 3D54A 4ZHQB 5IYZA 2NMUA 5HY1A 2UZHA 3LFOA 2Z1TA 5IYZB 3BYQA 5LYJB 3NVKE 1FNKA 1H47A 2BTOA 2L26A 3GHZA 3JALB 5HY2A 3LWVC 3CMAF 3E22A 2QEXF 2BTQB 4X1KA 2GLZA 3S0WA 1CN7A 1Q7YH 1Z5VA 3V4DA 4RQOA 1KC8H 2IG8A 3JAWA 1GO0A 2HS4A 4YJ2B 2UYNA 3C9SA 3JAWB 5EO3A 1YITF 4IIJA 1IV4A 2IQQA 4X20A 1XRGA 5IJ0A 3CCEF 1YI2F 1T0KB 4YJ2A 2UYNB 1IV1A 3RYCA 1VQOF 3I55F 1XV2A 2BTUA 3VO8A 3KIZA 4DRXB 5JH7A 3VIUA 3MCQA 1YJNF 1RLGA 4DRXA 5JH7B 4NQ3A 4O4LB 4BY9D 1T0AA 3HKBA 2FGYA 1CLIA 5J2UB 3P10A 3HKCA 3JAMM 4O4JB 3ZO8A 3TD3A 3RA6A 3N2KB 2ZOVA 3V7QA 3NK7A 2N48A 3M84A 5HP7A 5GONA 4BVTA 3RYIA 5KMGA 2CWJA 5JCOC 1PF5A 3F0FA 4G88A 2K1SA 5GONB 2HX0A 3ERNA 3VMFB 1K9MH 4G4WA 3IEQA 1IV2A 3SIVA 3CC7F 3J81M 4O4HB 3S0HA 4KWEA 1QAHA 3NMUC 2OZBA 1KQSF 3RYFB 3UT5B 1YJ9F 5EYPB 1W40A 1GZ0A 3S02A 4IHJB 3RYFA 3O85A 3UT5A 5LXTA 1YQNA 3OBYA 1W5FA 3JVHA 4TUYB 3GYQA 4B45A 3PAFA 5FJ4C 2G9IA 3CB2A 4I55A 5LXTB 2UYPA 4LNUB 4O2BA 5EB1B 4TUYA 5FNVB 4X1YA 3V3TA 3LWPC 1W5AA 3D01A 2JNBA 3RA5A 2WALA 2ZAUA 4X1YB 3J80M 3WJRA 4ZHYB 2AMTA 3EORA 3V7EA 3TD4A 1YJWF 3OW2F 4ZHVA 5MN6A 5A2QM 2HP3A 3IKFA 5LYJA 4BW0B 5BMVA 3K0TA 3MBMA 5MN4A 1KNJA 5BMVB 2P6YA 3JALA 5HXZA 4M8IA 3L7QA 4ZI7A 3E22B 1R1MA 2VGMA 1VQ8F 3QHDA 4E6EA 2R6R1 3AGKA 2VXYA 4TV9B 3QTYA 1VQNF 1TUBB 1W57A 2ZODA 1U40A 5JCOA 3KHNA 1J7HA 3F0DA 4C81A 5LP6A 4WBNB 4EI7A 2H8EA 1TUBA 5LP6B 2CVLA 4WBNA 1M1KH 1W2BF 3JARA 1FNJA 3MQWA 3LWOC 3IMPA 3CCRF 1KD1H 2GVIA 4B5CA 2OTJF 3JARB 1U3PA 3F0EA 1OFUA 3E1YA 3Q8HA 3PLAC 3ON1A 5FLXM 3WGLA 4EI9A 1W59A 1U3LA 3HKEB 4ZOLA 3VI6A 5G4UC 2ALEA 3K14A 3HKBB 4G4ZA 2FC3A 2ZVYA 4ZOLB 3CCMF 3F0GA 5J2UA 3P0ZA 3HKCB 5HY4A 3GTZA 3K12A 4X1IB 2F9ZC 4X3LA 3VTIC 3NVIB 4C4WC 2VGNA 1W55A 2LBWA 3RYIB 4EI8A 4X1IA 5JQGA 3JASB 1SZQA 5KX5A 5JQGB 3JASA 3JATA 2LCAA 3N4YA 3HTNA 3CG6A 4O4HA 3CCQF 1JY8A 4ZHWA 1W5BA 3I7TA 3I56F 3FPIA 1SDSA 3WPXA 3VOBA 2AIFA 3VOAA 5DCVA 1FFXB 1ONIA 1ZWZA 1RLUA 4G4VA 2KTVA 4I55B 3IKEA 1FFXA 4LNUA 4O2BB 3WGMA 4B62A 1QVFF 2KG4A 2RHLA 2HP0A 2LBXA 1W42A 2KGWA 2PMPA 1QD9A 4HNAB 2Z1EA 2UYKA 3FFMA 1XBIA 5EIBC 3HJWC 2HS3A 5B8FA 5J2TA 1IV3A 4BT5A 3IEWA 4NUTA 3LWRC 5LOVB 5J2TB 4ZI7B 1VQPF 1YHQF 2W8BC 1OAPA 5LOVA 3ZOPA 1ODEA 3VYTC 4TV9A 3JCMM 4ZK7A 2HS0A 1VQKF 5ITZA 5LP6C 1UFYA 5HP8A 1JN1A 2OTMA 3TD5A 1S72F 1E7KA 4BT4A 1VQMF 3T80A 1N8RH 3OONA 1VQ7F 3S0YA 5GIPC 2IAFA 1Q81H 3WPWA 2MQEA 2CHSA 1K8AH 5LA6B 2RB9A 4RHAA 3CC4F 3CMEF 2AIZP 4G4XA 3HKEA 3C8LA 1VH8A 2H6LA 3ELCA 2QI2A 4TV8A 4G4YA 5EB0A 1X52A 2DT4A 1NQ3A 3LDTA 2QTPA 1VQ9F 3NK6A 3G4SF 3CD6F 1DBFA 4I4TA 4F6RB 4YJ3B 3CC2F 5KX5B 3DDNA 4I4TB
chains in the Genus database with same CATH topology
2EWCA 1XRGA 2CHSA 3ZOPA 1FNKA 3KJJA 3L7QA 3VCZA 5HP7A 1ODEA 2CHTA 2UYNB 2CWJA 1XHOA 3M1XA 3ZP7A 4ZK7A 3R0PA 1PF5A 2CW4A 2UYPA 1X25A 2DYYA 1QU9A 1UFYA 3I3FA 4NWOB 3ZP4A 1J7HA 5HP8A 1NQ3A 3D01A 3LYBA 3M4SA 2OTMA 1QD9A 3I7TA 3QUWA 2UYKA 3V4DA 2B33A 2CVLA 3GTZA 1QAHA 2IG8A 1DBFA 3K12A 2UYJA 1COMA 1JD1A 1FNJA 3K0TA 3KJKA 3MQWA 1ONIA 3ZO8A 2CSLA 1UI9A 2UYNA 3LMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  1XRG A;  2CHS A;  3ZOP A;  1FNK A;  3KJJ A;  3L7Q A;  3VCZ A;  5HP7 A;  1ODE A;  2CHT A;  2UYN B;  2CWJ A;  1XHO A;  3M1X A;  3ZP7 A;  4ZK7 A;  3R0P A;  1PF5 A;  2CW4 A;  2UYP A;  1X25 A;  2DYY A;  1QU9 A;  1UFY A;  3I3F A;  4NWO B;  3ZP4 A;  1J7H A;  5HP8 A;  1NQ3 A;  3D01 A;  3LYB A;  3M4S A;  2OTM A;  1QD9 A;  3I7T A;  3QUW A;  2UYK A;  3V4D A;  2B33 A;  2CVL A;  3GTZ A;  1QAH A;  2IG8 A;  1DBF A;  3K12 A;  2UYJ A;  1COM A;  1JD1 A;  1FNJ A;  3K0T A;  3KJK A;  3MQW A;  1ONI A;  3ZO8 A;  2CSL A;  1UI9 A;  2UYN A;  3LME A; 
#chains in the Genus database with same CATH topology
 3JAT B;  3VCZ A;  2RHJ A;  3RYH A;  3DC2 A;  2PHN A;  3HWU A;  1W41 A;  3C9R A;  4EB6 A;  4PWT A;  4BT2 A;  3CCV F;  1QVG F;  3ZP4 A;  4EB6 B;  3MDO A;  1RA4 A;  3CYQ A;  3QUW A;  2ZF8 A;  1YIJ F;  3FBA A;  2YYE A;  1W5E A;  5HY0 A;  3WXM B;  1PXW A;  2QA4 F;  3S03 A;  4DXD A;  2YXZ A;  1Q82 H;  2HQS C;  3OBW A;  3LWQ C;  1VQ5 F;  3HAX D;  3MCA B;  3U0O A;  1TVK B;  4FFB B;  1NMU B;  3ZP7 A;  2BO1 A;  5GIN C;  2HP0 B;  3IR9 A;  2HRY A;  5EWR A;  4HNA A;  1QU9 A;  2I6D A;  2Z01 A;  5C8Y B;  1Q86 H;  3E20 B;  3CXC F;  4LCK A;  1U43 A;  4I50 B;  3LYB A;  1X7P A;  4C8E A;  3JAK B;  2VAM A;  1M90 H;  4X3M A;  3VYS C;  2LBT A;  2Q1Y A;  4BT3 A;  3JAK A;  4O4I A;  1RQ2 A;  1COM A;  1NJI H;  1JD1 A;  3D00 A;  1VHA A;  2CSL A;  1UI9 A;  3LME A;  4O4I B;  1YGY A;  2VAW A;  4U39 A;  3KJJ A;  4BVQ A;  2OTL F;  1CK2 A;  5ITZ B;  2CHT A;  2RHO A;  1XHO A;  2KTU A;  3CCL F;  4R40 B;  3VYU C;  1SA0 A;  1X25 A;  2OHW A;  3WGK A;  1SA0 B;  3ESJ A;  4X1K B;  1W3E X;  3CPW F;  4U3J B;  4C8I A;  5IT9 M;  1GO1 A;  3HKD A;  3CPQ A;  4U3J A;  5GIO C;  2CZW A;  3KJK A;  1RQ7 A;  5LA6 A;  3RE3 A;  5GAP K;  3KE1 A;  3HKD B;  2EWC A;  4B46 A;  5IJ9 A;  1JFF A;  5G4V C;  4TV8 B;  4IIJ B;  2VAP A;  4X20 B;  5IJ0 B;  4C8G A;  5IJ9 B;  1Z5W A;  1JFF B;  2HRU A;  3RYC B;  2DYY A;  3WGN A;  4NWO B;  3I3F A;  4BVR A;  5CA0 A;  1FSZ A;  1VQ6 F;  3G71 F;  4YJ3 A;  4TZZ A;  3SIU A;  1Q8R A;  2V9Y A;  5CA0 B;  4O4L A;  1W58 1;  5EIB D;  5EAZ A;  2H8C A;  3RYH B;  3J7A R;  5CA1 A;  1K73 H;  3CYP B;  3CCS F;  4O4J A;  3FD6 A;  5CA1 B;  5HXU A;  3WJQ A;  3N2K A;  1JJ2 F;  4XCQ A;  3N2G B;  5KMG B;  4F6R A;  2Z1U A;  3WJP A;  4C82 A;  3N2G A;  1IPA A;  3CCJ F;  3FD5 A;  3K2X A;  2GZL A;  1KNK A;  1H7M A;  3WGJ A;  2Q1X A;  2B33 A;  4BVS A;  4BT7 A;  2ZVZ A;  2UYJ A;  3B6N A;  1TVK A;  4FFB A;  2R75 1;  4O2A B;  5CB4 A;  4BT6 A;  5MN5 A;  3F6M A;  5EZY A;  3P4E A;  5JVD B;  4ERH A;  4O2A A;  5CB4 B;  1VK3 A;  5EYP A;  2HVY D;  1VQV A;  4IHJ A;  5AVM A;  1H48 A;  3M1X A;  5EZY B;  1DT9 A;  3R0P A;  5JVD A;  3G6E F;  2I6R A;  2Z1F A;  2CW4 A;  3C9U A;  5C8Y A;  2RHH A;  4I50 A;  1VQL F;  1GX1 A;  3C9T A;  5HWE A;  3S06 A;  5GAN K;  5FNV A;  3M4S A;  4ZHQ A;  3CCU F;  1X7O A;  3N4Z A;  1VQ4 F;  3D54 A;  4ZHQ B;  5IYZ A;  2NMU A;  5HY1 A;  2UZH A;  3LFO A;  2Z1T A;  5IYZ B;  3BYQ A;  5LYJ B;  3NVK E;  1FNK A;  1H47 A;  2BTO A;  2L26 A;  3GHZ A;  3JAL B;  5HY2 A;  3LWV C;  3CMA F;  3E22 A;  2QEX F;  2BTQ B;  4X1K A;  2GLZ A;  3S0W A;  1CN7 A;  1Q7Y H;  1Z5V A;  3V4D A;  4RQO A;  1KC8 H;  2IG8 A;  3JAW A;  1GO0 A;  2HS4 A;  4YJ2 B;  2UYN A;  3C9S A;  3JAW B;  5EO3 A;  1YIT F;  4IIJ A;  1IV4 A;  2IQQ A;  4X20 A;  1XRG A;  5IJ0 A;  3CCE F;  1YI2 F;  1T0K B;  4YJ2 A;  2UYN B;  1IV1 A;  3RYC A;  1VQO F;  3I55 F;  1XV2 A;  2BTU A;  3VO8 A;  3KIZ A;  4DRX B;  5JH7 A;  3VIU A;  3MCQ A;  1YJN F;  1RLG A;  4DRX A;  5JH7 B;  4NQ3 A;  4O4L B;  4BY9 D;  1T0A A;  3HKB A;  2FGY A;  1CLI A;  5J2U B;  3P10 A;  3HKC A;  3JAM M;  4O4J B;  3ZO8 A;  3TD3 A;  3RA6 A;  3N2K B;  2ZOV A;  3V7Q A;  3NK7 A;  2N48 A;  3M84 A;  5HP7 A;  5GON A;  4BVT A;  3RYI A;  5KMG A;  2CWJ A;  5JCO C;  1PF5 A;  3F0F A;  4G88 A;  2K1S A;  5GON B;  2HX0 A;  3ERN A;  3VMF B;  1K9M H;  4G4W A;  3IEQ A;  1IV2 A;  3SIV A;  3CC7 F;  3J81 M;  4O4H B;  3S0H A;  4KWE A;  1QAH A;  3NMU C;  2OZB A;  1KQS F;  3RYF B;  3UT5 B;  1YJ9 F;  5EYP B;  1W40 A;  1GZ0 A;  3S02 A;  4IHJ B;  3RYF A;  3O85 A;  3UT5 A;  5LXT A;  1YQN A;  3OBY A;  1W5F A;  3JVH A;  4TUY B;  3GYQ A;  4B45 A;  3PAF A;  5FJ4 C;  2G9I A;  3CB2 A;  4I55 A;  5LXT B;  2UYP A;  4LNU B;  4O2B A;  5EB1 B;  4TUY A;  5FNV B;  4X1Y A;  3V3T A;  3LWP C;  1W5A A;  3D01 A;  2JNB A;  3RA5 A;  2WAL A;  2ZAU A;  4X1Y B;  3J80 M;  3WJR A;  4ZHY B;  2AMT A;  3EOR A;  3V7E A;  3TD4 A;  1YJW F;  3OW2 F;  4ZHV A;  5MN6 A;  5A2Q M;  2HP3 A;  3IKF A;  5LYJ A;  4BW0 B;  5BMV A;  3K0T A;  3MBM A;  5MN4 A;  1KNJ A;  5BMV B;  2P6Y A;  3JAL A;  5HXZ A;  4M8I A;  3L7Q A;  4ZI7 A;  3E22 B;  1R1M A;  2VGM A;  1VQ8 F;  3QHD A;  4E6E A;  2R6R 1;  3AGK A;  2VXY A;  4TV9 B;  3QTY A;  1VQN F;  1TUB B;  1W57 A;  2ZOD A;  1U40 A;  5JCO A;  3KHN A;  1J7H A;  3F0D A;  4C81 A;  5LP6 A;  4WBN B;  4EI7 A;  2H8E A;  1TUB A;  5LP6 B;  2CVL A;  4WBN A;  1M1K H;  1W2B F;  3JAR A;  1FNJ A;  3MQW A;  3LWO C;  3IMP A;  3CCR F;  1KD1 H;  2GVI A;  4B5C A;  2OTJ F;  3JAR B;  1U3P A;  3F0E A;  1OFU A;  3E1Y A;  3Q8H A;  3PLA C;  3ON1 A;  5FLX M;  3WGL A;  4EI9 A;  1W59 A;  1U3L A;  3HKE B;  4ZOL A;  3VI6 A;  5G4U C;  2ALE A;  3K14 A;  3HKB B;  4G4Z A;  2FC3 A;  2ZVY A;  4ZOL B;  3CCM F;  3F0G A;  5J2U A;  3P0Z A;  3HKC B;  5HY4 A;  3GTZ A;  3K12 A;  4X1I B;  2F9Z C;  4X3L A;  3VTI C;  3NVI B;  4C4W C;  2VGN A;  1W55 A;  2LBW A;  3RYI B;  4EI8 A;  4X1I A;  5JQG A;  3JAS B;  1SZQ A;  5KX5 A;  5JQG B;  3JAS A;  3JAT A;  2LCA A;  3N4Y A;  3HTN A;  3CG6 A;  4O4H A;  3CCQ F;  1JY8 A;  4ZHW A;  1W5B A;  3I7T A;  3I56 F;  3FPI A;  1SDS A;  3WPX A;  3VOB A;  2AIF A;  3VOA A;  5DCV A;  1FFX B;  1ONI A;  1ZWZ A;  1RLU A;  4G4V A;  2KTV A;  4I55 B;  3IKE A;  1FFX A;  4LNU A;  4O2B B;  3WGM A;  4B62 A;  1QVF F;  2KG4 A;  2RHL A;  2HP0 A;  2LBX A;  1W42 A;  2KGW A;  2PMP A;  1QD9 A;  4HNA B;  2Z1E A;  2UYK A;  3FFM A;  1XBI A;  5EIB C;  3HJW C;  2HS3 A;  5B8F A;  5J2T A;  1IV3 A;  4BT5 A;  3IEW A;  4NUT A;  3LWR C;  5LOV B;  5J2T B;  4ZI7 B;  1VQP F;  1YHQ F;  2W8B C;  1OAP A;  5LOV A;  3ZOP A;  1ODE A;  3VYT C;  4TV9 A;  3JCM M;  4ZK7 A;  2HS0 A;  1VQK F;  5ITZ A;  5LP6 C;  1UFY A;  5HP8 A;  1JN1 A;  2OTM A;  3TD5 A;  1S72 F;  1E7K A;  4BT4 A;  1VQM F;  3T80 A;  1N8R H;  3OON A;  1VQ7 F;  3S0Y A;  5GIP C;  2IAF A;  1Q81 H;  3WPW A;  2MQE A;  2CHS A;  1K8A H;  5LA6 B;  2RB9 A;  4RHA A;  3CC4 F;  3CME F;  2AIZ P;  4G4X A;  3HKE A;  3C8L A;  1VH8 A;  2H6L A;  3ELC A;  2QI2 A;  4TV8 A;  4G4Y A;  5EB0 A;  1X52 A;  2DT4 A;  1NQ3 A;  3LDT A;  2QTP A;  1VQ9 F;  3NK6 A;  3G4S F;  3CD6 F;  1DBF A;  4I4T A;  4F6R B;  4YJ3 B;  3CC2 F;  5KX5 B;  3DDN A;  4I4T B; 
#chains in the Genus database with same CATH homology
 2EWC A;  1XRG A;  2CHS A;  3ZOP A;  1FNK A;  3KJJ A;  3L7Q A;  3VCZ A;  5HP7 A;  1ODE A;  2CHT A;  2UYN B;  2CWJ A;  1XHO A;  3M1X A;  3ZP7 A;  4ZK7 A;  3R0P A;  1PF5 A;  2CW4 A;  2UYP A;  1X25 A;  2DYY A;  1QU9 A;  1UFY A;  3I3F A;  4NWO B;  3ZP4 A;  1J7H A;  5HP8 A;  1NQ3 A;  3D01 A;  3LYB A;  3M4S A;  2OTM A;  1QD9 A;  3I7T A;  3QUW A;  2UYK A;  3V4D A;  2B33 A;  2CVL A;  3GTZ A;  1QAH A;  2IG8 A;  1DBF A;  3K12 A;  2UYJ A;  1COM A;  1JD1 A;  1FNJ A;  3K0T A;  3KJK A;  3MQW A;  1ONI A;  3ZO8 A;  2CSL A;  1UI9 A;  2UYN A;  3LME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...