4C8GA

Ispf (burkholderia cenocepacia) cmp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
153
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
total genus 51
structure length 153
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8gA00
1W57A 1GX1A 3FBAA 1IV2A 3JVHA 1KNKA 3IKEA 2AMTA 3ELCA 3KE1A 4C8IA 5B8FA 1IV4A 3F0EA 3ESJA 3IEWA 3Q8HA 3T80A 3GHZA 1KNJA 3F0FA 3F6MA 1H48A 1U3PA 3ERNA 3FPIA 1JY8A 4C8EA 1VH8A 1IV3A 3IEQA 3RE3A 3K14A 2GZLA 3EORA 4C81A 1T0AA 4C82A 1H47A 3QHDA 4C8GA 1U43A 1U40A 2UZHA 1IV1A 3F0GA 3MBMA 3B6NA 1YQNA 3P0ZA 3P10A 2PMPA 1U3LA 3K2XA 3IKFA 1JN1A 3F0DA 1VHAA 1W55A
chains in the Genus database with same CATH superfamily
2HP0B 3WGJA 3HKBA 4YJ2A 2DYYA 2ZF8A 3WJQA 1IV4A 3CPQA 1TVKB 5J2TA 3LMEA 3CC7F 4C81A 1SZQA 4BT7A 4IHJA 2Q1XA 4M8IA 2FC3A 1RLUA 2AIZP 2BTOA 2R6R1 2IG8A 2RHOA 5G4UC 3IKEA 2FGYA 3NMUC 4O4LA 5B8FA 4O2AA 1SA0A 5LP6A 4X3MA 3I55F 3HKEB 3CCRF 4BW0B 2KGWA 5HP8A 5IJ9B 2VAMA 4ZOLB 4B45A 5FLXM 2RHJA 2GLZA 2UYPA 5EB1B 3TD4A 3LWQC 5JQGB 4FFBA 3JALA 4C4WC 2DT4A 1YI2F 1YQNA 3U0OA 2LBWA 3J80M 3CCVF 1VQKF 3I3FA 3K2XA 5EYPB 1Z5VA 2RHLA 4U39A 1TUBB 1FFXA 3D01A 4I50B 5BMVB 5GONA 3BYQA 4BT4A 3F0EA 3T80A 4TV8A 2HP0A 3ERNA 2OHWA 5JH7B 2ZAUA 1JY8A 3CD6F 3QTYA 2B33A 1W40A 1VQVA 2GZLA 4ZI7B 1TVKA 3CG6A 1NMUB 1U40A 1U43A 2ALEA 1IV1A 5HWEA 3HJWC 3MBMA 3C9SA 2V9YA 5LXTB 5FNVB 2PHNA 3K0TA 1JN1A 2OTMA 2IAFA 3WXMB 2P6YA 5DCVA 2YXZA 3FFMA 2OTLF 1XV2A 4BT6A 1RA4A 3GHZA 3I7TA 1YJ9F 3N2KB 3JATA 4U3JB 4RHAA 3JCMM 1VQ5F 3V3TA 1W3EX 4BT5A 3UT5B 1E7KA 3HKEA 4E6EA 1W5AA 3CC4F 2GVIA 1JJ2F 1CK2A 5IJ9A 1RQ2A 3NVIB 1YGYA 4ZOLA 3M4SA 1UFYA 1W5EA 1QD9A 3CCMF 3D54A 3ZP4A 2I6RA 2H8CA 5JQGA 5EAZA 5HP7A 4I4TB 4XCQA 3G6EF 1KNKA 5CA0A 1COMA 3WGKA 2CVLA 3F6MA 3OBYA 4NQ3A 4ZHVA 3ZO8A 2UYKA 1TUBA 4I50A 1JD1A 4BY9D 3JAWB 5IT9M 1UI9A 2CHSA 4NUTA 4B46A 5HY1A 3MQWA 3E22B 5JH7A 1OFUA 3LWPC 5JVDB 1YJNF 1X25A 5KMGB 4ZI7A 1JFFA 1W57A 2N48A 3C9RA 1GX1A 1S72F 5C8YB 3LFOA 5LP6C 2ZVZA 1NJIH 3FD5A 3K12A 5LXTA 5FNVA 4BVQA 4X1YB 1W42A 2ZVYA 1RLGA 1J7HA 3Q8HA 4X20A 2QEXF 2VAWA 1W581 3VO8A 3CCJF 3HAXD 3IEQA 2QI2A 4BT3A 3VOAA 1CLIA 3J7AR 3WGLA 2Z1UA 3N2KA 4U3JA 3ZOPA 3WJPA 3RYCA 4ERHA 3G4SF 5IYZB 2CZWA 3F0DA 3UT5A 3OONA 3NVKE 3KJKA 2KTUA 3N4YA 4X1KB 2Z1TA 4O4IB 4TZZA 2CSLA 3HKDB 3M1XA 3G71F 4C8IA 5JCOC 1N8RH 1VQ4F 3IEWA 2RB9A 4LCKA 4LNUB 3JARB 4EB6B 5J2UB 4I4TA 3C9UA 1IV3A 5KX5B 2HVYD 4G4VA 3QHDA 4C8GA 1GZ0A 1RQ7A 4EI9A 1YIJF 3ZP7A 3IKFA 3CPWF 3E20B 4X1IB 1Q86H 3DDNA 3N2GB 3R0PA 3JAWA 4B62A 3VYSC 1ODEA 2HQSC 3E22A 4YJ3B 5EO3A 5JVDA 3S03A 3LWOC 4DRXB 5KMGA 2CW4A 3CCLF 1VQLF 2WALA 5C8YA 5JCOA 2ZOVA 1XRGA 4G4XA 3PAFA 3SIVA 4TV9B 4NWOB 2UYNB 3HTNA 2UZHA 3F0GA 2HS3A 1VQ7F 5CB4B 3B6NA 1XBIA 4BVTA 4PWTA 4TUYB 4F6RB 2K1SA 1X7OA 3V7QA 2EWCA 3CCUF 1KD1H 4DXDA 3GTZA 3VCZA 5HY2A 2KG4A 1FNKA 2AMTA 3D00A 3ELCA 2OZBA 5IYZA 3ESJA 3JAKB 2I6DA 3V4DA 1QU9A 2VXYA 4X1KA 4O4IA 3CCSF 3S0HA 1M1KH 5HY0A 3LDTA 3RA5A 5GIOC 1Z5WA 3KJJA 4EB6A 3JARA 4O4HB 1VQPF 3S0WA 2L26A 5KX5A 2H6LA 3RYIB 2Z1FA 5MN5A 1Q8RA 3OBWA 5HY4A 2HRUA 4HNAB 2LBTA 4B5CA 4IIJB 1T0KB 3TD3A 1CN7A 4X1IA 1X7PA 2BO1A 1U3PA 5EYPA 1Q7YH 2BTUA 1W59A 4YJ3A 1QAHA 1QVFF 4I55B 3RE3A 3CXCF 3RYHB 5BMVA 4DRXA 4G4WA 1T0AA 3E1YA 1KC8H 4O2BB 1FSZA 1YJWF 3SIUA 3CCQF 2YYEA 5GANK 4TV9A 1W41A 2UYNA 2MQEA 1IV2A 2UYJA 1VQ6F 5CB4A 1FNJA 2QA4F 3KE1A 3RYFB 4R40B 4G88A 2CWJA 1X52A 1XHOA 4EI7A 3JASB 1VQ9F 2LCAA 1DBFA 1R1MA 1W2BF 3EORA 3LYBA 3JAKA 1ONIA 1YHQF 5AVMA 3LWRC 3C9TA 3P0ZA 4TV8B 1PF5A 3S02A 4ZHQB 3FBAA 3JVHA 4EI8A 1PXWA 4O4HA 1ZWZA 3VMFB 3RYIA 3N4ZA 4BVRA 1H48A 5LYJB 5EWRA 5HXUA 4HNAA 1VH8A 3KIZA 3S0YA 4IIJA 3DC2A 3P4EA 2BTQB 4C82A 3CMAF 2LBXA 1K8AH 5G4VC 3VIUA 4I55A 3OW2F 4WBNB 3RYHA 3HKCB 1W55A 3I56F 3JATB 5LA6B 3VTIC 4O2BA 2VGNA 2VGMA 1Q81H 2F9ZC 3NK7A 2QTPA 4RQOA 2HS0A 1KQSF 1KNJA 3F0FA 1VQOF 3PLAC 3TD5A 2W8BC 3VYTC 5LOVB 1GO0A 2HRYA 3FPIA 1YITF 3RYFA 1W5FA 4X1YA 1K9MH 1K73H 4ZHYB 3LWVC 5CA0B 3C8LA 3VI6A 3JASA 3P10A 5CA1B 5HXZA 2H8EA 2HX0A 5EZYB 1VQNF 5GAPK 2G9IA 3IR9A 2Z01A 3WGMA 4BT2A 1IPAA 3CYPB 1SDSA 3FD6A 4KWEA 2HS4A 4ZHQA 2Z1EA 1VQ8F 1DT9A 4O4JB 1VK3A 5FJ4C 5A2QM 1NQ3A 3M84A 3CC2F 3CCEF 3CB2A 2RHHA 5EIBC 2NMUA 3VOBA 5IJ0B 3HKDA 5ITZB 2Q1YA 1JFFB 3WGNA 3ON1A 5LYJA 3HKBB 3KHNA 4YJ2B 2KTVA 4LNUA 4G4ZA 3WPWA 2HP3A 2PMPA 5J2UA 4X20B 2VAPA 1VHAA 2ZODA 3JAMM 5J2TB 2IQQA 3V7EA 5MN4A 3J81M 3AGKA 2AIFA 3NK6A 3VYUC 3MDOA 1Q82H 4WBNA 3HKCA 4IHJB 3CYQA 5LA6A 3N2GA 4ZHWA 3O85A 4C8EA 3RYCB 3QUWA 2R751 4ZK7A 5GIPC 1M90H 1H7MA 1H47A 3GYQA 5LOVA 2OTJF 5EB0A 5EIBD 4O4LB 1QVGF 4O2AB 1U3LA 1SA0B 3MCAB 5LP6B 3WPXA 1W5BA 3RA6A 3WJRA 5CA1A 5GINC 1VQMF 5EZYA 4X3LA 3HWUA 3MCQA 4FFBB 3JALB 2JNBA 4TUYA 4F6RA 5MN6A 2CHTA 1OAPA 3K14A 4BVSA 4G4YA 3L7QA 3IMPA 4O4JA 1GO1A 1FFXB 5GONB 5IJ0A 5ITZA 3S06A 3CMEF
chains in the Genus database with same CATH topology
1W57A 1GX1A 3FBAA 1IV2A 3JVHA 1KNKA 3IKEA 2AMTA 3ELCA 3KE1A 4C8IA 5B8FA 1IV4A 3F0EA 3ESJA 3IEWA 3Q8HA 3T80A 3GHZA 1KNJA 3F0FA 3F6MA 1H48A 1U3PA 3ERNA 3FPIA 1JY8A 4C8EA 1VH8A 1IV3A 3IEQA 3RE3A 3K14A 2GZLA 3EORA 4C81A 1T0AA 4C82A 1H47A 3QHDA 4C8GA 1U43A 1U40A 2UZHA 1IV1A 3F0GA 3MBMA 3B6NA 1YQNA 3P0ZA 3P10A 2PMPA 1U3LA 3K2XA 3IKFA 1JN1A 3F0DA 1VHAA 1W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W57 A;  1GX1 A;  3FBA A;  1IV2 A;  3JVH A;  1KNK A;  3IKE A;  2AMT A;  3ELC A;  3KE1 A;  4C8I A;  5B8F A;  1IV4 A;  3F0E A;  3ESJ A;  3IEW A;  3Q8H A;  3T80 A;  3GHZ A;  1KNJ A;  3F0F A;  3F6M A;  1H48 A;  1U3P A;  3ERN A;  3FPI A;  1JY8 A;  4C8E A;  1VH8 A;  1IV3 A;  3IEQ A;  3RE3 A;  3K14 A;  2GZL A;  3EOR A;  4C81 A;  1T0A A;  4C82 A;  1H47 A;  3QHD A;  4C8G A;  1U43 A;  1U40 A;  2UZH A;  1IV1 A;  3F0G A;  3MBM A;  3B6N A;  1YQN A;  3P0Z A;  3P10 A;  2PMP A;  1U3L A;  3K2X A;  3IKF A;  1JN1 A;  3F0D A;  1VHA A;  1W55 A; 
#chains in the Genus database with same CATH topology
 2HP0 B;  3WGJ A;  3HKB A;  4YJ2 A;  2DYY A;  2ZF8 A;  3WJQ A;  1IV4 A;  3CPQ A;  1TVK B;  5J2T A;  3LME A;  3CC7 F;  4C81 A;  1SZQ A;  4BT7 A;  4IHJ A;  2Q1X A;  4M8I A;  2FC3 A;  1RLU A;  2AIZ P;  2BTO A;  2R6R 1;  2IG8 A;  2RHO A;  5G4U C;  3IKE A;  2FGY A;  3NMU C;  4O4L A;  5B8F A;  4O2A A;  1SA0 A;  5LP6 A;  4X3M A;  3I55 F;  3HKE B;  3CCR F;  4BW0 B;  2KGW A;  5HP8 A;  5IJ9 B;  2VAM A;  4ZOL B;  4B45 A;  5FLX M;  2RHJ A;  2GLZ A;  2UYP A;  5EB1 B;  3TD4 A;  3LWQ C;  5JQG B;  4FFB A;  3JAL A;  4C4W C;  2DT4 A;  1YI2 F;  1YQN A;  3U0O A;  2LBW A;  3J80 M;  3CCV F;  1VQK F;  3I3F A;  3K2X A;  5EYP B;  1Z5V A;  2RHL A;  4U39 A;  1TUB B;  1FFX A;  3D01 A;  4I50 B;  5BMV B;  5GON A;  3BYQ A;  4BT4 A;  3F0E A;  3T80 A;  4TV8 A;  2HP0 A;  3ERN A;  2OHW A;  5JH7 B;  2ZAU A;  1JY8 A;  3CD6 F;  3QTY A;  2B33 A;  1W40 A;  1VQV A;  2GZL A;  4ZI7 B;  1TVK A;  3CG6 A;  1NMU B;  1U40 A;  1U43 A;  2ALE A;  1IV1 A;  5HWE A;  3HJW C;  3MBM A;  3C9S A;  2V9Y A;  5LXT B;  5FNV B;  2PHN A;  3K0T A;  1JN1 A;  2OTM A;  2IAF A;  3WXM B;  2P6Y A;  5DCV A;  2YXZ A;  3FFM A;  2OTL F;  1XV2 A;  4BT6 A;  1RA4 A;  3GHZ A;  3I7T A;  1YJ9 F;  3N2K B;  3JAT A;  4U3J B;  4RHA A;  3JCM M;  1VQ5 F;  3V3T A;  1W3E X;  4BT5 A;  3UT5 B;  1E7K A;  3HKE A;  4E6E A;  1W5A A;  3CC4 F;  2GVI A;  1JJ2 F;  1CK2 A;  5IJ9 A;  1RQ2 A;  3NVI B;  1YGY A;  4ZOL A;  3M4S A;  1UFY A;  1W5E A;  1QD9 A;  3CCM F;  3D54 A;  3ZP4 A;  2I6R A;  2H8C A;  5JQG A;  5EAZ A;  5HP7 A;  4I4T B;  4XCQ A;  3G6E F;  1KNK A;  5CA0 A;  1COM A;  3WGK A;  2CVL A;  3F6M A;  3OBY A;  4NQ3 A;  4ZHV A;  3ZO8 A;  2UYK A;  1TUB A;  4I50 A;  1JD1 A;  4BY9 D;  3JAW B;  5IT9 M;  1UI9 A;  2CHS A;  4NUT A;  4B46 A;  5HY1 A;  3MQW A;  3E22 B;  5JH7 A;  1OFU A;  3LWP C;  5JVD B;  1YJN F;  1X25 A;  5KMG B;  4ZI7 A;  1JFF A;  1W57 A;  2N48 A;  3C9R A;  1GX1 A;  1S72 F;  5C8Y B;  3LFO A;  5LP6 C;  2ZVZ A;  1NJI H;  3FD5 A;  3K12 A;  5LXT A;  5FNV A;  4BVQ A;  4X1Y B;  1W42 A;  2ZVY A;  1RLG A;  1J7H A;  3Q8H A;  4X20 A;  2QEX F;  2VAW A;  1W58 1;  3VO8 A;  3CCJ F;  3HAX D;  3IEQ A;  2QI2 A;  4BT3 A;  3VOA A;  1CLI A;  3J7A R;  3WGL A;  2Z1U A;  3N2K A;  4U3J A;  3ZOP A;  3WJP A;  3RYC A;  4ERH A;  3G4S F;  5IYZ B;  2CZW A;  3F0D A;  3UT5 A;  3OON A;  3NVK E;  3KJK A;  2KTU A;  3N4Y A;  4X1K B;  2Z1T A;  4O4I B;  4TZZ A;  2CSL A;  3HKD B;  3M1X A;  3G71 F;  4C8I A;  5JCO C;  1N8R H;  1VQ4 F;  3IEW A;  2RB9 A;  4LCK A;  4LNU B;  3JAR B;  4EB6 B;  5J2U B;  4I4T A;  3C9U A;  1IV3 A;  5KX5 B;  2HVY D;  4G4V A;  3QHD A;  4C8G A;  1GZ0 A;  1RQ7 A;  4EI9 A;  1YIJ F;  3ZP7 A;  3IKF A;  3CPW F;  3E20 B;  4X1I B;  1Q86 H;  3DDN A;  3N2G B;  3R0P A;  3JAW A;  4B62 A;  3VYS C;  1ODE A;  2HQS C;  3E22 A;  4YJ3 B;  5EO3 A;  5JVD A;  3S03 A;  3LWO C;  4DRX B;  5KMG A;  2CW4 A;  3CCL F;  1VQL F;  2WAL A;  5C8Y A;  5JCO A;  2ZOV A;  1XRG A;  4G4X A;  3PAF A;  3SIV A;  4TV9 B;  4NWO B;  2UYN B;  3HTN A;  2UZH A;  3F0G A;  2HS3 A;  1VQ7 F;  5CB4 B;  3B6N A;  1XBI A;  4BVT A;  4PWT A;  4TUY B;  4F6R B;  2K1S A;  1X7O A;  3V7Q A;  2EWC A;  3CCU F;  1KD1 H;  4DXD A;  3GTZ A;  3VCZ A;  5HY2 A;  2KG4 A;  1FNK A;  2AMT A;  3D00 A;  3ELC A;  2OZB A;  5IYZ A;  3ESJ A;  3JAK B;  2I6D A;  3V4D A;  1QU9 A;  2VXY A;  4X1K A;  4O4I A;  3CCS F;  3S0H A;  1M1K H;  5HY0 A;  3LDT A;  3RA5 A;  5GIO C;  1Z5W A;  3KJJ A;  4EB6 A;  3JAR A;  4O4H B;  1VQP F;  3S0W A;  2L26 A;  5KX5 A;  2H6L A;  3RYI B;  2Z1F A;  5MN5 A;  1Q8R A;  3OBW A;  5HY4 A;  2HRU A;  4HNA B;  2LBT A;  4B5C A;  4IIJ B;  1T0K B;  3TD3 A;  1CN7 A;  4X1I A;  1X7P A;  2BO1 A;  1U3P A;  5EYP A;  1Q7Y H;  2BTU A;  1W59 A;  4YJ3 A;  1QAH A;  1QVF F;  4I55 B;  3RE3 A;  3CXC F;  3RYH B;  5BMV A;  4DRX A;  4G4W A;  1T0A A;  3E1Y A;  1KC8 H;  4O2B B;  1FSZ A;  1YJW F;  3SIU A;  3CCQ F;  2YYE A;  5GAN K;  4TV9 A;  1W41 A;  2UYN A;  2MQE A;  1IV2 A;  2UYJ A;  1VQ6 F;  5CB4 A;  1FNJ A;  2QA4 F;  3KE1 A;  3RYF B;  4R40 B;  4G88 A;  2CWJ A;  1X52 A;  1XHO A;  4EI7 A;  3JAS B;  1VQ9 F;  2LCA A;  1DBF A;  1R1M A;  1W2B F;  3EOR A;  3LYB A;  3JAK A;  1ONI A;  1YHQ F;  5AVM A;  3LWR C;  3C9T A;  3P0Z A;  4TV8 B;  1PF5 A;  3S02 A;  4ZHQ B;  3FBA A;  3JVH A;  4EI8 A;  1PXW A;  4O4H A;  1ZWZ A;  3VMF B;  3RYI A;  3N4Z A;  4BVR A;  1H48 A;  5LYJ B;  5EWR A;  5HXU A;  4HNA A;  1VH8 A;  3KIZ A;  3S0Y A;  4IIJ A;  3DC2 A;  3P4E A;  2BTQ B;  4C82 A;  3CMA F;  2LBX A;  1K8A H;  5G4V C;  3VIU A;  4I55 A;  3OW2 F;  4WBN B;  3RYH A;  3HKC B;  1W55 A;  3I56 F;  3JAT B;  5LA6 B;  3VTI C;  4O2B A;  2VGN A;  2VGM A;  1Q81 H;  2F9Z C;  3NK7 A;  2QTP A;  4RQO A;  2HS0 A;  1KQS F;  1KNJ A;  3F0F A;  1VQO F;  3PLA C;  3TD5 A;  2W8B C;  3VYT C;  5LOV B;  1GO0 A;  2HRY A;  3FPI A;  1YIT F;  3RYF A;  1W5F A;  4X1Y A;  1K9M H;  1K73 H;  4ZHY B;  3LWV C;  5CA0 B;  3C8L A;  3VI6 A;  3JAS A;  3P10 A;  5CA1 B;  5HXZ A;  2H8E A;  2HX0 A;  5EZY B;  1VQN F;  5GAP K;  2G9I A;  3IR9 A;  2Z01 A;  3WGM A;  4BT2 A;  1IPA A;  3CYP B;  1SDS A;  3FD6 A;  4KWE A;  2HS4 A;  4ZHQ A;  2Z1E A;  1VQ8 F;  1DT9 A;  4O4J B;  1VK3 A;  5FJ4 C;  5A2Q M;  1NQ3 A;  3M84 A;  3CC2 F;  3CCE F;  3CB2 A;  2RHH A;  5EIB C;  2NMU A;  3VOB A;  5IJ0 B;  3HKD A;  5ITZ B;  2Q1Y A;  1JFF B;  3WGN A;  3ON1 A;  5LYJ A;  3HKB B;  3KHN A;  4YJ2 B;  2KTV A;  4LNU A;  4G4Z A;  3WPW A;  2HP3 A;  2PMP A;  5J2U A;  4X20 B;  2VAP A;  1VHA A;  2ZOD A;  3JAM M;  5J2T B;  2IQQ A;  3V7E A;  5MN4 A;  3J81 M;  3AGK A;  2AIF A;  3NK6 A;  3VYU C;  3MDO A;  1Q82 H;  4WBN A;  3HKC A;  4IHJ B;  3CYQ A;  5LA6 A;  3N2G A;  4ZHW A;  3O85 A;  4C8E A;  3RYC B;  3QUW A;  2R75 1;  4ZK7 A;  5GIP C;  1M90 H;  1H7M A;  1H47 A;  3GYQ A;  5LOV A;  2OTJ F;  5EB0 A;  5EIB D;  4O4L B;  1QVG F;  4O2A B;  1U3L A;  1SA0 B;  3MCA B;  5LP6 B;  3WPX A;  1W5B A;  3RA6 A;  3WJR A;  5CA1 A;  5GIN C;  1VQM F;  5EZY A;  4X3L A;  3HWU A;  3MCQ A;  4FFB B;  3JAL B;  2JNB A;  4TUY A;  4F6R A;  5MN6 A;  2CHT A;  1OAP A;  3K14 A;  4BVS A;  4G4Y A;  3L7Q A;  3IMP A;  4O4J A;  1GO1 A;  1FFX B;  5GON B;  5IJ0 A;  5ITZ A;  3S06 A;  3CME F; 
#chains in the Genus database with same CATH homology
 1W57 A;  1GX1 A;  3FBA A;  1IV2 A;  3JVH A;  1KNK A;  3IKE A;  2AMT A;  3ELC A;  3KE1 A;  4C8I A;  5B8F A;  1IV4 A;  3F0E A;  3ESJ A;  3IEW A;  3Q8H A;  3T80 A;  3GHZ A;  1KNJ A;  3F0F A;  3F6M A;  1H48 A;  1U3P A;  3ERN A;  3FPI A;  1JY8 A;  4C8E A;  1VH8 A;  1IV3 A;  3IEQ A;  3RE3 A;  3K14 A;  2GZL A;  3EOR A;  4C81 A;  1T0A A;  4C82 A;  1H47 A;  3QHD A;  4C8G A;  1U43 A;  1U40 A;  2UZH A;  1IV1 A;  3F0G A;  3MBM A;  3B6N A;  1YQN A;  3P0Z A;  3P10 A;  2PMP A;  1U3L A;  3K2X A;  3IKF A;  1JN1 A;  3F0D A;  1VHA A;  1W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...