4R40B

Crystal structure of tolb/pal complex from yersinia pestis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
SNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TolB
publication title Crystal Structure of TolB/Pal complex from Yersinia pestis.
rcsb
source organism Yersinia pestis co92
molecule tags Protein transport
total genus 31
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4r40B01
2ZVZA 5EB0A 4ERHA 2MQEA 5EB1B 3S02A 2N48A 4PWTA 3TD5A 3S0WA 3S0YA 3S0HA 4G4XA 4R40B 4G88A 2K1SA 3TD4A 4G4ZA 3WPWA 2LCAA 3WPXA 2W8BC 3S06A 2LBTA 2AIZP 2HQSC 2KGWA 4ZHYB 4ZHWA 4ZHVA 1OAPA 2ZOVA 3CYQA 4G4VA 3IMPA 4G4WA 2L26A 4B62A 4B5CA 3KHNA 5EAZA 2ZF8A 2ZVYA 3S03A 1R1MA 4G4YA 4RHAA 3TD3A 3CYPB 3OONA 3LDTA
chains in the Genus database with same CATH superfamily
1GO0A 4BVSA 3C9RA 4TV9A 5GINC 3D01A 2H6LA 2R6R1 3IKFA 5EB1B 3F0EA 5C8YA 3JATB 2RB9A 3VYSC 3P0ZA 4G4XA 4R40B 3I7TA 2AMTA 4BVRA 3WPXA 3DC2A 4C4WC 3J7AR 1VQNF 3HKDA 1CK2A 1OAPA 3JCMM 5EIBD 2GZLA 1X7OA 3E1YA 4FFBA 2RHLA 3ON1A 1XV2A 5HWEA 2Q1YA 2OTLF 5EZYB 1RQ2A 5IT9M 1XHOA 1K8AH 1W42A 3CCLF 5CA0A 2LCAA 1W2BF 2HVYD 2AIFA 4O4JA 1H47A 3S06A 4ZHWA 1YJNF 3JASB 3VIUA 1KC8H 2Q1XA 2VGNA 3HTNA 2G9IA 3VTIC 5CB4B 4IIJA 4O4LB 3IEQA 4G4YA 3AGKA 3E20B 1VQKF 1U3LA 5J2TB 2VXYA 3NVIB 3VMFB 5LXTB 5KMGB 2I6RA 1VQOF 2BTUA 2ZODA 3K2XA 3HKBA 1RLGA 5LYJA 1YJ9F 3M4SA 4BT2A 4C81A 4G4ZA 5LA6A 1JFFB 4B45A 3EORA 3CCSF 2OZBA 2HQSC 3DDNA 2LBWA 2JNBA 3VOBA 5BMVA 3F6MA 3NVKE 3IR9A 3P10A 1OFUA 4C82A 3CCJF 3O85A 5CA1B 4X1YB 4YJ2A 5JQGB 4O4IA 3LWRC 4O2BB 5IJ9B 3JALB 3U0OA 2QA4F 3ERNA 3ZP7A 1VQLF 1W5AA 4RQOA 1K73H 1S72F 5FNVB 1U40A 1JN1A 3KJKA 4EI8A 3RE3A 1Q82H 3HAXD 5HXZA 3CMEF 5ITZA 5GIPC 1TUBA 5HY4A 2BTQB 4DXDA 3RYFA 4YJ3B 1W5BA 2DYYA 4B5CA 3WJQA 3LMEA 3WGJA 2ZVZA 4I55A 3LWOC 1M1KH 2PHNA 4O2AB 5JVDA 1KD1H 3D54A 3E22B 3HKCB 2BO1A 3S0HA 4WBNB 1QAHA 4BW0B 3WPWA 3G71F 2HP3A 4KWEA 4E6EA 4ZHYB 2FGYA 1VQVA 2BTOA 1VQ5F 5EIBC 4DRXA 4XCQA 3LWPC 2KG4A 3RYIB 2L26A 3M1XA 1W581 3KHNA 1DBFA 3OBYA 4BVTA 1X52A 3ESJA 4F6RB 2P6YA 4ZHQB 3C8LA 1W5FA 3L7QA 3UT5B 1GZ0A 4I4TB 2OTJF 5HP8A 4ZOLB 1IV1A 4TV8A 1NMUB 2OTMA 4IHJA 1Z5WA 4LNUA 2QI2A 2GVIA 4O4HA 5GAPK 1IV2A 1KQSF 3CCUF 1Q86H 2Z1TA 3JAKB 5JH7A 5HP7A 3RA5A 2V9YA 3RYCA 1GO1A 1YQNA 3IMPA 1RQ7A 5LOVA 3HKEB 4B46A 3G4SF 2UYNA 5FJ4C 3HWUA 1XRGA 3CB2A 1W59A 1Q7YH 5MN4A 4I50B 1H48A 5GONA 2B33A 3IKEA 4ZK7A 3D00A 1FFXB 2CWJA 1SA0A 1IV3A 3VOAA 3K14A 5IYZB 3K12A 1VQ7F 1YIJF 1QU9A 3RYHB 3RA6A 3JARA 4HNAB 3LYBA 1NQ3A 2KGWA 3V7QA 3CCRF 2H8EA 3FBAA 4U3JB 1X7PA 3WGKA 2HS3A 3JAWA 5J2UA 4C8IA 5FNVA 4TUYB 5IJ0B 2UZHA 4BT6A 4X1KA 1QD9A 3CCEF 4BT4A 3CPQA 1VH8A 2HP0B 4ZI7A 5MN5A 1ZWZA 3PAFA 1YHQF 2OHWA 1JY8A 3N2GA 3Q8HA 4TV9B 1VK3A 2I6DA 1IPAA 1VQ8F 3K0TA 4EB6A 5C8YB 1YGYA 1PXWA 1VHAA 3V7EA 3ZO8A 2CW4A 1FSZA 4C8EA 1VQMF 3WJRA 5EAZA 4X20A 5EYPA 3C9UA 4RHAA 1U43A 5EO3A 4X3LA 3JVHA 3LDTA 2ALEA 3HKDB 2F9ZC 5EB0A 1IV4A 4ERHA 5HY2A 5DCVA 4NWOB 5LP6C 3CD6F 2IQQA 3WGMA 4M8IA 3GTZA 3B6NA 4G88A 2VGMA 3LFOA 1W40A 4ZHQA 2EWCA 2R751 4U39A 5LP6B 1N8RH 5CA0B 1VQ6F 4NQ3A 2HS4A 4O4JB 3JATA 1YJWF 3QHDA 2HS0A 4C8GA 3OW2F 1W3EX 4EI9A 4BVQA 2N48A 1W41A 2GLZA 2FC3A 3C9SA 3R0PA 1W5EA 5KX5B 2LBTA 3I55F 3CXCF 3T80A 3HKBB 3N4YA 5LYJB 1Q81H 2VAWA 3I56F 1GX1A 3J81M 1VQ4F 5LA6B 5EZYA 5IYZA 3CG6A 3PLAC 3MQWA 5G4VC 2KTVA 1W57A 5HY1A 5BMVB 1J7HA 1PF5A 3ELCA 3JASA 4YJ2B 3N2KB 5JCOC 1COMA 4O4IB 5CB4A 3I3FA 3VO8A 3LWQC 4O4LA 3J80M 2RHOA 1JJ2F 3VYUC 4TUYA 1KNKA 3N4ZA 3KIZA 3MCQA 4ZHVA 2CHTA 3VYTC 3CYQA 2CSLA 5J2TA 1T0KB 5LXTA 1RLUA 2HP0A 4BT3A 5KMGA 2ZF8A 5ITZB 2CHSA 1TUBB 3F0GA 3KE1A 1U3PA 5HY0A 3RYFB 4X1IB 1TVKB 1JFFA 2MQEA 1CLIA 1VQPF 1CN7A 3S0WA 5AVMA 1YI2F 4I55B 3WGNA 1QVFF 2YXZA 5CA1A 5JVDB 4X1YA 3KJJA 3JAMM 4BT5A 2ZAUA 5JQGA 2ZOVA 1X25A 1UI9A 4O2BA 5IJ9A 3JALA 4G4WA 3FD5A 1VQ9F 3CYPB 2W8BC 4DRXB 5FLXM 4BT7A 3F0DA 1RA4A 3ZOPA 2HRYA 3FFMA 5LP6A 5G4UC 4YJ3A 3F0FA 2K1SA 2UYKA 5EWRA 3MCAB 5MN6A 3NMUC 3SIUA 2UYJA 3VCZA 3V3TA 4TV8B 3MDOA 5HXUA 1SDSA 4IHJB 4LNUB 2QEXF 3G6EF 2CZWA 1W55A 4O4HB 4O2AA 3S03A 3SIVA 2DT4A 2PMPA 3E22A 1QVGF 3HKCA 3OONA 5JH7B 1XBIA 4WBNA 3CC4F 3RYCB 3MBMA 5LOVB 1DT9A 5KX5A 3VI6A 4PWTA 2UYNB 1FNJA 1E7KA 3TD5A 2YYEA 2IG8A 4FFBB 3WJPA 5A2QM 3S0YA 1M90H 3RYIA 2HRUA 5B8FA 5GONB 2WALA 1SA0B 4BY9D 4F6RA 4X3MA 3UT5A 4I4TA 3JARB 5GIOC 3V4DA 4ZOLA 2HX0A 3GYQA 2ZVYA 3N2KA 3TD3A 2Z1FA 5GANK 1K9MH 3QTYA 4EI7A 1H7MA 2RHHA 3JAWB 4NUTA 5J2UB 4IIJB 3JAKA 1T0AA 1KNJA 3CCQF 3P4EA 3HKEA 4X1KB 5JCOA 3CCMF 4ZI7B 2AIZP 4LCKA 1ODEA 3NK6A 4I50A 4X1IA 1TVKA 2RHJA 4G4VA 3CC2F 3M84A 3N2GB 3QUWA 4B62A 2NMUA 1FFXA 3CC7F 1SZQA 3HJWC 2LBXA 1R1MA 4EB6B 1UFYA 3BYQA 3RYHA 3TD4A 3FPIA 1Q8RA 4HNAA 4X20B 5EYPB 3S02A 4TZZA 2QTPA 3OBWA 2KTUA 2Z01A 1NJIH 2H8CA 3FD6A 2CVLA 1Z5VA 4U3JA 2UYPA 3WXMB 3CMAF 2VAPA 3ZP4A 1JD1A 3C9TA 3IEWA 5IJ0A 2VAMA 2Z1EA 2Z1UA 3NK7A 2IAFA 1ONIA 1YITF 3CPWF 3CCVF 3GHZA 3WGLA 1FNKA 3LWVC
chains in the Genus database with same CATH topology
2ZVZA 5EB0A 4ERHA 2MQEA 5EB1B 3S02A 2N48A 4PWTA 3TD5A 3S0WA 3S0YA 3S0HA 4G4XA 4R40B 4G88A 2K1SA 3TD4A 4G4ZA 3WPWA 2LCAA 3WPXA 2W8BC 3S06A 2LBTA 2AIZP 2HQSC 2KGWA 4ZHYB 4ZHWA 4ZHVA 1OAPA 2ZOVA 3CYQA 4G4VA 3IMPA 4G4WA 2L26A 4B62A 4B5CA 3KHNA 5EAZA 2ZF8A 2ZVYA 3S03A 1R1MA 4G4YA 4RHAA 3TD3A 3CYPB 3OONA 3LDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVZ A;  5EB0 A;  4ERH A;  2MQE A;  5EB1 B;  3S02 A;  2N48 A;  4PWT A;  3TD5 A;  3S0W A;  3S0Y A;  3S0H A;  4G4X A;  4R40 B;  4G88 A;  2K1S A;  3TD4 A;  4G4Z A;  3WPW A;  2LCA A;  3WPX A;  2W8B C;  3S06 A;  2LBT A;  2AIZ P;  2HQS C;  2KGW A;  4ZHY B;  4ZHW A;  4ZHV A;  1OAP A;  2ZOV A;  3CYQ A;  4G4V A;  3IMP A;  4G4W A;  2L26 A;  4B62 A;  4B5C A;  3KHN A;  5EAZ A;  2ZF8 A;  2ZVY A;  3S03 A;  1R1M A;  4G4Y A;  4RHA A;  3TD3 A;  3CYP B;  3OON A;  3LDT A; 
#chains in the Genus database with same CATH topology
 1GO0 A;  4BVS A;  3C9R A;  4TV9 A;  5GIN C;  3D01 A;  2H6L A;  2R6R 1;  3IKF A;  5EB1 B;  3F0E A;  5C8Y A;  3JAT B;  2RB9 A;  3VYS C;  3P0Z A;  4G4X A;  4R40 B;  3I7T A;  2AMT A;  4BVR A;  3WPX A;  3DC2 A;  4C4W C;  3J7A R;  1VQN F;  3HKD A;  1CK2 A;  1OAP A;  3JCM M;  5EIB D;  2GZL A;  1X7O A;  3E1Y A;  4FFB A;  2RHL A;  3ON1 A;  1XV2 A;  5HWE A;  2Q1Y A;  2OTL F;  5EZY B;  1RQ2 A;  5IT9 M;  1XHO A;  1K8A H;  1W42 A;  3CCL F;  5CA0 A;  2LCA A;  1W2B F;  2HVY D;  2AIF A;  4O4J A;  1H47 A;  3S06 A;  4ZHW A;  1YJN F;  3JAS B;  3VIU A;  1KC8 H;  2Q1X A;  2VGN A;  3HTN A;  2G9I A;  3VTI C;  5CB4 B;  4IIJ A;  4O4L B;  3IEQ A;  4G4Y A;  3AGK A;  3E20 B;  1VQK F;  1U3L A;  5J2T B;  2VXY A;  3NVI B;  3VMF B;  5LXT B;  5KMG B;  2I6R A;  1VQO F;  2BTU A;  2ZOD A;  3K2X A;  3HKB A;  1RLG A;  5LYJ A;  1YJ9 F;  3M4S A;  4BT2 A;  4C81 A;  4G4Z A;  5LA6 A;  1JFF B;  4B45 A;  3EOR A;  3CCS F;  2OZB A;  2HQS C;  3DDN A;  2LBW A;  2JNB A;  3VOB A;  5BMV A;  3F6M A;  3NVK E;  3IR9 A;  3P10 A;  1OFU A;  4C82 A;  3CCJ F;  3O85 A;  5CA1 B;  4X1Y B;  4YJ2 A;  5JQG B;  4O4I A;  3LWR C;  4O2B B;  5IJ9 B;  3JAL B;  3U0O A;  2QA4 F;  3ERN A;  3ZP7 A;  1VQL F;  1W5A A;  4RQO A;  1K73 H;  1S72 F;  5FNV B;  1U40 A;  1JN1 A;  3KJK A;  4EI8 A;  3RE3 A;  1Q82 H;  3HAX D;  5HXZ A;  3CME F;  5ITZ A;  5GIP C;  1TUB A;  5HY4 A;  2BTQ B;  4DXD A;  3RYF A;  4YJ3 B;  1W5B A;  2DYY A;  4B5C A;  3WJQ A;  3LME A;  3WGJ A;  2ZVZ A;  4I55 A;  3LWO C;  1M1K H;  2PHN A;  4O2A B;  5JVD A;  1KD1 H;  3D54 A;  3E22 B;  3HKC B;  2BO1 A;  3S0H A;  4WBN B;  1QAH A;  4BW0 B;  3WPW A;  3G71 F;  2HP3 A;  4KWE A;  4E6E A;  4ZHY B;  2FGY A;  1VQV A;  2BTO A;  1VQ5 F;  5EIB C;  4DRX A;  4XCQ A;  3LWP C;  2KG4 A;  3RYI B;  2L26 A;  3M1X A;  1W58 1;  3KHN A;  1DBF A;  3OBY A;  4BVT A;  1X52 A;  3ESJ A;  4F6R B;  2P6Y A;  4ZHQ B;  3C8L A;  1W5F A;  3L7Q A;  3UT5 B;  1GZ0 A;  4I4T B;  2OTJ F;  5HP8 A;  4ZOL B;  1IV1 A;  4TV8 A;  1NMU B;  2OTM A;  4IHJ A;  1Z5W A;  4LNU A;  2QI2 A;  2GVI A;  4O4H A;  5GAP K;  1IV2 A;  1KQS F;  3CCU F;  1Q86 H;  2Z1T A;  3JAK B;  5JH7 A;  5HP7 A;  3RA5 A;  2V9Y A;  3RYC A;  1GO1 A;  1YQN A;  3IMP A;  1RQ7 A;  5LOV A;  3HKE B;  4B46 A;  3G4S F;  2UYN A;  5FJ4 C;  3HWU A;  1XRG A;  3CB2 A;  1W59 A;  1Q7Y H;  5MN4 A;  4I50 B;  1H48 A;  5GON A;  2B33 A;  3IKE A;  4ZK7 A;  3D00 A;  1FFX B;  2CWJ A;  1SA0 A;  1IV3 A;  3VOA A;  3K14 A;  5IYZ B;  3K12 A;  1VQ7 F;  1YIJ F;  1QU9 A;  3RYH B;  3RA6 A;  3JAR A;  4HNA B;  3LYB A;  1NQ3 A;  2KGW A;  3V7Q A;  3CCR F;  2H8E A;  3FBA A;  4U3J B;  1X7P A;  3WGK A;  2HS3 A;  3JAW A;  5J2U A;  4C8I A;  5FNV A;  4TUY B;  5IJ0 B;  2UZH A;  4BT6 A;  4X1K A;  1QD9 A;  3CCE F;  4BT4 A;  3CPQ A;  1VH8 A;  2HP0 B;  4ZI7 A;  5MN5 A;  1ZWZ A;  3PAF A;  1YHQ F;  2OHW A;  1JY8 A;  3N2G A;  3Q8H A;  4TV9 B;  1VK3 A;  2I6D A;  1IPA A;  1VQ8 F;  3K0T A;  4EB6 A;  5C8Y B;  1YGY A;  1PXW A;  1VHA A;  3V7E A;  3ZO8 A;  2CW4 A;  1FSZ A;  4C8E A;  1VQM F;  3WJR A;  5EAZ A;  4X20 A;  5EYP A;  3C9U A;  4RHA A;  1U43 A;  5EO3 A;  4X3L A;  3JVH A;  3LDT A;  2ALE A;  3HKD B;  2F9Z C;  5EB0 A;  1IV4 A;  4ERH A;  5HY2 A;  5DCV A;  4NWO B;  5LP6 C;  3CD6 F;  2IQQ A;  3WGM A;  4M8I A;  3GTZ A;  3B6N A;  4G88 A;  2VGM A;  3LFO A;  1W40 A;  4ZHQ A;  2EWC A;  2R75 1;  4U39 A;  5LP6 B;  1N8R H;  5CA0 B;  1VQ6 F;  4NQ3 A;  2HS4 A;  4O4J B;  3JAT A;  1YJW F;  3QHD A;  2HS0 A;  4C8G A;  3OW2 F;  1W3E X;  4EI9 A;  4BVQ A;  2N48 A;  1W41 A;  2GLZ A;  2FC3 A;  3C9S A;  3R0P A;  1W5E A;  5KX5 B;  2LBT A;  3I55 F;  3CXC F;  3T80 A;  3HKB B;  3N4Y A;  5LYJ B;  1Q81 H;  2VAW A;  3I56 F;  1GX1 A;  3J81 M;  1VQ4 F;  5LA6 B;  5EZY A;  5IYZ A;  3CG6 A;  3PLA C;  3MQW A;  5G4V C;  2KTV A;  1W57 A;  5HY1 A;  5BMV B;  1J7H A;  1PF5 A;  3ELC A;  3JAS A;  4YJ2 B;  3N2K B;  5JCO C;  1COM A;  4O4I B;  5CB4 A;  3I3F A;  3VO8 A;  3LWQ C;  4O4L A;  3J80 M;  2RHO A;  1JJ2 F;  3VYU C;  4TUY A;  1KNK A;  3N4Z A;  3KIZ A;  3MCQ A;  4ZHV A;  2CHT A;  3VYT C;  3CYQ A;  2CSL A;  5J2T A;  1T0K B;  5LXT A;  1RLU A;  2HP0 A;  4BT3 A;  5KMG A;  2ZF8 A;  5ITZ B;  2CHS A;  1TUB B;  3F0G A;  3KE1 A;  1U3P A;  5HY0 A;  3RYF B;  4X1I B;  1TVK B;  1JFF A;  2MQE A;  1CLI A;  1VQP F;  1CN7 A;  3S0W A;  5AVM A;  1YI2 F;  4I55 B;  3WGN A;  1QVF F;  2YXZ A;  5CA1 A;  5JVD B;  4X1Y A;  3KJJ A;  3JAM M;  4BT5 A;  2ZAU A;  5JQG A;  2ZOV A;  1X25 A;  1UI9 A;  4O2B A;  5IJ9 A;  3JAL A;  4G4W A;  3FD5 A;  1VQ9 F;  3CYP B;  2W8B C;  4DRX B;  5FLX M;  4BT7 A;  3F0D A;  1RA4 A;  3ZOP A;  2HRY A;  3FFM A;  5LP6 A;  5G4U C;  4YJ3 A;  3F0F A;  2K1S A;  2UYK A;  5EWR A;  3MCA B;  5MN6 A;  3NMU C;  3SIU A;  2UYJ A;  3VCZ A;  3V3T A;  4TV8 B;  3MDO A;  5HXU A;  1SDS A;  4IHJ B;  4LNU B;  2QEX F;  3G6E F;  2CZW A;  1W55 A;  4O4H B;  4O2A A;  3S03 A;  3SIV A;  2DT4 A;  2PMP A;  3E22 A;  1QVG F;  3HKC A;  3OON A;  5JH7 B;  1XBI A;  4WBN A;  3CC4 F;  3RYC B;  3MBM A;  5LOV B;  1DT9 A;  5KX5 A;  3VI6 A;  4PWT A;  2UYN B;  1FNJ A;  1E7K A;  3TD5 A;  2YYE A;  2IG8 A;  4FFB B;  3WJP A;  5A2Q M;  3S0Y A;  1M90 H;  3RYI A;  2HRU A;  5B8F A;  5GON B;  2WAL A;  1SA0 B;  4BY9 D;  4F6R A;  4X3M A;  3UT5 A;  4I4T A;  3JAR B;  5GIO C;  3V4D A;  4ZOL A;  2HX0 A;  3GYQ A;  2ZVY A;  3N2K A;  3TD3 A;  2Z1F A;  5GAN K;  1K9M H;  3QTY A;  4EI7 A;  1H7M A;  2RHH A;  3JAW B;  4NUT A;  5J2U B;  4IIJ B;  3JAK A;  1T0A A;  1KNJ A;  3CCQ F;  3P4E A;  3HKE A;  4X1K B;  5JCO A;  3CCM F;  4ZI7 B;  2AIZ P;  4LCK A;  1ODE A;  3NK6 A;  4I50 A;  4X1I A;  1TVK A;  2RHJ A;  4G4V A;  3CC2 F;  3M84 A;  3N2G B;  3QUW A;  4B62 A;  2NMU A;  1FFX A;  3CC7 F;  1SZQ A;  3HJW C;  2LBX A;  1R1M A;  4EB6 B;  1UFY A;  3BYQ A;  3RYH A;  3TD4 A;  3FPI A;  1Q8R A;  4HNA A;  4X20 B;  5EYP B;  3S02 A;  4TZZ A;  2QTP A;  3OBW A;  2KTU A;  2Z01 A;  1NJI H;  2H8C A;  3FD6 A;  2CVL A;  1Z5V A;  4U3J A;  2UYP A;  3WXM B;  3CMA F;  2VAP A;  3ZP4 A;  1JD1 A;  3C9T A;  3IEW A;  5IJ0 A;  2VAM A;  2Z1E A;  2Z1U A;  3NK7 A;  2IAF A;  1ONI A;  1YIT F;  3CPW F;  3CCV F;  3GHZ A;  3WGL A;  1FNK A;  3LWV C; 
#chains in the Genus database with same CATH homology
 2ZVZ A;  5EB0 A;  4ERH A;  2MQE A;  5EB1 B;  3S02 A;  2N48 A;  4PWT A;  3TD5 A;  3S0W A;  3S0Y A;  3S0H A;  4G4X A;  4R40 B;  4G88 A;  2K1S A;  3TD4 A;  4G4Z A;  3WPW A;  2LCA A;  3WPX A;  2W8B C;  3S06 A;  2LBT A;  2AIZ P;  2HQS C;  2KGW A;  4ZHY B;  4ZHW A;  4ZHV A;  1OAP A;  2ZOV A;  3CYQ A;  4G4V A;  3IMP A;  4G4W A;  2L26 A;  4B62 A;  4B5C A;  3KHN A;  5EAZ A;  2ZF8 A;  2ZVY A;  3S03 A;  1R1M A;  4G4Y A;  4RHA A;  3TD3 A;  3CYP B;  3OON A;  3LDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...