1J7HA

Solution structure of hi0719, a hypothetical protein from haemophilus influenzae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
MMTQIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEVPADIVAQARQSLENVKAIIEKAGLTAADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNFPARSCVEVARLPKDVGLEIEAIAVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords HYPOTHETICAL PROTEIN HI0719
publication title Solution Structure and Functional Ligand Screening of HI0719, a Highly Conserved Protein from Bacteria to Humans in the YjgF/YER057c/UK114 Family
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 22
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1j7hA00
2IG8A 2CW4A 1X25A 3GTZA 2CVLA 2OTMA 1PF5A 3MQWA 3I3FA 5HP7A 3KJKA 1JD1A 1FNJA 1DBFA 1FNKA 3K12A 3LYBA 3QUWA 3K0TA 3D01A 3ZO8A 2CWJA 3M4SA 1NQ3A 1UFYA 2EWCA 2UYNA 3ZOPA 3VCZA 3R0PA 2B33A 5HP8A 1UI9A 3KJJA 2UYPA 2UYNB 3L7QA 2UYJA 1QD9A 3M1XA 1J7HA 3V4DA 1COMA 1ODEA 2CHTA 3ZP4A 1XHOA 4ZK7A 3I7TA 1QAHA 2UYKA 1QU9A 3LMEA 2CSLA 3ZP7A 1XRGA 2DYYA 4NWOB 2CHSA 1ONIA
chains in the Genus database with same CATH superfamily
2IQQA 4TV9B 3RE3A 3IR9A 2R6R1 1W3EX 3HKBA 3QUWA 5LP6C 3CPWF 2Z01A 4G4VA 4BT4A 3JAKB 2GLZA 3IKEA 2HRYA 3JAWB 4G4YA 2OZBA 3AGKA 3S0WA 3WPWA 2HX0A 2K1SA 4X1KA 3LFOA 3OW2F 4BW0B 1VQVA 5HWEA 5MN5A 1ONIA 4G4XA 2CW4A 3RYHB 2HP0B 4RQOA 3D01A 2BTQB 3D00A 4ZHWA 2KTVA 5J2UA 2VGNA 4O4LA 1W5BA 2HRUA 3P0ZA 3CCQF 3WGLA 2BTOA 2Z1UA 3HKDA 4F6RB 4X1YA 5LA6B 4U3JB 3WJRA 3K14A 3LWVC 1JY8A 1ODEA 5LXTB 1GX1A 5JVDB 4TV9A 2RB9A 5JCOA 3ZP7A 3FFMA 3OBYA 3JAKA 2GVIA 2QA4F 1N8RH 3CCRF 3GHZA 3LYBA 3JAWA 3KIZA 2VXYA 2ZOVA 3ESJA 1VQPF 5IYZB 3UT5B 4LCKA 1Q82H 1M90H 4FFBB 3WJQA 3JVHA 3OBWA 4O4IB 3FBAA 3KE1A 3I55F 4ERHA 2AMTA 5CA1B 3RYHA 2HP0A 1VQ6F 3LMEA 3QTYA 3CG6A 5KMGB 4NQ3A 4LNUB 3LWRC 1JFFB 2OTJF 1YGYA 2WALA 1U40A 2AIFA 5HXUA 3CCJF 3CCVF 3M84A 3M4SA 4F6RA 3CC4F 2W8BC 2ZVZA 5LA6A 4U3JA 3B6NA 2Z1EA 5LXTA 2HS4A 5JVDA 4C8EA 2UYJA 3VI6A 1NJIH 3V4DA 2RHOA 3P10A 3WGKA 5FNVB 2YYEA 1U3LA 3U0OA 3MCAB 1W5FA 4TUYB 5IYZA 3UT5A 1SDSA 1X7OA 3MQWA 4FFBA 4B62A 4HNAB 3G6EF 3KJKA 5EO3A 3O85A 2YXZA 3SIUA 2BTUA 4O4IA 3VMFB 1ZWZA 3ZOPA 3HJWC 3CB2A 1FSZA 3G4SF 1FFXB 2N48A 1KD1H 5B8FA 1YI2F 5CA1A 1R1MA 2KTUA 3GYQA 1XV2A 2HS3A 3IKFA 2NMUA 4BT2A 1NMUB 3MBMA 5KMGA 3C8LA 4ZHYB 4LNUA 2OHWA 1JFFA 2UYKA 3RA5A 1QU9A 3VYUC 3S0HA 2RHLA 1IV4A 3EORA 1U3PA 2Z1TA 1VH8A 4O4JB 2CWJA 3LDTA 1UFYA 2EWCA 2Z1FA 3VYTC 3WGJA 1T0KB 4ZOLB 2UZHA 2Q1XA 3VOAA 3CC7F 1W41A 3C9SA 3N4ZA 5FNVA 2JNBA 5JCOC 4WBNB 4B45A 2CHTA 4X1IB 4E6EA 4TUYA 3SIVA 3RYIB 1TUBB 3CMEF 1OFUA 4U39A 4HNAA 3WJPA 4ZHQB 2IAFA 5EIBD 2LBXA 4NWOB 5HXZA 3HAXD 1S72F 1W57A 1KNJA 5MN6A 1X52A 3CPQA 1FFXA 1Z5VA 2P6YA 5HY4A 3VCZA 4IHJB 2HP3A 3R0PA 2OTLF 5HP8A 4NUTA 1SA0B 4BVRA 5IJ0B 5EWRA 3L7QA 3CYPB 2PHNA 3V7QA 2LCAA 2VGMA 1VQNF 1QAHA 1TVKB 3FD6A 1E7KA 4BT7A 3JASB 3F0GA 1IV2A 1RQ7A 4O4JA 3WPXA 5HP7A 2KG4A 5KX5B 3JARB 5JQGB 4ZOLA 3HKEB 3CMAF 5EYPB 1RA4A 3IEWA 4I50B 1VQOF 1W40A 4G88A 1CN7A 3VOBA 1K9MH 4WBNA 2B33A 3IMPA 2DT4A 5GONB 4X1IA 3OONA 5CB4B 1RLUA 3CYQA 3RYIA 2UYNB 3E22B 5JH7B 1TUBA 3TD3A 4ZHQA 5HY0A 5J2TB 3V3TA 5LYJB 3CD6F 5DCVA 1VQ5F 4YJ3B 1GZ0A 4O2AB 1CLIA 1X25A 2CVLA 3N2KB 3I56F 3CXCF 4IHJA 4IIJB 2H8CA 1SA0A 3C9UA 2ZF8A 5IJ0A 5FLXM 3K2XA 4B46A 1H7MA 2ZODA 4ZHVA 3NMUC 3TD4A 1YJNF 1RQ2A 1TVKA 1VQ8F 3JASA 5BMVB 3VIUA 1XBIA 3PLAC 4BT6A 1DT9A 1VQMF 4B5CA 5KX5A 4DXDA 3JARA 5JQGA 3HKEA 5HY1A 5G4VC 4G4WA 4I50A 4O2BB 2VAPA 5EZYB 5C8YB 3J7AR 5GONA 2KGWA 5CB4A 4TV8B 3ZO8A 4BT5A 1W42A 2UYNA 3E22A 5JH7A 5ITZB 4TZZA 3FPIA 4I4TB 2L26A 3KJJA 1RLGA 3HTNA 5J2TA 5LYJA 4EI9A 1YHQF 4YJ3A 5G4UC 3CCUF 1QVGF 3N2GB 1Z5WA 4O2AA 4DRXB 2R751 3N2KA 2HQSC 4BY9D 4BVQA 2PMPA 4IIJA 3MDOA 1X7PA 1IV3A 2CHSA 3GTZA 5FJ4C 1JJ2F 1YQNA 1DBFA 2RHHA 3K0TA 3F0DA 3MCQA 4EI7A 5BMVA 5EB1B 4C81A 4X20B 4ZI7B 5GIPC 1UI9A 3P4EA 1VK3A 3FD5A 4M8IA 3WGNA 4EB6B 2FGYA 1QD9A 2LBWA 4I55B 3CCEF 1T0AA 3RYCB 2MQEA 5LP6B 2H8EA 4O2BA 4C82A 1VQ9F 5EZYA 5C8YA 2VAWA 4YJ2B 5EB0A 4R40B 4TV8A 3S03A 5ITZA 2RHJA 3TD5A 1JD1A 4G4ZA 4I4TA 3JALB 3E1YA 1Q8RA 3Q8HA 2G9IA 5HY2A 3N2GA 3LWQC 1QVFF 4DRXA 1JN1A 2AIZP 1Q81H 1J7HA 3HKCB 3CC2F 1W5EA 3E20B 3CCSF 3CCLF 1YIJF 1W59A 2VAMA 2V9YA 3NVIB 2Q1YA 2F9ZC 3V7EA 3RA6A 4X20A 4XCQA 4ZI7A 3ON1A 3C9TA 4EB6A 4BVSA 4O4HB 5GAPK 3S06A 4I55A 2HVYD 3WXMB 4C4WC 3RYCA 5LP6A 1PXWA 4BT3A 3QHDA 5GANK 5GINC 1SZQA 2QEXF 4YJ2A 3WGMA 2H6LA 1XHOA 4ZK7A 3VTIC 3DC2A 3KHNA 3JALA 1XRGA 2FC3A 2IG8A 2ZAUA 4BVTA 2ZVYA 3BYQA 1FNKA 1GO0A 3RYFB 1YITF 1NQ3A 3ELCA 1U43A 3C9RA 3HKCA 1CK2A 3JAMM 1IPAA 1GO1A 4KWEA 5EAZA 2UYPA 1K73H 4PWTA 1KC8H 2QTPA 1Q7YH 2QI2A 1VHAA 1K8AH 3I7TA 3J80M 2I6RA 3JCMM 3F6MA 3T80A 3NK7A 5LOVB 3IEQA 3S0YA 2CSLA 5IJ9B 3NVKE 2LBTA 5CA0B 5EYPA 1W2BF 2OTMA 3DDNA 3JATB 4O4HA 1FNJA 1IV1A 2ALEA 3K12A 1VQ4F 5EIBC 1VQKF 3F0EA 3J81M 3HKBB 3N4YA 2CZWA 3VYSC 3F0FA 1COMA 5A2QM 2BO1A 1KQSF 1KNKA 2GZLA 2DYYA 4X1KB 3LWOC 1YJWF 1H47A 1W55A 3RYFA 1OAPA 1VQLF 4EI8A 1PF5A 1YJ9F 3I3FA 3NK6A 3PAFA 3G71F 5GIOC 4RHAA 5AVMA 4C8GA 2HS0A 3CCMF 3HWUA 1W5AA 5LOVA 3M1XA 5J2UB 3S02A 5IT9M 4X3MA 4O4LB 1H48A 1W581 5IJ9A 3ZP4A 4X3LA 2I6DA 5CA0A 3HKDB 4X1YB 1M1KH 3D54A 1VQ7F 1Q86H 3JATA 3LWPC 5MN4A 3VO8A 4C8IA 3ERNA
chains in the Genus database with same CATH topology
2IG8A 2CW4A 1X25A 3GTZA 2CVLA 2OTMA 1PF5A 3MQWA 3I3FA 5HP7A 3KJKA 1JD1A 1FNJA 1DBFA 1FNKA 3K12A 3LYBA 3QUWA 3K0TA 3D01A 3ZO8A 2CWJA 3M4SA 1NQ3A 1UFYA 2EWCA 2UYNA 3ZOPA 3VCZA 3R0PA 2B33A 5HP8A 1UI9A 3KJJA 2UYPA 2UYNB 3L7QA 2UYJA 1QD9A 3M1XA 1J7HA 3V4DA 1COMA 1ODEA 2CHTA 3ZP4A 1XHOA 4ZK7A 3I7TA 1QAHA 2UYKA 1QU9A 3LMEA 2CSLA 3ZP7A 1XRGA 2DYYA 4NWOB 2CHSA 1ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG8 A;  2CW4 A;  1X25 A;  3GTZ A;  2CVL A;  2OTM A;  1PF5 A;  3MQW A;  3I3F A;  5HP7 A;  3KJK A;  1JD1 A;  1FNJ A;  1DBF A;  1FNK A;  3K12 A;  3LYB A;  3QUW A;  3K0T A;  3D01 A;  3ZO8 A;  2CWJ A;  3M4S A;  1NQ3 A;  1UFY A;  2EWC A;  2UYN A;  3ZOP A;  3VCZ A;  3R0P A;  2B33 A;  5HP8 A;  1UI9 A;  3KJJ A;  2UYP A;  2UYN B;  3L7Q A;  2UYJ A;  1QD9 A;  3M1X A;  1J7H A;  3V4D A;  1COM A;  1ODE A;  2CHT A;  3ZP4 A;  1XHO A;  4ZK7 A;  3I7T A;  1QAH A;  2UYK A;  1QU9 A;  3LME A;  2CSL A;  3ZP7 A;  1XRG A;  2DYY A;  4NWO B;  2CHS A;  1ONI A; 
#chains in the Genus database with same CATH topology
 2IQQ A;  4TV9 B;  3RE3 A;  3IR9 A;  2R6R 1;  1W3E X;  3HKB A;  3QUW A;  5LP6 C;  3CPW F;  2Z01 A;  4G4V A;  4BT4 A;  3JAK B;  2GLZ A;  3IKE A;  2HRY A;  3JAW B;  4G4Y A;  2OZB A;  3AGK A;  3S0W A;  3WPW A;  2HX0 A;  2K1S A;  4X1K A;  3LFO A;  3OW2 F;  4BW0 B;  1VQV A;  5HWE A;  5MN5 A;  1ONI A;  4G4X A;  2CW4 A;  3RYH B;  2HP0 B;  4RQO A;  3D01 A;  2BTQ B;  3D00 A;  4ZHW A;  2KTV A;  5J2U A;  2VGN A;  4O4L A;  1W5B A;  2HRU A;  3P0Z A;  3CCQ F;  3WGL A;  2BTO A;  2Z1U A;  3HKD A;  4F6R B;  4X1Y A;  5LA6 B;  4U3J B;  3WJR A;  3K14 A;  3LWV C;  1JY8 A;  1ODE A;  5LXT B;  1GX1 A;  5JVD B;  4TV9 A;  2RB9 A;  5JCO A;  3ZP7 A;  3FFM A;  3OBY A;  3JAK A;  2GVI A;  2QA4 F;  1N8R H;  3CCR F;  3GHZ A;  3LYB A;  3JAW A;  3KIZ A;  2VXY A;  2ZOV A;  3ESJ A;  1VQP F;  5IYZ B;  3UT5 B;  4LCK A;  1Q82 H;  1M90 H;  4FFB B;  3WJQ A;  3JVH A;  3OBW A;  4O4I B;  3FBA A;  3KE1 A;  3I55 F;  4ERH A;  2AMT A;  5CA1 B;  3RYH A;  2HP0 A;  1VQ6 F;  3LME A;  3QTY A;  3CG6 A;  5KMG B;  4NQ3 A;  4LNU B;  3LWR C;  1JFF B;  2OTJ F;  1YGY A;  2WAL A;  1U40 A;  2AIF A;  5HXU A;  3CCJ F;  3CCV F;  3M84 A;  3M4S A;  4F6R A;  3CC4 F;  2W8B C;  2ZVZ A;  5LA6 A;  4U3J A;  3B6N A;  2Z1E A;  5LXT A;  2HS4 A;  5JVD A;  4C8E A;  2UYJ A;  3VI6 A;  1NJI H;  3V4D A;  2RHO A;  3P10 A;  3WGK A;  5FNV B;  2YYE A;  1U3L A;  3U0O A;  3MCA B;  1W5F A;  4TUY B;  5IYZ A;  3UT5 A;  1SDS A;  1X7O A;  3MQW A;  4FFB A;  4B62 A;  4HNA B;  3G6E F;  3KJK A;  5EO3 A;  3O85 A;  2YXZ A;  3SIU A;  2BTU A;  4O4I A;  3VMF B;  1ZWZ A;  3ZOP A;  3HJW C;  3CB2 A;  1FSZ A;  3G4S F;  1FFX B;  2N48 A;  1KD1 H;  5B8F A;  1YI2 F;  5CA1 A;  1R1M A;  2KTU A;  3GYQ A;  1XV2 A;  2HS3 A;  3IKF A;  2NMU A;  4BT2 A;  1NMU B;  3MBM A;  5KMG A;  3C8L A;  4ZHY B;  4LNU A;  2OHW A;  1JFF A;  2UYK A;  3RA5 A;  1QU9 A;  3VYU C;  3S0H A;  2RHL A;  1IV4 A;  3EOR A;  1U3P A;  2Z1T A;  1VH8 A;  4O4J B;  2CWJ A;  3LDT A;  1UFY A;  2EWC A;  2Z1F A;  3VYT C;  3WGJ A;  1T0K B;  4ZOL B;  2UZH A;  2Q1X A;  3VOA A;  3CC7 F;  1W41 A;  3C9S A;  3N4Z A;  5FNV A;  2JNB A;  5JCO C;  4WBN B;  4B45 A;  2CHT A;  4X1I B;  4E6E A;  4TUY A;  3SIV A;  3RYI B;  1TUB B;  3CME F;  1OFU A;  4U39 A;  4HNA A;  3WJP A;  4ZHQ B;  2IAF A;  5EIB D;  2LBX A;  4NWO B;  5HXZ A;  3HAX D;  1S72 F;  1W57 A;  1KNJ A;  5MN6 A;  1X52 A;  3CPQ A;  1FFX A;  1Z5V A;  2P6Y A;  5HY4 A;  3VCZ A;  4IHJ B;  2HP3 A;  3R0P A;  2OTL F;  5HP8 A;  4NUT A;  1SA0 B;  4BVR A;  5IJ0 B;  5EWR A;  3L7Q A;  3CYP B;  2PHN A;  3V7Q A;  2LCA A;  2VGM A;  1VQN F;  1QAH A;  1TVK B;  3FD6 A;  1E7K A;  4BT7 A;  3JAS B;  3F0G A;  1IV2 A;  1RQ7 A;  4O4J A;  3WPX A;  5HP7 A;  2KG4 A;  5KX5 B;  3JAR B;  5JQG B;  4ZOL A;  3HKE B;  3CMA F;  5EYP B;  1RA4 A;  3IEW A;  4I50 B;  1VQO F;  1W40 A;  4G88 A;  1CN7 A;  3VOB A;  1K9M H;  4WBN A;  2B33 A;  3IMP A;  2DT4 A;  5GON B;  4X1I A;  3OON A;  5CB4 B;  1RLU A;  3CYQ A;  3RYI A;  2UYN B;  3E22 B;  5JH7 B;  1TUB A;  3TD3 A;  4ZHQ A;  5HY0 A;  5J2T B;  3V3T A;  5LYJ B;  3CD6 F;  5DCV A;  1VQ5 F;  4YJ3 B;  1GZ0 A;  4O2A B;  1CLI A;  1X25 A;  2CVL A;  3N2K B;  3I56 F;  3CXC F;  4IHJ A;  4IIJ B;  2H8C A;  1SA0 A;  3C9U A;  2ZF8 A;  5IJ0 A;  5FLX M;  3K2X A;  4B46 A;  1H7M A;  2ZOD A;  4ZHV A;  3NMU C;  3TD4 A;  1YJN F;  1RQ2 A;  1TVK A;  1VQ8 F;  3JAS A;  5BMV B;  3VIU A;  1XBI A;  3PLA C;  4BT6 A;  1DT9 A;  1VQM F;  4B5C A;  5KX5 A;  4DXD A;  3JAR A;  5JQG A;  3HKE A;  5HY1 A;  5G4V C;  4G4W A;  4I50 A;  4O2B B;  2VAP A;  5EZY B;  5C8Y B;  3J7A R;  5GON A;  2KGW A;  5CB4 A;  4TV8 B;  3ZO8 A;  4BT5 A;  1W42 A;  2UYN A;  3E22 A;  5JH7 A;  5ITZ B;  4TZZ A;  3FPI A;  4I4T B;  2L26 A;  3KJJ A;  1RLG A;  3HTN A;  5J2T A;  5LYJ A;  4EI9 A;  1YHQ F;  4YJ3 A;  5G4U C;  3CCU F;  1QVG F;  3N2G B;  1Z5W A;  4O2A A;  4DRX B;  2R75 1;  3N2K A;  2HQS C;  4BY9 D;  4BVQ A;  2PMP A;  4IIJ A;  3MDO A;  1X7P A;  1IV3 A;  2CHS A;  3GTZ A;  5FJ4 C;  1JJ2 F;  1YQN A;  1DBF A;  2RHH A;  3K0T A;  3F0D A;  3MCQ A;  4EI7 A;  5BMV A;  5EB1 B;  4C81 A;  4X20 B;  4ZI7 B;  5GIP C;  1UI9 A;  3P4E A;  1VK3 A;  3FD5 A;  4M8I A;  3WGN A;  4EB6 B;  2FGY A;  1QD9 A;  2LBW A;  4I55 B;  3CCE F;  1T0A A;  3RYC B;  2MQE A;  5LP6 B;  2H8E A;  4O2B A;  4C82 A;  1VQ9 F;  5EZY A;  5C8Y A;  2VAW A;  4YJ2 B;  5EB0 A;  4R40 B;  4TV8 A;  3S03 A;  5ITZ A;  2RHJ A;  3TD5 A;  1JD1 A;  4G4Z A;  4I4T A;  3JAL B;  3E1Y A;  1Q8R A;  3Q8H A;  2G9I A;  5HY2 A;  3N2G A;  3LWQ C;  1QVF F;  4DRX A;  1JN1 A;  2AIZ P;  1Q81 H;  1J7H A;  3HKC B;  3CC2 F;  1W5E A;  3E20 B;  3CCS F;  3CCL F;  1YIJ F;  1W59 A;  2VAM A;  2V9Y A;  3NVI B;  2Q1Y A;  2F9Z C;  3V7E A;  3RA6 A;  4X20 A;  4XCQ A;  4ZI7 A;  3ON1 A;  3C9T A;  4EB6 A;  4BVS A;  4O4H B;  5GAP K;  3S06 A;  4I55 A;  2HVY D;  3WXM B;  4C4W C;  3RYC A;  5LP6 A;  1PXW A;  4BT3 A;  3QHD A;  5GAN K;  5GIN C;  1SZQ A;  2QEX F;  4YJ2 A;  3WGM A;  2H6L A;  1XHO A;  4ZK7 A;  3VTI C;  3DC2 A;  3KHN A;  3JAL A;  1XRG A;  2FC3 A;  2IG8 A;  2ZAU A;  4BVT A;  2ZVY A;  3BYQ A;  1FNK A;  1GO0 A;  3RYF B;  1YIT F;  1NQ3 A;  3ELC A;  1U43 A;  3C9R A;  3HKC A;  1CK2 A;  3JAM M;  1IPA A;  1GO1 A;  4KWE A;  5EAZ A;  2UYP A;  1K73 H;  4PWT A;  1KC8 H;  2QTP A;  1Q7Y H;  2QI2 A;  1VHA A;  1K8A H;  3I7T A;  3J80 M;  2I6R A;  3JCM M;  3F6M A;  3T80 A;  3NK7 A;  5LOV B;  3IEQ A;  3S0Y A;  2CSL A;  5IJ9 B;  3NVK E;  2LBT A;  5CA0 B;  5EYP A;  1W2B F;  2OTM A;  3DDN A;  3JAT B;  4O4H A;  1FNJ A;  1IV1 A;  2ALE A;  3K12 A;  1VQ4 F;  5EIB C;  1VQK F;  3F0E A;  3J81 M;  3HKB B;  3N4Y A;  2CZW A;  3VYS C;  3F0F A;  1COM A;  5A2Q M;  2BO1 A;  1KQS F;  1KNK A;  2GZL A;  2DYY A;  4X1K B;  3LWO C;  1YJW F;  1H47 A;  1W55 A;  3RYF A;  1OAP A;  1VQL F;  4EI8 A;  1PF5 A;  1YJ9 F;  3I3F A;  3NK6 A;  3PAF A;  3G71 F;  5GIO C;  4RHA A;  5AVM A;  4C8G A;  2HS0 A;  3CCM F;  3HWU A;  1W5A A;  5LOV A;  3M1X A;  5J2U B;  3S02 A;  5IT9 M;  4X3M A;  4O4L B;  1H48 A;  1W58 1;  5IJ9 A;  3ZP4 A;  4X3L A;  2I6D A;  5CA0 A;  3HKD B;  4X1Y B;  1M1K H;  3D54 A;  1VQ7 F;  1Q86 H;  3JAT A;  3LWP C;  5MN4 A;  3VO8 A;  4C8I A;  3ERN A; 
#chains in the Genus database with same CATH homology
 2IG8 A;  2CW4 A;  1X25 A;  3GTZ A;  2CVL A;  2OTM A;  1PF5 A;  3MQW A;  3I3F A;  5HP7 A;  3KJK A;  1JD1 A;  1FNJ A;  1DBF A;  1FNK A;  3K12 A;  3LYB A;  3QUW A;  3K0T A;  3D01 A;  3ZO8 A;  2CWJ A;  3M4S A;  1NQ3 A;  1UFY A;  2EWC A;  2UYN A;  3ZOP A;  3VCZ A;  3R0P A;  2B33 A;  5HP8 A;  1UI9 A;  3KJJ A;  2UYP A;  2UYN B;  3L7Q A;  2UYJ A;  1QD9 A;  3M1X A;  1J7H A;  3V4D A;  1COM A;  1ODE A;  2CHT A;  3ZP4 A;  1XHO A;  4ZK7 A;  3I7T A;  1QAH A;  2UYK A;  1QU9 A;  3LME A;  2CSL A;  3ZP7 A;  1XRG A;  2DYY A;  4NWO B;  2CHS A;  1ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...