1J7HA

Solution structure of hi0719, a hypothetical protein from haemophilus influenzae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
MMTQIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEVPADIVAQARQSLENVKAIIEKAGLTAADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNFPARSCVEVARLPKDVGLEIEAIAVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HI0719
publication title Solution Structure and Functional Ligand Screening of HI0719, a Highly Conserved Protein from Bacteria to Humans in the YjgF/YER057c/UK114 Family
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Unknown function
total genus 22
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1j7hA00
1PF5A 1QAHA 2CVLA 2B33A 3I7TA 2UYPA 1DBFA 3K0TA 2CSLA 1ODEA 1FNKA 3KJKA 3L7QA 3LMEA 1X25A 4NWOB 1XHOA 3ZP4A 1COMA 3VCZA 1XRGA 2EWCA 2UYKA 2UYJA 1QD9A 4ZK7A 3KJJA 2CHTA 3K12A 3ZOPA 1JD1A 2CWJA 3R0PA 1QU9A 1NQ3A 2IG8A 3I3FA 3ZO8A 1J7HA 1ONIA 3MQWA 1UFYA 3LYBA 3ZP7A 3QUWA 1UI9A 2UYNA 2UYNB 3D01A 3GTZA 3V4DA 2OTMA 3M4SA 2CW4A 3M1XA 2DYYA 5HP8A 5HP7A 1FNJA 2CHSA
chains in the Genus database with same CATH superfamily
1CN7A 3F0FA 4EI9A 2K1SA 4U3JA 1TVKA 3RYFA 2AMTA 4ZHVA 4YJ2A 1VQ4F 3IEQA 3OBYA 3IMPA 3T80A 1XHOA 3LFOA 4G88A 3ELCA 3GYQA 3Q8HA 3WGJA 5KMGA 3NVIB 3NK6A 3I55F 4O4LA 3KIZA 1K73H 4TV8A 4G4YA 5JQGA 3OONA 5LP6C 2HX0A 3HWUA 1N8RH 3JCMM 3MQWA 2VAPA 2OTJF 4X3LA 3J80M 2Z1TA 1TVKB 3RYFB 4YJ2B 5G4VC 5EWRA 3WXMB 4DRXB 2OZBA 2WALA 3PLAC 4C81A 3MCQA 2KTVA 5ITZA 5MN5A 1T0AA 5KMGB 3CCUF 3BYQA 4O4LB 2BTQB 3M84A 2GLZA 3C9UA 4TV8B 5JQGB 5EO3A 2CHTA 3IEWA 1YIJF 3MCAB 2KTUA 3B6NA 3JASB 4HNAA 1H47A 3J81M 3FFMA 3CPQA 3D00A 3GTZA 1VQNF 2OTMA 3UT5B 4TUYA 5HP7A 3LWVC 1IPAA 3WGNA 1VQ5F 2UYPA 5GANK 3HKDB 5EIBC 3CCEF 1QVGF 2PMPA 5IJ0A 5B8FA 5HXUA 5LA6B 4ZK7A 1FFXA 4E6EA 4C8EA 1Q82H 3G4SF 2Z1EA 4HNAB 2OTLF 1X52A 4WBNB 5FLXM 1Q8RA 1X7PA 4RHAA 1KC8H 3VYUC 1M90H 5GONB 1VQVA 5LYJA 1VQOF 3IKFA 4EI8A 4X1YB 2CVLA 2QI2A 1VHAA 2CSLA 3L7QA 1FNKA 2FGYA 3S0WA 1COMA 2YXZA 3F0DA 2V9YA 2HP0A 3ON1A 4EI7A 2ZF8A 5LYJB 4ZHWA 2JNBA 4BT7A 4C4WC 5KX5B 1YHQF 1ZWZA 2R751 1M1KH 1RQ7A 1DT9A 1Z5WA 2ZAUA 1X25A 2VGMA 3FPIA 3C9SA 4BW0B 3HKCB 5IYZA 1VQ6F 3CC7F 5EAZA 3JAMM 1YJWF 5EB1B 5LXTA 1T0KB 4O4HB 3CXCF 2FC3A 1K9MH 1VH8A 1NQ3A 2CZWA 3NMUC 3V4DA 3CC2F 4EB6B 3RYHA 2RHOA 5IT9M 2UYNA 5HP8A 4BT4A 1U3PA 4O2BA 1W3EX 3CCRF 4B5CA 3P0ZA 2HQSC 1Z5VA 2OHWA 4IHJA 2GVIA 2Q1YA 3ESJA 1VQ8F 1H48A 3C9TA 3S06A 2ZODA 3CC4F 5J2TA 1W42A 4IIJB 4LNUB 3WGMA 4O2AB 5JCOA 4X1IB 3CCJF 2IG8A 2HVYD 5IJ9A 3NK7A 3RYHB 2UYNB 4O2BB 1TUBB 3KE1A 4BT2A 1QAHA 4U3JB 3TD4A 1U3LA 3I7TA 4IHJB 3PAFA 4F6RA 3U0OA 4NWOB 1W57A 1YJ9F 5J2TB 2N48A 1S72F 2QEXF 5EIBD 1QD9A 1FSZA 2HRUA 3CD6F 3ZOPA 1Q81H 2CWJA 3DDNA 1QU9A 2RB9A 3MBMA 5IJ9B 3TD5A 4B62A 3D54A 4TV9A 1J7HA 1W5AA 1UFYA 3LYBA 3VOAA 3S0HA 1VK3A 3E22A 3JARA 4R40B 3JAKA 1U40A 2B33A 4F6RB 4NUTA 3G6EF 3SIUA 1JY8A 2H6LA 2Z1UA 4YJ3A 1GX1A 1IV1A 5ITZB 4G4VA 1W5EA 5LOVA 4BY9D 5JVDA 2RHLA 2DT4A 2UZHA 1W41A 3C8LA 3TD3A 1YJNF 3WJRA 4PWTA 5CA1A 1SDSA 3JARB 2L26A 3JAKB 4TUYB 2HRYA 2CW4A 2DYYA 1W581 3K2XA 2I6RA 4YJ3B 1VQKF 3FBAA 1NMUB 5FNVA 3CYQA 5HY0A 5JVDB 3HKEA 3WPWA 3JALA 3RA5A 5IJ0B 1NJIH 5EYPA 3WGLA 4B45A 1IV2A 4KWEA 4ZHQA 5J2UA 1FFXB 3N4YA 2BTUA 5BMVA 2H8EA 3HJWC 3FD5A 3K14A 2AIFA 5DCVA 3CCSF 5CA1B 1OAPA 1KD1H 3O85A 1RLGA 2P6YA 3VTIC 2G9IA 1QVFF 3IR9A 2QA4F 4O4IA 5FNVB 3HKEB 5CA0A 3JALB 2BO1A 3JAWA 3MDOA 1ODEA 3RYCA 3VIUA 4U39A 2Z1FA 1YITF 3ZP4A 3CPWF 3KHNA 3V3TA 2VAWA 3RA6A 1R1MA 2QTPA 4BT3A 4TZZA 1YI2F 1CK2A 2HP0B 3R0PA 3CMAF 3LDTA 3JATA 1VQ9F 3QUWA 4G4ZA 3P10A 4B46A 4BT6A 5MN4A 4FFBA 2PHNA 2ZVYA 1PF5A 3JAWB 1U43A 3F0GA 3RYIA 3RYCB 4XCQA 1W5FA 1PXWA 3LMEA 3WJPA 5JCOC 1YGYA 1JFFA 1W5BA 3CCVF 3C9RA 5IYZB 3VCZA 3WPXA 5LXTB 3KJJA 4ZI7A 4O4JA 3JATB 3P4EA 2KGWA 1KNKA 3I3FA 3LWRC 3CG6A 1XBIA 3ZP7A 1GZ0A 2ALEA 1H7MA 3HKBA 3RYIB 2W8BC 1GO0A 4C8IA 3F0EA 4ERHA 4ZHYB 2GZLA 1JFFB 1KNJA 3FD6A 4DRXA 1JJ2F 4NQ3A 1SA0A 2HS4A 5HY1A 2MQEA 3CB2A 4BVRA 5A2QM 2VGNA 1W59A 4ZI7B 4BT5A 1K8AH 3N4ZA 4O4JB 5GIOC 5AVMA 3WGKA 3QHDA 4LCKA 3WJQA 3VYTC 2F9ZC 3JASA 4DXDA 1ONIA 1RQ2A 3V7QA 3HKBB 2NMUA 3CMEF 2HS3A 3LWOC 4I4TA 3UT5A 3QTYA 5LP6A 2ZOVA 1DBFA 1SA0B 3S02A 2R6R1 3HKDA 3CYPB 5GINC 2RHHA 2Q1XA 2RHJA 5GIPC 1E7KA 3VOBA 3I56F 2LBWA 4BVQA 5LA6A 5JH7A 2IAFA 3E20B 3SIVA 2IQQA 1JD1A 1CLIA 3GHZA 5EZYA 4C82A 4TV9B 3ERNA 4WBNA 2LBXA 1Q86H 1XV2A 2Z01A 4ZOLA 5GONA 4I4TB 3E22B 5LP6B 3CCLF 2YYEA 1FNJA 1KQSF 5MN6A 3HAXD 4X1YA 3HTNA 3AGKA 2VAMA 3JVHA 2AIZP 3J7AR 2ZVZA 5LOVB 3KJKA 3N2GA 3RE3A 1W55A 3F6MA 2I6DA 5JH7B 2HS0A 2UYKA 1VQPF 4I50A 5EZYB 4BVSA 3K12A 5C8YA 1IV3A 4X1KA 3VYSC 3DC2A 4ZOLB 3OBWA 3ZO8A 2VXYA 4X3MA 5CB4A 3OW2F 1OFUA 5HY4A 3M4SA 5KX5A 3VMFB 3IKEA 2CHSA 1SZQA 1RLUA 1IV4A 3N2GB 5GAPK 2H8CA 1VQMF 3G71F 5EYPB 3S0YA 4ZHQB 5J2UB 4X20A 5HXZA 4I50B 5HWEA 1XRGA 1VQLF 3HKCA 5BMVB 4X1KB 5C8YB 1JN1A 4I55A 5HY2A 5G4UC 1W40A 3CCQF 3CCMF 5FJ4C 4O4HA 5CB4B 3V7EA 4G4XA 1GO1A 1RA4A 1UI9A 3D01A 2BTOA 3N2KA 3M1XA 3VI6A 4O4IB 4EB6A 5CA0B 1X7OA 4G4WA 1Q7YH 3K0TA 4X20B 4BVTA 1W2BF 2HP3A 2KG4A 2LCAA 2LBTA 4I55B 3LWQC 3LWPC 3NVKE 2UYJA 3S03A 4RQOA 1YQNA 4IIJA 4LNUA 1VQ7F 4O2AA 3VO8A 4X1IA 5EB0A 4C8GA 3N2KB 3E1YA 4M8IA 4FFBB 3EORA 1TUBA 2EWCA
chains in the Genus database with same CATH topology
1PF5A 1QAHA 2CVLA 2B33A 3I7TA 2UYPA 1DBFA 3K0TA 2CSLA 1ODEA 1FNKA 3KJKA 3L7QA 3LMEA 1X25A 4NWOB 1XHOA 3ZP4A 1COMA 3VCZA 1XRGA 2EWCA 2UYKA 2UYJA 1QD9A 4ZK7A 3KJJA 2CHTA 3K12A 3ZOPA 1JD1A 2CWJA 3R0PA 1QU9A 1NQ3A 2IG8A 3I3FA 3ZO8A 1J7HA 1ONIA 3MQWA 1UFYA 3LYBA 3ZP7A 3QUWA 1UI9A 2UYNA 2UYNB 3D01A 3GTZA 3V4DA 2OTMA 3M4SA 2CW4A 3M1XA 2DYYA 5HP8A 5HP7A 1FNJA 2CHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PF5 A;  1QAH A;  2CVL A;  2B33 A;  3I7T A;  2UYP A;  1DBF A;  3K0T A;  2CSL A;  1ODE A;  1FNK A;  3KJK A;  3L7Q A;  3LME A;  1X25 A;  4NWO B;  1XHO A;  3ZP4 A;  1COM A;  3VCZ A;  1XRG A;  2EWC A;  2UYK A;  2UYJ A;  1QD9 A;  4ZK7 A;  3KJJ A;  2CHT A;  3K12 A;  3ZOP A;  1JD1 A;  2CWJ A;  3R0P A;  1QU9 A;  1NQ3 A;  2IG8 A;  3I3F A;  3ZO8 A;  1J7H A;  1ONI A;  3MQW A;  1UFY A;  3LYB A;  3ZP7 A;  3QUW A;  1UI9 A;  2UYN A;  2UYN B;  3D01 A;  3GTZ A;  3V4D A;  2OTM A;  3M4S A;  2CW4 A;  3M1X A;  2DYY A;  5HP8 A;  5HP7 A;  1FNJ A;  2CHS A; 
#chains in the Genus database with same CATH topology
 1CN7 A;  3F0F A;  4EI9 A;  2K1S A;  4U3J A;  1TVK A;  3RYF A;  2AMT A;  4ZHV A;  4YJ2 A;  1VQ4 F;  3IEQ A;  3OBY A;  3IMP A;  3T80 A;  1XHO A;  3LFO A;  4G88 A;  3ELC A;  3GYQ A;  3Q8H A;  3WGJ A;  5KMG A;  3NVI B;  3NK6 A;  3I55 F;  4O4L A;  3KIZ A;  1K73 H;  4TV8 A;  4G4Y A;  5JQG A;  3OON A;  5LP6 C;  2HX0 A;  3HWU A;  1N8R H;  3JCM M;  3MQW A;  2VAP A;  2OTJ F;  4X3L A;  3J80 M;  2Z1T A;  1TVK B;  3RYF B;  4YJ2 B;  5G4V C;  5EWR A;  3WXM B;  4DRX B;  2OZB A;  2WAL A;  3PLA C;  4C81 A;  3MCQ A;  2KTV A;  5ITZ A;  5MN5 A;  1T0A A;  5KMG B;  3CCU F;  3BYQ A;  4O4L B;  2BTQ B;  3M84 A;  2GLZ A;  3C9U A;  4TV8 B;  5JQG B;  5EO3 A;  2CHT A;  3IEW A;  1YIJ F;  3MCA B;  2KTU A;  3B6N A;  3JAS B;  4HNA A;  1H47 A;  3J81 M;  3FFM A;  3CPQ A;  3D00 A;  3GTZ A;  1VQN F;  2OTM A;  3UT5 B;  4TUY A;  5HP7 A;  3LWV C;  1IPA A;  3WGN A;  1VQ5 F;  2UYP A;  5GAN K;  3HKD B;  5EIB C;  3CCE F;  1QVG F;  2PMP A;  5IJ0 A;  5B8F A;  5HXU A;  5LA6 B;  4ZK7 A;  1FFX A;  4E6E A;  4C8E A;  1Q82 H;  3G4S F;  2Z1E A;  4HNA B;  2OTL F;  1X52 A;  4WBN B;  5FLX M;  1Q8R A;  1X7P A;  4RHA A;  1KC8 H;  3VYU C;  1M90 H;  5GON B;  1VQV A;  5LYJ A;  1VQO F;  3IKF A;  4EI8 A;  4X1Y B;  2CVL A;  2QI2 A;  1VHA A;  2CSL A;  3L7Q A;  1FNK A;  2FGY A;  3S0W A;  1COM A;  2YXZ A;  3F0D A;  2V9Y A;  2HP0 A;  3ON1 A;  4EI7 A;  2ZF8 A;  5LYJ B;  4ZHW A;  2JNB A;  4BT7 A;  4C4W C;  5KX5 B;  1YHQ F;  1ZWZ A;  2R75 1;  1M1K H;  1RQ7 A;  1DT9 A;  1Z5W A;  2ZAU A;  1X25 A;  2VGM A;  3FPI A;  3C9S A;  4BW0 B;  3HKC B;  5IYZ A;  1VQ6 F;  3CC7 F;  5EAZ A;  3JAM M;  1YJW F;  5EB1 B;  5LXT A;  1T0K B;  4O4H B;  3CXC F;  2FC3 A;  1K9M H;  1VH8 A;  1NQ3 A;  2CZW A;  3NMU C;  3V4D A;  3CC2 F;  4EB6 B;  3RYH A;  2RHO A;  5IT9 M;  2UYN A;  5HP8 A;  4BT4 A;  1U3P A;  4O2B A;  1W3E X;  3CCR F;  4B5C A;  3P0Z A;  2HQS C;  1Z5V A;  2OHW A;  4IHJ A;  2GVI A;  2Q1Y A;  3ESJ A;  1VQ8 F;  1H48 A;  3C9T A;  3S06 A;  2ZOD A;  3CC4 F;  5J2T A;  1W42 A;  4IIJ B;  4LNU B;  3WGM A;  4O2A B;  5JCO A;  4X1I B;  3CCJ F;  2IG8 A;  2HVY D;  5IJ9 A;  3NK7 A;  3RYH B;  2UYN B;  4O2B B;  1TUB B;  3KE1 A;  4BT2 A;  1QAH A;  4U3J B;  3TD4 A;  1U3L A;  3I7T A;  4IHJ B;  3PAF A;  4F6R A;  3U0O A;  4NWO B;  1W57 A;  1YJ9 F;  5J2T B;  2N48 A;  1S72 F;  2QEX F;  5EIB D;  1QD9 A;  1FSZ A;  2HRU A;  3CD6 F;  3ZOP A;  1Q81 H;  2CWJ A;  3DDN A;  1QU9 A;  2RB9 A;  3MBM A;  5IJ9 B;  3TD5 A;  4B62 A;  3D54 A;  4TV9 A;  1J7H A;  1W5A A;  1UFY A;  3LYB A;  3VOA A;  3S0H A;  1VK3 A;  3E22 A;  3JAR A;  4R40 B;  3JAK A;  1U40 A;  2B33 A;  4F6R B;  4NUT A;  3G6E F;  3SIU A;  1JY8 A;  2H6L A;  2Z1U A;  4YJ3 A;  1GX1 A;  1IV1 A;  5ITZ B;  4G4V A;  1W5E A;  5LOV A;  4BY9 D;  5JVD A;  2RHL A;  2DT4 A;  2UZH A;  1W41 A;  3C8L A;  3TD3 A;  1YJN F;  3WJR A;  4PWT A;  5CA1 A;  1SDS A;  3JAR B;  2L26 A;  3JAK B;  4TUY B;  2HRY A;  2CW4 A;  2DYY A;  1W58 1;  3K2X A;  2I6R A;  4YJ3 B;  1VQK F;  3FBA A;  1NMU B;  5FNV A;  3CYQ A;  5HY0 A;  5JVD B;  3HKE A;  3WPW A;  3JAL A;  3RA5 A;  5IJ0 B;  1NJI H;  5EYP A;  3WGL A;  4B45 A;  1IV2 A;  4KWE A;  4ZHQ A;  5J2U A;  1FFX B;  3N4Y A;  2BTU A;  5BMV A;  2H8E A;  3HJW C;  3FD5 A;  3K14 A;  2AIF A;  5DCV A;  3CCS F;  5CA1 B;  1OAP A;  1KD1 H;  3O85 A;  1RLG A;  2P6Y A;  3VTI C;  2G9I A;  1QVF F;  3IR9 A;  2QA4 F;  4O4I A;  5FNV B;  3HKE B;  5CA0 A;  3JAL B;  2BO1 A;  3JAW A;  3MDO A;  1ODE A;  3RYC A;  3VIU A;  4U39 A;  2Z1F A;  1YIT F;  3ZP4 A;  3CPW F;  3KHN A;  3V3T A;  2VAW A;  3RA6 A;  1R1M A;  2QTP A;  4BT3 A;  4TZZ A;  1YI2 F;  1CK2 A;  2HP0 B;  3R0P A;  3CMA F;  3LDT A;  3JAT A;  1VQ9 F;  3QUW A;  4G4Z A;  3P10 A;  4B46 A;  4BT6 A;  5MN4 A;  4FFB A;  2PHN A;  2ZVY A;  1PF5 A;  3JAW B;  1U43 A;  3F0G A;  3RYI A;  3RYC B;  4XCQ A;  1W5F A;  1PXW A;  3LME A;  3WJP A;  5JCO C;  1YGY A;  1JFF A;  1W5B A;  3CCV F;  3C9R A;  5IYZ B;  3VCZ A;  3WPX A;  5LXT B;  3KJJ A;  4ZI7 A;  4O4J A;  3JAT B;  3P4E A;  2KGW A;  1KNK A;  3I3F A;  3LWR C;  3CG6 A;  1XBI A;  3ZP7 A;  1GZ0 A;  2ALE A;  1H7M A;  3HKB A;  3RYI B;  2W8B C;  1GO0 A;  4C8I A;  3F0E A;  4ERH A;  4ZHY B;  2GZL A;  1JFF B;  1KNJ A;  3FD6 A;  4DRX A;  1JJ2 F;  4NQ3 A;  1SA0 A;  2HS4 A;  5HY1 A;  2MQE A;  3CB2 A;  4BVR A;  5A2Q M;  2VGN A;  1W59 A;  4ZI7 B;  4BT5 A;  1K8A H;  3N4Z A;  4O4J B;  5GIO C;  5AVM A;  3WGK A;  3QHD A;  4LCK A;  3WJQ A;  3VYT C;  2F9Z C;  3JAS A;  4DXD A;  1ONI A;  1RQ2 A;  3V7Q A;  3HKB B;  2NMU A;  3CME F;  2HS3 A;  3LWO C;  4I4T A;  3UT5 A;  3QTY A;  5LP6 A;  2ZOV A;  1DBF A;  1SA0 B;  3S02 A;  2R6R 1;  3HKD A;  3CYP B;  5GIN C;  2RHH A;  2Q1X A;  2RHJ A;  5GIP C;  1E7K A;  3VOB A;  3I56 F;  2LBW A;  4BVQ A;  5LA6 A;  5JH7 A;  2IAF A;  3E20 B;  3SIV A;  2IQQ A;  1JD1 A;  1CLI A;  3GHZ A;  5EZY A;  4C82 A;  4TV9 B;  3ERN A;  4WBN A;  2LBX A;  1Q86 H;  1XV2 A;  2Z01 A;  4ZOL A;  5GON A;  4I4T B;  3E22 B;  5LP6 B;  3CCL F;  2YYE A;  1FNJ A;  1KQS F;  5MN6 A;  3HAX D;  4X1Y A;  3HTN A;  3AGK A;  2VAM A;  3JVH A;  2AIZ P;  3J7A R;  2ZVZ A;  5LOV B;  3KJK A;  3N2G A;  3RE3 A;  1W55 A;  3F6M A;  2I6D A;  5JH7 B;  2HS0 A;  2UYK A;  1VQP F;  4I50 A;  5EZY B;  4BVS A;  3K12 A;  5C8Y A;  1IV3 A;  4X1K A;  3VYS C;  3DC2 A;  4ZOL B;  3OBW A;  3ZO8 A;  2VXY A;  4X3M A;  5CB4 A;  3OW2 F;  1OFU A;  5HY4 A;  3M4S A;  5KX5 A;  3VMF B;  3IKE A;  2CHS A;  1SZQ A;  1RLU A;  1IV4 A;  3N2G B;  5GAP K;  2H8C A;  1VQM F;  3G71 F;  5EYP B;  3S0Y A;  4ZHQ B;  5J2U B;  4X20 A;  5HXZ A;  4I50 B;  5HWE A;  1XRG A;  1VQL F;  3HKC A;  5BMV B;  4X1K B;  5C8Y B;  1JN1 A;  4I55 A;  5HY2 A;  5G4U C;  1W40 A;  3CCQ F;  3CCM F;  5FJ4 C;  4O4H A;  5CB4 B;  3V7E A;  4G4X A;  1GO1 A;  1RA4 A;  1UI9 A;  3D01 A;  2BTO A;  3N2K A;  3M1X A;  3VI6 A;  4O4I B;  4EB6 A;  5CA0 B;  1X7O A;  4G4W A;  1Q7Y H;  3K0T A;  4X20 B;  4BVT A;  1W2B F;  2HP3 A;  2KG4 A;  2LCA A;  2LBT A;  4I55 B;  3LWQ C;  3LWP C;  3NVK E;  2UYJ A;  3S03 A;  4RQO A;  1YQN A;  4IIJ A;  4LNU A;  1VQ7 F;  4O2A A;  3VO8 A;  4X1I A;  5EB0 A;  4C8G A;  3N2K B;  3E1Y A;  4M8I A;  4FFB B;  3EOR A;  1TUB A;  2EWC A; 
#chains in the Genus database with same CATH homology
 1PF5 A;  1QAH A;  2CVL A;  2B33 A;  3I7T A;  2UYP A;  1DBF A;  3K0T A;  2CSL A;  1ODE A;  1FNK A;  3KJK A;  3L7Q A;  3LME A;  1X25 A;  4NWO B;  1XHO A;  3ZP4 A;  1COM A;  3VCZ A;  1XRG A;  2EWC A;  2UYK A;  2UYJ A;  1QD9 A;  4ZK7 A;  3KJJ A;  2CHT A;  3K12 A;  3ZOP A;  1JD1 A;  2CWJ A;  3R0P A;  1QU9 A;  1NQ3 A;  2IG8 A;  3I3F A;  3ZO8 A;  1J7H A;  1ONI A;  3MQW A;  1UFY A;  3LYB A;  3ZP7 A;  3QUW A;  1UI9 A;  2UYN A;  2UYN B;  3D01 A;  3GTZ A;  3V4D A;  2OTM A;  3M4S A;  2CW4 A;  3M1X A;  2DYY A;  5HP8 A;  5HP7 A;  1FNJ A;  2CHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...