4R40B

Crystal structure of tolb/pal complex from yersinia pestis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
SNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein TolB
publication title Crystal Structure of TolB/Pal complex from Yersinia pestis.
rcsb
source organism Yersinia pestis co92
total genus 31
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4r40B01
2N48A 4PWTA 4G4ZA 5EB0A 3S06A 2L26A 2MQEA 4R40B 2KGWA 4G4XA 3TD5A 2K1SA 3S02A 1OAPA 4G4VA 2ZOVA 2ZF8A 5EAZA 3WPWA 2W8BC 3LDTA 3S0HA 2LCAA 3S0WA 4ERHA 4ZHYB 2ZVZA 4ZHVA 3S03A 4G4WA 4B62A 4B5CA 4G88A 3S0YA 3TD3A 5EB1B 3KHNA 3OONA 4G4YA 3IMPA 2LBTA 2HQSC 2ZVYA 3WPXA 3CYPB 1R1MA 4ZHWA 3TD4A 2AIZP 3CYQA 4RHAA
chains in the Genus database with same CATH superfamily
2UYPA 1X52A 5EO3A 3JARB 5C8YB 3CPWF 4BVTA 3I56F 3S06A 2R6R1 5CA0B 2VAWA 2KGWA 3JASB 3KIZA 2OTLF 2B33A 1X7OA 3RYHA 3WGMA 1FFXB 2Z1EA 2JNBA 3D00A 4O4HA 3RYIB 5LP6A 1YIJF 2I6RA 2RHJA 4X1IB 4B5CA 4O4IB 1NQ3A 4X1YB 1UI9A 1H47A 3F6MA 5B8FA 1PXWA 2YXZA 3N4ZA 3VIUA 5EYPB 2ZVYA 3C8LA 1W40A 3N2KA 3ZP4A 4BT7A 5IJ0B 2L26A 1FSZA 4NQ3A 3VI6A 4B45A 3N2GA 3D01A 4X3MA 1RLGA 1OAPA 3L7QA 3RE3A 3JCMM 2G9IA 5LA6B 3CMEF 5KX5A 1JFFA 4G4WA 2Z1TA 3ERNA 1RLUA 1YJNF 4NWOB 4U3JB 1TUBB 2CHSA 3CCVF 5HP7A 4I4TA 3J80M 3JAMM 5J2UB 3CYPB 3DC2A 3IEWA 4LNUB 2P6YA 2N48A 2F9ZC 3HKEA 5IJ9B 3JALA 4O4JB 5JVDB 2GZLA 3KJJA 4C8EA 4IHJA 5LYJB 3G6EF 3OBWA 4TV8A 3BYQA 5LXTA 1KC8H 5EZYA 3LWOC 2HP0B 2VAMA 4C8GA 3HTNA 4BT6A 3ELCA 5EB1B 3HKCA 3CG6A 3CCRF 4FFBA 1TVKB 2RB9A 3KE1A 5HXUA 4YJ3A 1KQSF 3HKBA 3VO8A 5AVMA 3UT5B 4HNAB 4G4XA 5GAPK 3G4SF 3S02A 3JAKA 3F0FA 3V3TA 2RHOA 3CPQA 1YI2F 3SIUA 1E7KA 1Z5VA 4TV9A 3LWRC 3O85A 3VTIC 3CMAF 4B62A 5CA1B 2IAFA 2Q1XA 3VYUC 2PHNA 1QAHA 1U3PA 4U39A 2DT4A 4DRXB 4EI9A 3CYQA 3F0GA 4BW0B 3JATB 1IPAA 5BMVB 3LWPC 5A2QM 3OW2F 3CCEF 2KTVA 1SA0A 3P0ZA 3I55F 3WPWA 2AIFA 4ERHA 3GTZA 3NVKE 3IKEA 3CCMF 3C9RA 1NMUB 3E22A 4X3LA 3ZO8A 5FJ4C 3KHNA 1YGYA 4X20A 5MN5A 3PLAC 2WALA 3ESJA 2ZAUA 4M8IA 5FNVB 1QD9A 3IEQA 4TUYA 3J81M 3P4EA 4I50B 1SDSA 5GONA 3HWUA 5EIBC 1OFUA 2K1SA 4F6RA 1W5AA 4X1KA 1SZQA 2R751 5LP6B 5ITZA 2OTJF 1Q82H 4BT5A 4O2BA 4O2AB 2NMUA 5KMGA 1YITF 2CWJA 3CCJF 4C81A 5IYZB 4YJ2A 5J2TA 1QU9A 1GX1A 4PWTA 3RYFB 5EIBD 2GVIA 3CCQF 3N2GB 2RHHA 3LWQC 3JARA 5C8YA 2QI2A 1VQMF 5CA0A 1FNJA 1NJIH 4ZI7B 3WGJA 3JASA 1ONIA 5MN6A 2BO1A 1ODEA 2W8BC 1FFXA 1YHQF 4LCKA 3RYIA 4X1IA 1KNJA 4X1YA 1K9MH 3GYQA 3CXCF 5EYPA 1JD1A 4ZK7A 2AIZP 3WXMB 1W5FA 1UFYA 4E6EA 5MN4A 4IIJA 3M4SA 3MDOA 4EI8A 2HX0A 1GO0A 1RQ2A 5LXTB 5EZYB 5LA6A 3ZP7A 1KD1H 3VCZA 4O4LB 3VOAA 2HP3A 3HKCB 1IV3A 1ZWZA 3IKFA 2LBTA 4FFBB 4U3JA 1TUBA 2CW4A 4BVSA 1VQKF 3TD4A 4EB6B 5J2UA 3VYSC 4ZOLB 5IJ9A 2UYNA 4O4JA 4I55B 5JVDA 3CCLF 2LBXA 5EAZA 2DYYA 5G4VC 4C4WC 1T0KB 2EWCA 1IV4A 1YJWF 3CC7F 1VQVA 3T80A 4B46A 4BVRA 2HP0A 3V7EA 4G4YA 5FLXM 2BTOA 2HS0A 2UYJA 3LMEA 2Z01A 1VQ5F 3B6NA 2BTUA 3K12A 3WGKA 1YJ9F 3J7AR 1JN1A 4XCQA 1K8AH 1CLIA 4ZHQB 5CB4A 2VGMA 2MQEA 3C9TA 3LYBA 5G4UC 1N8RH 1XV2A 3RYCB 3UT5A 2HS4A 4HNAA 1J7HA 1JY8A 2ZOVA 1VQLF 4WBNB 3MQWA 2ZODA 1W42A 2Z1UA 5LOVA 1QVFF 2YYEA 3HKDB 1W3EX 1VQ4F 3V7QA 5JQGB 4BT3A 3AGKA 3DDNA 5CA1A 5JH7A 1VQ9F 3CCSF 3NVIB 3F0EA 3EORA 3VMFB 2QA4F 4RHAA 3PAFA 4DRXA 2H8CA 2UZHA 3QTYA 5BMVA 1W5EA 4RQOA 1DBFA 3K2XA 4R40B 2PMPA 3RYHB 2QTPA 3WJRA 2GLZA 4O4HB 1W2BF 2ZF8A 1GZ0A 2CHTA 2FGYA 1FNKA 2FC3A 3FD5A 4C82A 1H48A 5JCOA 1VQPF 3N2KB 3NK6A 3JAWA 1VQNF 3WJPA 1R1MA 5GINC 4ZHWA 1KNKA 5FNVA 2UYKA 3FPIA 4I50A 1VK3A 3TD5A 2Z1FA 3D54A 3LWVC 1T0AA 5KX5B 5DCVA 4ZHYB 3S0HA 3S0WA 1COMA 3F0DA 5JCOC 1JFFB 3CC4F 3CD6F 2HRUA 3WGNA 4G88A 4O2AA 4I4TB 5HXZA 1U40A 3C9UA 3IMPA 3VYTC 1JJ2F 4O4IA 3LFOA 4BT2A 1RQ7A 2IQQA 5GANK 1DT9A 1W57A 1X25A 3I3FA 4IIJB 3ON1A 5IYZA 3NMUC 2KTUA 3HKEB 5IT9M 3JALB 3G71F 5EB0A 1RA4A 2CVLA 3RYFA 5IJ0A 1VQOF 4IHJB 5LP6C 1YQNA 3WGLA 2OTMA 4TV8B 2I6DA 4NUTA 4ZI7A 3C9SA 4DXDA 2OHWA 3E1YA 2Q1YA 1PF5A 1Q81H 4TZZA 3S0YA 3IR9A 3QHDA 1VQ6F 3FBAA 2VXYA 4C8IA 4KWEA 2CSLA 4YJ3B 1W5BA 3HKBB 4G4ZA 4LNUA 4BT4A 2UYNB 1IV1A 3NK7A 2LBWA 1XBIA 3JAKB 1Q86H 4TV9B 3LDTA 2QEXF 4EI7A 2LCAA 5LYJA 3MCAB 1H7MA 3S03A 3SIVA 4O4LA 5GIPC 3VOBA 3M84A 1W581 3OONA 2HVYD 3WJQA 3GHZA 1U43A 2HS3A 3K0TA 3U0OA 3WPXA 2AMTA 5CB4B 1VH8A 3RA6A 4EB6A 3HAXD 1K73H 1TVKA 2H8EA 5HWEA 3ZOPA 5HY1A 1W55A 4BY9D 3KJKA 3MBMA 1XHOA 4ZOLA 1SA0B 1XRGA 1M1KH 3RA5A 3V4DA 4BVQA 4I55A 1S72F 5LOVB 1CN7A 3JVHA 5EWRA 1Q7YH 1U3LA 3N4YA 1GO1A 3E22B 1VHAA 3FFMA 3R0PA 1Z5WA 5JH7B 4X20B 2ALEA 1QVGF 1W59A 2BTQB 3K14A 5GIOC 1VQ7F 2V9YA 2HQSC 1X7PA 1W41A 2H6LA 5HY2A 2RHLA 4TUYB 2IG8A 1M90H 2OZBA 2VGNA 5GONB 3OBYA 3JATA 4ZHQA 4F6RB 4X1KB 2HRYA 4G4VA 5ITZB 3RYCA 4O2BB 3CCUF 3CC2F 1IV2A 3P10A 5HP8A 2ZVZA 4WBNA 3M1XA 3Q8HA 4ZHVA 5KMGB 1VQ8F 3I7TA 3MCQA 3HKDA 2KG4A 2VAPA 3CB2A 3JAWB 2CZWA 3TD3A 5HY0A 5JQGA 4YJ2B 3QUWA 5HY4A 3FD6A 5J2TB 3HJWC 1Q8RA 1CK2A 3E20B
chains in the Genus database with same CATH topology
2N48A 4PWTA 4G4ZA 5EB0A 3S06A 2L26A 2MQEA 4R40B 2KGWA 4G4XA 3TD5A 2K1SA 3S02A 1OAPA 4G4VA 2ZOVA 2ZF8A 5EAZA 3WPWA 2W8BC 3LDTA 3S0HA 2LCAA 3S0WA 4ERHA 4ZHYB 2ZVZA 4ZHVA 3S03A 4G4WA 4B62A 4B5CA 4G88A 3S0YA 3TD3A 5EB1B 3KHNA 3OONA 4G4YA 3IMPA 2LBTA 2HQSC 2ZVYA 3WPXA 3CYPB 1R1MA 4ZHWA 3TD4A 2AIZP 3CYQA 4RHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N48 A;  4PWT A;  4G4Z A;  5EB0 A;  3S06 A;  2L26 A;  2MQE A;  4R40 B;  2KGW A;  4G4X A;  3TD5 A;  2K1S A;  3S02 A;  1OAP A;  4G4V A;  2ZOV A;  2ZF8 A;  5EAZ A;  3WPW A;  2W8B C;  3LDT A;  3S0H A;  2LCA A;  3S0W A;  4ERH A;  4ZHY B;  2ZVZ A;  4ZHV A;  3S03 A;  4G4W A;  4B62 A;  4B5C A;  4G88 A;  3S0Y A;  3TD3 A;  5EB1 B;  3KHN A;  3OON A;  4G4Y A;  3IMP A;  2LBT A;  2HQS C;  2ZVY A;  3WPX A;  3CYP B;  1R1M A;  4ZHW A;  3TD4 A;  2AIZ P;  3CYQ A;  4RHA A; 
#chains in the Genus database with same CATH topology
 2UYP A;  1X52 A;  5EO3 A;  3JAR B;  5C8Y B;  3CPW F;  4BVT A;  3I56 F;  3S06 A;  2R6R 1;  5CA0 B;  2VAW A;  2KGW A;  3JAS B;  3KIZ A;  2OTL F;  2B33 A;  1X7O A;  3RYH A;  3WGM A;  1FFX B;  2Z1E A;  2JNB A;  3D00 A;  4O4H A;  3RYI B;  5LP6 A;  1YIJ F;  2I6R A;  2RHJ A;  4X1I B;  4B5C A;  4O4I B;  1NQ3 A;  4X1Y B;  1UI9 A;  1H47 A;  3F6M A;  5B8F A;  1PXW A;  2YXZ A;  3N4Z A;  3VIU A;  5EYP B;  2ZVY A;  3C8L A;  1W40 A;  3N2K A;  3ZP4 A;  4BT7 A;  5IJ0 B;  2L26 A;  1FSZ A;  4NQ3 A;  3VI6 A;  4B45 A;  3N2G A;  3D01 A;  4X3M A;  1RLG A;  1OAP A;  3L7Q A;  3RE3 A;  3JCM M;  2G9I A;  5LA6 B;  3CME F;  5KX5 A;  1JFF A;  4G4W A;  2Z1T A;  3ERN A;  1RLU A;  1YJN F;  4NWO B;  4U3J B;  1TUB B;  2CHS A;  3CCV F;  5HP7 A;  4I4T A;  3J80 M;  3JAM M;  5J2U B;  3CYP B;  3DC2 A;  3IEW A;  4LNU B;  2P6Y A;  2N48 A;  2F9Z C;  3HKE A;  5IJ9 B;  3JAL A;  4O4J B;  5JVD B;  2GZL A;  3KJJ A;  4C8E A;  4IHJ A;  5LYJ B;  3G6E F;  3OBW A;  4TV8 A;  3BYQ A;  5LXT A;  1KC8 H;  5EZY A;  3LWO C;  2HP0 B;  2VAM A;  4C8G A;  3HTN A;  4BT6 A;  3ELC A;  5EB1 B;  3HKC A;  3CG6 A;  3CCR F;  4FFB A;  1TVK B;  2RB9 A;  3KE1 A;  5HXU A;  4YJ3 A;  1KQS F;  3HKB A;  3VO8 A;  5AVM A;  3UT5 B;  4HNA B;  4G4X A;  5GAP K;  3G4S F;  3S02 A;  3JAK A;  3F0F A;  3V3T A;  2RHO A;  3CPQ A;  1YI2 F;  3SIU A;  1E7K A;  1Z5V A;  4TV9 A;  3LWR C;  3O85 A;  3VTI C;  3CMA F;  4B62 A;  5CA1 B;  2IAF A;  2Q1X A;  3VYU C;  2PHN A;  1QAH A;  1U3P A;  4U39 A;  2DT4 A;  4DRX B;  4EI9 A;  3CYQ A;  3F0G A;  4BW0 B;  3JAT B;  1IPA A;  5BMV B;  3LWP C;  5A2Q M;  3OW2 F;  3CCE F;  2KTV A;  1SA0 A;  3P0Z A;  3I55 F;  3WPW A;  2AIF A;  4ERH A;  3GTZ A;  3NVK E;  3IKE A;  3CCM F;  3C9R A;  1NMU B;  3E22 A;  4X3L A;  3ZO8 A;  5FJ4 C;  3KHN A;  1YGY A;  4X20 A;  5MN5 A;  3PLA C;  2WAL A;  3ESJ A;  2ZAU A;  4M8I A;  5FNV B;  1QD9 A;  3IEQ A;  4TUY A;  3J81 M;  3P4E A;  4I50 B;  1SDS A;  5GON A;  3HWU A;  5EIB C;  1OFU A;  2K1S A;  4F6R A;  1W5A A;  4X1K A;  1SZQ A;  2R75 1;  5LP6 B;  5ITZ A;  2OTJ F;  1Q82 H;  4BT5 A;  4O2B A;  4O2A B;  2NMU A;  5KMG A;  1YIT F;  2CWJ A;  3CCJ F;  4C81 A;  5IYZ B;  4YJ2 A;  5J2T A;  1QU9 A;  1GX1 A;  4PWT A;  3RYF B;  5EIB D;  2GVI A;  3CCQ F;  3N2G B;  2RHH A;  3LWQ C;  3JAR A;  5C8Y A;  2QI2 A;  1VQM F;  5CA0 A;  1FNJ A;  1NJI H;  4ZI7 B;  3WGJ A;  3JAS A;  1ONI A;  5MN6 A;  2BO1 A;  1ODE A;  2W8B C;  1FFX A;  1YHQ F;  4LCK A;  3RYI A;  4X1I A;  1KNJ A;  4X1Y A;  1K9M H;  3GYQ A;  3CXC F;  5EYP A;  1JD1 A;  4ZK7 A;  2AIZ P;  3WXM B;  1W5F A;  1UFY A;  4E6E A;  5MN4 A;  4IIJ A;  3M4S A;  3MDO A;  4EI8 A;  2HX0 A;  1GO0 A;  1RQ2 A;  5LXT B;  5EZY B;  5LA6 A;  3ZP7 A;  1KD1 H;  3VCZ A;  4O4L B;  3VOA A;  2HP3 A;  3HKC B;  1IV3 A;  1ZWZ A;  3IKF A;  2LBT A;  4FFB B;  4U3J A;  1TUB A;  2CW4 A;  4BVS A;  1VQK F;  3TD4 A;  4EB6 B;  5J2U A;  3VYS C;  4ZOL B;  5IJ9 A;  2UYN A;  4O4J A;  4I55 B;  5JVD A;  3CCL F;  2LBX A;  5EAZ A;  2DYY A;  5G4V C;  4C4W C;  1T0K B;  2EWC A;  1IV4 A;  1YJW F;  3CC7 F;  1VQV A;  3T80 A;  4B46 A;  4BVR A;  2HP0 A;  3V7E A;  4G4Y A;  5FLX M;  2BTO A;  2HS0 A;  2UYJ A;  3LME A;  2Z01 A;  1VQ5 F;  3B6N A;  2BTU A;  3K12 A;  3WGK A;  1YJ9 F;  3J7A R;  1JN1 A;  4XCQ A;  1K8A H;  1CLI A;  4ZHQ B;  5CB4 A;  2VGM A;  2MQE A;  3C9T A;  3LYB A;  5G4U C;  1N8R H;  1XV2 A;  3RYC B;  3UT5 A;  2HS4 A;  4HNA A;  1J7H A;  1JY8 A;  2ZOV A;  1VQL F;  4WBN B;  3MQW A;  2ZOD A;  1W42 A;  2Z1U A;  5LOV A;  1QVF F;  2YYE A;  3HKD B;  1W3E X;  1VQ4 F;  3V7Q A;  5JQG B;  4BT3 A;  3AGK A;  3DDN A;  5CA1 A;  5JH7 A;  1VQ9 F;  3CCS F;  3NVI B;  3F0E A;  3EOR A;  3VMF B;  2QA4 F;  4RHA A;  3PAF A;  4DRX A;  2H8C A;  2UZH A;  3QTY A;  5BMV A;  1W5E A;  4RQO A;  1DBF A;  3K2X A;  4R40 B;  2PMP A;  3RYH B;  2QTP A;  3WJR A;  2GLZ A;  4O4H B;  1W2B F;  2ZF8 A;  1GZ0 A;  2CHT A;  2FGY A;  1FNK A;  2FC3 A;  3FD5 A;  4C82 A;  1H48 A;  5JCO A;  1VQP F;  3N2K B;  3NK6 A;  3JAW A;  1VQN F;  3WJP A;  1R1M A;  5GIN C;  4ZHW A;  1KNK A;  5FNV A;  2UYK A;  3FPI A;  4I50 A;  1VK3 A;  3TD5 A;  2Z1F A;  3D54 A;  3LWV C;  1T0A A;  5KX5 B;  5DCV A;  4ZHY B;  3S0H A;  3S0W A;  1COM A;  3F0D A;  5JCO C;  1JFF B;  3CC4 F;  3CD6 F;  2HRU A;  3WGN A;  4G88 A;  4O2A A;  4I4T B;  5HXZ A;  1U40 A;  3C9U A;  3IMP A;  3VYT C;  1JJ2 F;  4O4I A;  3LFO A;  4BT2 A;  1RQ7 A;  2IQQ A;  5GAN K;  1DT9 A;  1W57 A;  1X25 A;  3I3F A;  4IIJ B;  3ON1 A;  5IYZ A;  3NMU C;  2KTU A;  3HKE B;  5IT9 M;  3JAL B;  3G71 F;  5EB0 A;  1RA4 A;  2CVL A;  3RYF A;  5IJ0 A;  1VQO F;  4IHJ B;  5LP6 C;  1YQN A;  3WGL A;  2OTM A;  4TV8 B;  2I6D A;  4NUT A;  4ZI7 A;  3C9S A;  4DXD A;  2OHW A;  3E1Y A;  2Q1Y A;  1PF5 A;  1Q81 H;  4TZZ A;  3S0Y A;  3IR9 A;  3QHD A;  1VQ6 F;  3FBA A;  2VXY A;  4C8I A;  4KWE A;  2CSL A;  4YJ3 B;  1W5B A;  3HKB B;  4G4Z A;  4LNU A;  4BT4 A;  2UYN B;  1IV1 A;  3NK7 A;  2LBW A;  1XBI A;  3JAK B;  1Q86 H;  4TV9 B;  3LDT A;  2QEX F;  4EI7 A;  2LCA A;  5LYJ A;  3MCA B;  1H7M A;  3S03 A;  3SIV A;  4O4L A;  5GIP C;  3VOB A;  3M84 A;  1W58 1;  3OON A;  2HVY D;  3WJQ A;  3GHZ A;  1U43 A;  2HS3 A;  3K0T A;  3U0O A;  3WPX A;  2AMT A;  5CB4 B;  1VH8 A;  3RA6 A;  4EB6 A;  3HAX D;  1K73 H;  1TVK A;  2H8E A;  5HWE A;  3ZOP A;  5HY1 A;  1W55 A;  4BY9 D;  3KJK A;  3MBM A;  1XHO A;  4ZOL A;  1SA0 B;  1XRG A;  1M1K H;  3RA5 A;  3V4D A;  4BVQ A;  4I55 A;  1S72 F;  5LOV B;  1CN7 A;  3JVH A;  5EWR A;  1Q7Y H;  1U3L A;  3N4Y A;  1GO1 A;  3E22 B;  1VHA A;  3FFM A;  3R0P A;  1Z5W A;  5JH7 B;  4X20 B;  2ALE A;  1QVG F;  1W59 A;  2BTQ B;  3K14 A;  5GIO C;  1VQ7 F;  2V9Y A;  2HQS C;  1X7P A;  1W41 A;  2H6L A;  5HY2 A;  2RHL A;  4TUY B;  2IG8 A;  1M90 H;  2OZB A;  2VGN A;  5GON B;  3OBY A;  3JAT A;  4ZHQ A;  4F6R B;  4X1K B;  2HRY A;  4G4V A;  5ITZ B;  3RYC A;  4O2B B;  3CCU F;  3CC2 F;  1IV2 A;  3P10 A;  5HP8 A;  2ZVZ A;  4WBN A;  3M1X A;  3Q8H A;  4ZHV A;  5KMG B;  1VQ8 F;  3I7T A;  3MCQ A;  3HKD A;  2KG4 A;  2VAP A;  3CB2 A;  3JAW B;  2CZW A;  3TD3 A;  5HY0 A;  5JQG A;  4YJ2 B;  3QUW A;  5HY4 A;  3FD6 A;  5J2T B;  3HJW C;  1Q8R A;  1CK2 A;  3E20 B; 
#chains in the Genus database with same CATH homology
 2N48 A;  4PWT A;  4G4Z A;  5EB0 A;  3S06 A;  2L26 A;  2MQE A;  4R40 B;  2KGW A;  4G4X A;  3TD5 A;  2K1S A;  3S02 A;  1OAP A;  4G4V A;  2ZOV A;  2ZF8 A;  5EAZ A;  3WPW A;  2W8B C;  3LDT A;  3S0H A;  2LCA A;  3S0W A;  4ERH A;  4ZHY B;  2ZVZ A;  4ZHV A;  3S03 A;  4G4W A;  4B62 A;  4B5C A;  4G88 A;  3S0Y A;  3TD3 A;  5EB1 B;  3KHN A;  3OON A;  4G4Y A;  3IMP A;  2LBT A;  2HQS C;  2ZVY A;  3WPX A;  3CYP B;  1R1M A;  4ZHW A;  3TD4 A;  2AIZ P;  3CYQ A;  4RHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...