4R40B

Crystal structure of tolb/pal complex from yersinia pestis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
SNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TolB
publication title Crystal Structure of TolB/Pal complex from Yersinia pestis.
rcsb
source organism Yersinia pestis co92
molecule tags Protein transport
total genus 31
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4r40B01
3OONA 3S0HA 3TD3A 5EAZA 2ZVYA 2KGWA 4G4XA 4PWTA 3CYQA 3WPWA 2W8BC 2ZOVA 3TD5A 3CYPB 3KHNA 2ZF8A 4ERHA 3S0YA 2MQEA 4G4VA 3IMPA 1OAPA 2HQSC 2LCAA 4G4ZA 2K1SA 5EB1B 2LBTA 3S06A 3WPXA 4B5CA 5EB0A 4ZHYB 3S03A 2L26A 1R1MA 4R40B 4B62A 3LDTA 3S0WA 3S02A 2ZVZA 2AIZP 4G4WA 4RHAA 4ZHVA 4ZHWA 4G88A 2N48A 3TD4A 4G4YA
chains in the Genus database with same CATH superfamily
3CCLF 3NK6A 4PWTA 5J2UB 3V3TA 1IV1A 4U3JA 5LXTB 4ERHA 3KJJA 1YGYA 3V4DA 3JAWB 4X20A 1H48A 3IKEA 3P10A 3C9TA 4ZOLA 1TUBB 3OBYA 4X1KA 1SDSA 2UYJA 1KQSF 2L26A 3SIUA 4RQOA 3OBWA 2HS0A 3EORA 3WGKA 5JH7A 3CMAF 3RYHB 3RYFB 2BTQB 1PXWA 2GVIA 2LBXA 4C82A 5IJ9B 1J7HA 2OZBA 3PAFA 3OONA 3N4ZA 1YJWF 3WXMB 1VQKF 4X3LA 2FC3A 5IT9M 2Q1YA 3CYQA 4NUTA 3HJWC 4ZI7B 3CC4F 1YITF 3K12A 4F6RB 5CB4A 2RHLA 1W5AA 3RYIA 1KNJA 4LNUA 3T80A 4ZK7A 5HY1A 3S03A 3J7AR 4R40B 3JASB 3WJQA 3HKDB 5GONB 3RYCB 4B45A 4I4TB 3N2KA 3WGMA 1U3PA 2BO1A 3TD3A 4EB6A 1CN7A 1K73H 2RHOA 4BVQA 4G4XA 3G4SF 4YJ3B 3F0FA 1XHOA 3DC2A 3HKEB 5G4UC 2MQEA 3FD6A 4IHJB 1KD1H 1W40A 5EO3A 2GLZA 4BW0B 4B5CA 1QD9A 3U0OA 5EB0A 1SZQA 3LDTA 4O4LA 2AIFA 5JCOC 4I50A 1XRGA 3D00A 5CA0A 3FPIA 2BTUA 1IV4A 1QU9A 3LWVC 1RQ7A 5CA1B 1X52A 4FFBB 1QVGF 3CCQF 3CD6F 1JY8A 4KWEA 5GIOC 2YXZA 4YJ2A 3VI6A 2RHHA 4WBNA 5BMVA 4O4IB 3DDNA 1JD1A 5IYZB 4ZHQA 3CCVF 1R1MA 5HXUA 2KG4A 3C9RA 3FFMA 3E22A 4O4JB 5ITZB 5FJ4C 1FSZA 5C8YA 1H47A 4G4YA 3S0HA 2HX0A 1W57A 2ZVYA 2UYPA 3ELCA 1T0AA 3RA6A 4C8EA 3OW2F 2GZLA 5JQGA 5IJ0B 3NK7A 3FD5A 2Z1UA 3CCRF 3P4EA 2CWJA 4BT7A 5MN5A 4ZHYB 3HKBB 5JVDA 3HWUA 2LBTA 5GIPC 3G6EF 3VTIC 2CW4A 5J2TB 3N2GB 5KX5A 4LCKA 1Q8RA 3JAKB 1QVFF 5LYJA 1VQPF 3HAXD 3TD4A 1U43A 2BTOA 1YJNF 1VQ9F 1ZWZA 2YYEA 1FFXB 1GO1A 3ZOPA 5GAPK 1JFFA 2OHWA 4C4WC 1VQ6F 5EZYB 3IMPA 2LCAA 5EB1B 5KMGA 3CC2F 1UFYA 3GHZA 2LBWA 1KC8H 1XV2A 3IEWA 3I56F 2UZHA 4TV9A 3S0WA 4I55B 4TUYA 3ZP4A 2KTUA 1X25A 3LWOC 3JATA 1RA4A 4RHAA 1YJ9F 1W55A 3N4YA 2N48A 4BT5A 1GX1A 2UYNB 4TV8B 3CPQA 4X1IB 1IV2A 5LP6A 2HP0A 3D01A 3WPWA 5MN4A 5LA6A 2DYYA 1QAHA 4C8IA 4X1YB 3I55F 1IV3A 2HS4A 2IAFA 4IIJA 4BVRA 2JNBA 4O2BA 3JALA 1X7OA 5HWEA 2CZWA 1Z5WA 1JJ2F 5B8FA 3CXCF 3C9UA 5EYPB 3O85A 3S02A 5FLXM 1T0KB 5LOVB 3E20B 3QTYA 3RA5A 3BYQA 3LYBA 1FNKA 1SA0A 1TVKA 3C8LA 5FNVA 4HNAA 2HVYD 1ODEA 2HRUA 2KGWA 1YIJF 3K2XA 4BT2A 3TD5A 2ZF8A 4BT4A 4O2AA 5EIBD 4TZZA 4O4HB 1Q81H 2R6R1 2HRYA 3GTZA 2QA4F 1Q86H 1VHAA 3HKCB 5DCVA 4DRXB 3ESJA 1VQ4F 5HP7A 2F9ZC 3VOAA 2QEXF 3CCJF 2IQQA 2WALA 3JARB 2QTPA 3MDOA 5J2UA 4BY9D 2V9YA 5LXTA 1VQNF 2Z1FA 2Q1XA 3JAWA 5EIBC 1VK3A 1W3EX 3UT5B 2Z01A 1TUBA 1RQ2A 1GO0A 1W42A 3L7QA 3VYTC 1X7PA 3RYFA 3RYHA 2VGMA 3CC7F 5G4VC 3VCZA 3VYSC 3F0GA 3S06A 4BVSA 5IJ9A 3WPXA 1VQ7F 3F0EA 1KNKA 1N8RH 4U3JB 1VQVA 5HY2A 2RB9A 4EI9A 3WJRA 1UI9A 4X20B 3JAMM 3KE1A 4ZI7A 1YHQF 4G88A 1U40A 4ZOLB 2H8EA 1CK2A 3K14A 1JN1A 4X1KB 3CCUF 4F6RA 1W5EA 2RHJA 3P0ZA 5JH7B 3MCAB 1W581 3JASA 3J80M 3KHNA 3HKDA 5GONA 2CVLA 2IG8A 3RYCA 2G9IA 1Z5VA 3FBAA 3QHDA 4I4TA 2DT4A 3CCEF 4G4ZA 2K1SA 3WJPA 3LMEA 3M4SA 4NQ3A 3NVKE 3MBMA 2UYKA 3I7TA 5LP6C 3MCQA 4YJ3A 5CB4B 4ZHWA 3F6MA 3RYIB 4LNUB 3HKEA 1ONIA 4IHJA 5EAZA 3CCMF 5JCOA 5MN6A 3NVIB 2P6YA 3QUWA 1RLUA 3N2KB 3RE3A 3KJKA 1E7KA 2B33A 1FNJA 1OAPA 2HQSC 2PHNA 2VXYA 4EB6B 1VQOF 4BT3A 5HXZA 3CG6A 3VOBA 2ZAUA 5CA1A 4FFBA 4B62A 4BVTA 5A2QM 1YI2F 3C9SA 2CHSA 3LWPC 3ZP7A 4O4IA 5EWRA 5GINC 3I3FA 1GZ0A 2ZODA 1NJIH 4NWOB 3LWRC 5IYZA 4O4LB 3PLAC 4I50B 1NMUB 3CB2A 2W8BC 2Z1TA 2OTLF 5CA0B 1W41A 4BT6A 4O4JA 5ITZA 1W5FA 1YQNA 3K0TA 3IKFA 3D54A 3R0PA 4U39A 2H8CA 1VQLF 3B6NA 3V7EA 4YJ2B 2ZVZA 4WBNB 5BMVB 5IJ0A 2Z1EA 2I6DA 1DBFA 4ZHQB 3HKBA 1W59A 3CCSF 1M90H 1CLIA 5HY4A 3E22B 3N2GA 3F0DA 1VH8A 4B46A 5J2TA 3G71F 2ZOVA 5GANK 1K9MH 5C8YB 3IR9A 3JAKA 1H7MA 2HS3A 5JQGB 3AGKA 4E6EA 1VQMF 3WGLA 1FFXA 3CPWF 2H6LA 2FGYA 1DT9A 2CHTA 5JVDB 3HTNA 1W5BA 1U3LA 5EZYA 3WGNA 5KX5B 3WGJA 5LYJB 2OTMA 4I55A 3J81M 2NMUA 4EI8A 3Q8HA 4G4VA 3KIZA 5HY0A 2UYNA 3CMEF 4TV8A 3VMFB 1Q82H 4X1IA 2R751 2VAWA 2OTJF 3ZO8A 1JFFB 4G4WA 1S72F 4C8GA 4X1YA 5KMGB 1COMA 2ALEA 3GYQA 2QI2A 4TV9B 4TUYB 3NMUC 1OFUA 3E1YA 2VGNA 3JATB 3VIUA 3IEQA 4XCQA 5EYPA 4X3MA 5LOVA 1PF5A 5LP6B 2HP0B 2CSLA 2VAPA 5LA6B 2AMTA 4IIJB 3ON1A 5AVMA 2HP3A 3MQWA 4O2BB 3JALB 4C81A 3JVHA 4O4HA 3JCMM 4DXDA 1IPAA 1M1KH 3HKCA 1K8AH 4DRXA 3VYUC 3LWQC 3CYPB 2VAMA 3JARA 3S0YA 3SIVA 3V7QA 1Q7YH 4EI7A 5HP8A 1SA0B 1TVKB 5FNVB 4HNAB 1VQ8F 1W2BF 2PMPA 2KTVA 3M1XA 2EWCA 2I6RA 4M8IA 3VO8A 3UT5A 4O2AB 1XBIA 1VQ5F 1NQ3A 3LFOA 2AIZP 1RLGA 4ZHVA 3M84A 3ERNA
chains in the Genus database with same CATH topology
3OONA 3S0HA 3TD3A 5EAZA 2ZVYA 2KGWA 4G4XA 4PWTA 3CYQA 3WPWA 2W8BC 2ZOVA 3TD5A 3CYPB 3KHNA 2ZF8A 4ERHA 3S0YA 2MQEA 4G4VA 3IMPA 1OAPA 2HQSC 2LCAA 4G4ZA 2K1SA 5EB1B 2LBTA 3S06A 3WPXA 4B5CA 5EB0A 4ZHYB 3S03A 2L26A 1R1MA 4R40B 4B62A 3LDTA 3S0WA 3S02A 2ZVZA 2AIZP 4G4WA 4RHAA 4ZHVA 4ZHWA 4G88A 2N48A 3TD4A 4G4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OON A;  3S0H A;  3TD3 A;  5EAZ A;  2ZVY A;  2KGW A;  4G4X A;  4PWT A;  3CYQ A;  3WPW A;  2W8B C;  2ZOV A;  3TD5 A;  3CYP B;  3KHN A;  2ZF8 A;  4ERH A;  3S0Y A;  2MQE A;  4G4V A;  3IMP A;  1OAP A;  2HQS C;  2LCA A;  4G4Z A;  2K1S A;  5EB1 B;  2LBT A;  3S06 A;  3WPX A;  4B5C A;  5EB0 A;  4ZHY B;  3S03 A;  2L26 A;  1R1M A;  4R40 B;  4B62 A;  3LDT A;  3S0W A;  3S02 A;  2ZVZ A;  2AIZ P;  4G4W A;  4RHA A;  4ZHV A;  4ZHW A;  4G88 A;  2N48 A;  3TD4 A;  4G4Y A; 
#chains in the Genus database with same CATH topology
 3CCL F;  3NK6 A;  4PWT A;  5J2U B;  3V3T A;  1IV1 A;  4U3J A;  5LXT B;  4ERH A;  3KJJ A;  1YGY A;  3V4D A;  3JAW B;  4X20 A;  1H48 A;  3IKE A;  3P10 A;  3C9T A;  4ZOL A;  1TUB B;  3OBY A;  4X1K A;  1SDS A;  2UYJ A;  1KQS F;  2L26 A;  3SIU A;  4RQO A;  3OBW A;  2HS0 A;  3EOR A;  3WGK A;  5JH7 A;  3CMA F;  3RYH B;  3RYF B;  2BTQ B;  1PXW A;  2GVI A;  2LBX A;  4C82 A;  5IJ9 B;  1J7H A;  2OZB A;  3PAF A;  3OON A;  3N4Z A;  1YJW F;  3WXM B;  1VQK F;  4X3L A;  2FC3 A;  5IT9 M;  2Q1Y A;  3CYQ A;  4NUT A;  3HJW C;  4ZI7 B;  3CC4 F;  1YIT F;  3K12 A;  4F6R B;  5CB4 A;  2RHL A;  1W5A A;  3RYI A;  1KNJ A;  4LNU A;  3T80 A;  4ZK7 A;  5HY1 A;  3S03 A;  3J7A R;  4R40 B;  3JAS B;  3WJQ A;  3HKD B;  5GON B;  3RYC B;  4B45 A;  4I4T B;  3N2K A;  3WGM A;  1U3P A;  2BO1 A;  3TD3 A;  4EB6 A;  1CN7 A;  1K73 H;  2RHO A;  4BVQ A;  4G4X A;  3G4S F;  4YJ3 B;  3F0F A;  1XHO A;  3DC2 A;  3HKE B;  5G4U C;  2MQE A;  3FD6 A;  4IHJ B;  1KD1 H;  1W40 A;  5EO3 A;  2GLZ A;  4BW0 B;  4B5C A;  1QD9 A;  3U0O A;  5EB0 A;  1SZQ A;  3LDT A;  4O4L A;  2AIF A;  5JCO C;  4I50 A;  1XRG A;  3D00 A;  5CA0 A;  3FPI A;  2BTU A;  1IV4 A;  1QU9 A;  3LWV C;  1RQ7 A;  5CA1 B;  1X52 A;  4FFB B;  1QVG F;  3CCQ F;  3CD6 F;  1JY8 A;  4KWE A;  5GIO C;  2YXZ A;  4YJ2 A;  3VI6 A;  2RHH A;  4WBN A;  5BMV A;  4O4I B;  3DDN A;  1JD1 A;  5IYZ B;  4ZHQ A;  3CCV F;  1R1M A;  5HXU A;  2KG4 A;  3C9R A;  3FFM A;  3E22 A;  4O4J B;  5ITZ B;  5FJ4 C;  1FSZ A;  5C8Y A;  1H47 A;  4G4Y A;  3S0H A;  2HX0 A;  1W57 A;  2ZVY A;  2UYP A;  3ELC A;  1T0A A;  3RA6 A;  4C8E A;  3OW2 F;  2GZL A;  5JQG A;  5IJ0 B;  3NK7 A;  3FD5 A;  2Z1U A;  3CCR F;  3P4E A;  2CWJ A;  4BT7 A;  5MN5 A;  4ZHY B;  3HKB B;  5JVD A;  3HWU A;  2LBT A;  5GIP C;  3G6E F;  3VTI C;  2CW4 A;  5J2T B;  3N2G B;  5KX5 A;  4LCK A;  1Q8R A;  3JAK B;  1QVF F;  5LYJ A;  1VQP F;  3HAX D;  3TD4 A;  1U43 A;  2BTO A;  1YJN F;  1VQ9 F;  1ZWZ A;  2YYE A;  1FFX B;  1GO1 A;  3ZOP A;  5GAP K;  1JFF A;  2OHW A;  4C4W C;  1VQ6 F;  5EZY B;  3IMP A;  2LCA A;  5EB1 B;  5KMG A;  3CC2 F;  1UFY A;  3GHZ A;  2LBW A;  1KC8 H;  1XV2 A;  3IEW A;  3I56 F;  2UZH A;  4TV9 A;  3S0W A;  4I55 B;  4TUY A;  3ZP4 A;  2KTU A;  1X25 A;  3LWO C;  3JAT A;  1RA4 A;  4RHA A;  1YJ9 F;  1W55 A;  3N4Y A;  2N48 A;  4BT5 A;  1GX1 A;  2UYN B;  4TV8 B;  3CPQ A;  4X1I B;  1IV2 A;  5LP6 A;  2HP0 A;  3D01 A;  3WPW A;  5MN4 A;  5LA6 A;  2DYY A;  1QAH A;  4C8I A;  4X1Y B;  3I55 F;  1IV3 A;  2HS4 A;  2IAF A;  4IIJ A;  4BVR A;  2JNB A;  4O2B A;  3JAL A;  1X7O A;  5HWE A;  2CZW A;  1Z5W A;  1JJ2 F;  5B8F A;  3CXC F;  3C9U A;  5EYP B;  3O85 A;  3S02 A;  5FLX M;  1T0K B;  5LOV B;  3E20 B;  3QTY A;  3RA5 A;  3BYQ A;  3LYB A;  1FNK A;  1SA0 A;  1TVK A;  3C8L A;  5FNV A;  4HNA A;  2HVY D;  1ODE A;  2HRU A;  2KGW A;  1YIJ F;  3K2X A;  4BT2 A;  3TD5 A;  2ZF8 A;  4BT4 A;  4O2A A;  5EIB D;  4TZZ A;  4O4H B;  1Q81 H;  2R6R 1;  2HRY A;  3GTZ A;  2QA4 F;  1Q86 H;  1VHA A;  3HKC B;  5DCV A;  4DRX B;  3ESJ A;  1VQ4 F;  5HP7 A;  2F9Z C;  3VOA A;  2QEX F;  3CCJ F;  2IQQ A;  2WAL A;  3JAR B;  2QTP A;  3MDO A;  5J2U A;  4BY9 D;  2V9Y A;  5LXT A;  1VQN F;  2Z1F A;  2Q1X A;  3JAW A;  5EIB C;  1VK3 A;  1W3E X;  3UT5 B;  2Z01 A;  1TUB A;  1RQ2 A;  1GO0 A;  1W42 A;  3L7Q A;  3VYT C;  1X7P A;  3RYF A;  3RYH A;  2VGM A;  3CC7 F;  5G4V C;  3VCZ A;  3VYS C;  3F0G A;  3S06 A;  4BVS A;  5IJ9 A;  3WPX A;  1VQ7 F;  3F0E A;  1KNK A;  1N8R H;  4U3J B;  1VQV A;  5HY2 A;  2RB9 A;  4EI9 A;  3WJR A;  1UI9 A;  4X20 B;  3JAM M;  3KE1 A;  4ZI7 A;  1YHQ F;  4G88 A;  1U40 A;  4ZOL B;  2H8E A;  1CK2 A;  3K14 A;  1JN1 A;  4X1K B;  3CCU F;  4F6R A;  1W5E A;  2RHJ A;  3P0Z A;  5JH7 B;  3MCA B;  1W58 1;  3JAS A;  3J80 M;  3KHN A;  3HKD A;  5GON A;  2CVL A;  2IG8 A;  3RYC A;  2G9I A;  1Z5V A;  3FBA A;  3QHD A;  4I4T A;  2DT4 A;  3CCE F;  4G4Z A;  2K1S A;  3WJP A;  3LME A;  3M4S A;  4NQ3 A;  3NVK E;  3MBM A;  2UYK A;  3I7T A;  5LP6 C;  3MCQ A;  4YJ3 A;  5CB4 B;  4ZHW A;  3F6M A;  3RYI B;  4LNU B;  3HKE A;  1ONI A;  4IHJ A;  5EAZ A;  3CCM F;  5JCO A;  5MN6 A;  3NVI B;  2P6Y A;  3QUW A;  1RLU A;  3N2K B;  3RE3 A;  3KJK A;  1E7K A;  2B33 A;  1FNJ A;  1OAP A;  2HQS C;  2PHN A;  2VXY A;  4EB6 B;  1VQO F;  4BT3 A;  5HXZ A;  3CG6 A;  3VOB A;  2ZAU A;  5CA1 A;  4FFB A;  4B62 A;  4BVT A;  5A2Q M;  1YI2 F;  3C9S A;  2CHS A;  3LWP C;  3ZP7 A;  4O4I A;  5EWR A;  5GIN C;  3I3F A;  1GZ0 A;  2ZOD A;  1NJI H;  4NWO B;  3LWR C;  5IYZ A;  4O4L B;  3PLA C;  4I50 B;  1NMU B;  3CB2 A;  2W8B C;  2Z1T A;  2OTL F;  5CA0 B;  1W41 A;  4BT6 A;  4O4J A;  5ITZ A;  1W5F A;  1YQN A;  3K0T A;  3IKF A;  3D54 A;  3R0P A;  4U39 A;  2H8C A;  1VQL F;  3B6N A;  3V7E A;  4YJ2 B;  2ZVZ A;  4WBN B;  5BMV B;  5IJ0 A;  2Z1E A;  2I6D A;  1DBF A;  4ZHQ B;  3HKB A;  1W59 A;  3CCS F;  1M90 H;  1CLI A;  5HY4 A;  3E22 B;  3N2G A;  3F0D A;  1VH8 A;  4B46 A;  5J2T A;  3G71 F;  2ZOV A;  5GAN K;  1K9M H;  5C8Y B;  3IR9 A;  3JAK A;  1H7M A;  2HS3 A;  5JQG B;  3AGK A;  4E6E A;  1VQM F;  3WGL A;  1FFX A;  3CPW F;  2H6L A;  2FGY A;  1DT9 A;  2CHT A;  5JVD B;  3HTN A;  1W5B A;  1U3L A;  5EZY A;  3WGN A;  5KX5 B;  3WGJ A;  5LYJ B;  2OTM A;  4I55 A;  3J81 M;  2NMU A;  4EI8 A;  3Q8H A;  4G4V A;  3KIZ A;  5HY0 A;  2UYN A;  3CME F;  4TV8 A;  3VMF B;  1Q82 H;  4X1I A;  2R75 1;  2VAW A;  2OTJ F;  3ZO8 A;  1JFF B;  4G4W A;  1S72 F;  4C8G A;  4X1Y A;  5KMG B;  1COM A;  2ALE A;  3GYQ A;  2QI2 A;  4TV9 B;  4TUY B;  3NMU C;  1OFU A;  3E1Y A;  2VGN A;  3JAT B;  3VIU A;  3IEQ A;  4XCQ A;  5EYP A;  4X3M A;  5LOV A;  1PF5 A;  5LP6 B;  2HP0 B;  2CSL A;  2VAP A;  5LA6 B;  2AMT A;  4IIJ B;  3ON1 A;  5AVM A;  2HP3 A;  3MQW A;  4O2B B;  3JAL B;  4C81 A;  3JVH A;  4O4H A;  3JCM M;  4DXD A;  1IPA A;  1M1K H;  3HKC A;  1K8A H;  4DRX A;  3VYU C;  3LWQ C;  3CYP B;  2VAM A;  3JAR A;  3S0Y A;  3SIV A;  3V7Q A;  1Q7Y H;  4EI7 A;  5HP8 A;  1SA0 B;  1TVK B;  5FNV B;  4HNA B;  1VQ8 F;  1W2B F;  2PMP A;  2KTV A;  3M1X A;  2EWC A;  2I6R A;  4M8I A;  3VO8 A;  3UT5 A;  4O2A B;  1XBI A;  1VQ5 F;  1NQ3 A;  3LFO A;  2AIZ P;  1RLG A;  4ZHV A;  3M84 A;  3ERN A; 
#chains in the Genus database with same CATH homology
 3OON A;  3S0H A;  3TD3 A;  5EAZ A;  2ZVY A;  2KGW A;  4G4X A;  4PWT A;  3CYQ A;  3WPW A;  2W8B C;  2ZOV A;  3TD5 A;  3CYP B;  3KHN A;  2ZF8 A;  4ERH A;  3S0Y A;  2MQE A;  4G4V A;  3IMP A;  1OAP A;  2HQS C;  2LCA A;  4G4Z A;  2K1S A;  5EB1 B;  2LBT A;  3S06 A;  3WPX A;  4B5C A;  5EB0 A;  4ZHY B;  3S03 A;  2L26 A;  1R1M A;  4R40 B;  4B62 A;  3LDT A;  3S0W A;  3S02 A;  2ZVZ A;  2AIZ P;  4G4W A;  4RHA A;  4ZHV A;  4ZHW A;  4G88 A;  2N48 A;  3TD4 A;  4G4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...