4C8GA

Ispf (burkholderia cenocepacia) cmp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
153
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
total genus 51
structure length 153
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8gA00
3KE1A 1VH8A 3K2XA 3F6MA 1W55A 1VHAA 1IV4A 1JY8A 3IEQA 3IEWA 3Q8HA 3ESJA 4C82A 1IV2A 5B8FA 1U43A 3EORA 4C8IA 2GZLA 3B6NA 1W57A 3F0FA 1JN1A 1H48A 3F0GA 3F0DA 3ELCA 3GHZA 1H47A 3T80A 1U3LA 3IKFA 1GX1A 1YQNA 3IKEA 3MBMA 1KNJA 3FBAA 2PMPA 1U40A 2AMTA 2UZHA 3F0EA 1KNKA 3ERNA 3RE3A 4C8EA 3K14A 3P0ZA 1IV1A 3P10A 3QHDA 4C81A 4C8GA 3JVHA 1IV3A 1T0AA 1U3PA 3FPIA
chains in the Genus database with same CATH superfamily
2Z01A 4YJ2B 4O4LB 4WBNA 1XV2A 4IIJB 1M1KH 3RA5A 4C8IA 3G71F 3F0FA 3CXCF 4X1IA 1ONIA 2P6YA 3JARB 1KD1H 3S0YA 3CG6A 2VAWA 3FBAA 3N2GA 2HS4A 2CSLA 2HP0A 5EWRA 4C8GA 4B45A 4FFBA 2HP3A 1UFYA 3V4DA 3AGKA 5JQGB 3K2XA 3IMPA 3JAMM 1Z5WA 3MCQA 3S0WA 3MQWA 2ZODA 4C82A 1QVGF 1VQVA 3LDTA 5CA1A 4O2AB 1K8AH 3ZP4A 5CA0A 1X25A 5LP6A 3F0GA 2YXZA 5LXTA 3CC2F 3HKDB 1JFFA 1QAHA 3J81M 3IKEA 3RYFA 1W581 3CPWF 3V3TA 3WGNA 1VQMF 2JNBA 4EB6B 4LNUA 5IJ9A 3CCUF 2HVYD 2EWCA 5FNVA 3ESJA 2UYNB 3OONA 2KGWA 3LWRC 4O4HA 4BT3A 3NVKE 2RB9A 4PWTA 2H6LA 1J7HA 5JH7B 4ERHA 3DC2A 1W5FA 5HY4A 4I50B 2KTUA 2W8BC 3TD5A 1KNJA 3TD4A 3WGJA 4TUYB 3ERNA 2UYNA 3LWPC 4BT2A 1JJ2F 3ZOPA 2MQEA 2HRUA 3VMFB 3LWVC 5EYPB 1FNKA 1IV4A 5KMGB 3JASA 5LA6A 3CC7F 4X1YA 5LYJB 3CC4F 2HS3A 3BYQA 4ZHQB 3S03A 2RHHA 1DT9A 5GAPK 3D00A 4U39A 3T80A 4O4JA 1GX1A 5IJ0A 3CYQA 5EB1B 3CPQA 1YHQF 1Z5VA 1SA0A 4C81A 4ZOLA 2RHJA 2CWJA 3C9RA 3VO8A 2DYYA 3V7EA 2HS0A 1FNJA 1X7OA 5IJ9B 2LCAA 3HTNA 2CHSA 3RYHB 1JD1A 3WPWA 2IAFA 3HWUA 4X1KA 2WALA 3I7TA 4DXDA 3J80M 4ZHYB 3S02A 4ZOLB 3S0HA 4I4TB 1U3LA 3MBMA 4FFBB 1RLGA 1GO1A 1FSZA 1VQ9F 3E1YA 3CCVF 1W59A 2OHWA 4YJ3B 1K73H 5ITZB 5GANK 2KTVA 4NQ3A 5G4VC 2HRYA 3MDOA 1Q86H 1CK2A 1W3EX 1W55A 1VHAA 3JARA 4G4XA 1VQLF 5HY0A 2I6RA 4I4TA 5EIBD 1ODEA 3JAKA 3FFMA 1YJWF 5EZYA 4TV8B 3S06A 4O4IB 3RYIB 3VOBA 1RQ7A 1RA4A 1N8RH 1SZQA 5ITZA 2BTQB 2VXYA 3CCMF 3CCSF 4G4YA 1X52A 2OTJF 3HKCB 2ZVYA 3E22A 1Q7YH 3P0ZA 3O85A 5FNVB 5HWEA 2ALEA 4TV9A 2G9IA 2RHOA 2DT4A 1K9MH 4BW0B 4I55A 1UI9A 4HNAA 2GVIA 1XRGA 5BMVA 1IV2A 1QU9A 3U0OA 4BT7A 4X1IB 3LMEA 3GYQA 1VQNF 1H47A 5CA0B 1GO0A 1YQNA 3WJQA 3LWOC 2AMTA 3F0EA 4M8IA 3NK6A 5LOVB 4G4WA 1KC8H 2N48A 4O2BB 4X20B 4BVTA 1XHOA 1COMA 5FJ4C 3JATA 1YI2F 2FGYA 3SIUA 1H7MA 3D54A 3N2KA 4O2AA 1VQ7F 5KX5B 3EORA 4G4VA 1M90H 3M1XA 4LCKA 2GLZA 3R0PA 2YYEA 4TV8A 3HJWC 1H48A 1VQ6F 1VQKF 5LP6C 2PHNA 3ON1A 1W2BF 1VQ5F 1YITF 5JVDA 3HKEB 3UT5B 4X1YB 5LYJA 2LBWA 1NJIH 1VK3A 2Z1EA 4BVQA 3K0TA 1W5EA 3VI6A 2BO1A 1VH8A 3VOAA 4EI8A 3IEQA 2HQSC 5B8FA 5GIPC 1SDSA 4I50A 1PXWA 2HP0B 1TVKA 2Q1XA 2IQQA 2OTLF 3I55F 3HKBA 3IKFA 5C8YA 5FLXM 4E6EA 5EIBC 3VCZA 4B46A 4TZZA 3CCQF 2CW4A 4BY9D 2QI2A 2HX0A 3CYPB 1ZWZA 2R751 5A2QM 5CA1B 5JCOA 5HXZA 3F6MA 3WGLA 3JALB 5DCVA 2L26A 3KHNA 4DRXB 3WPXA 2CVLA 3PLAC 1CLIA 2H8EA 3RYCB 5IT9M 2QTPA 3E22B 3F0DA 4ZHWA 2FC3A 2Z1UA 3CCJF 3KJJA 3CCLF 2LBTA 2QA4F 4R40B 5HXUA 1GZ0A 3JALA 4HNAB 1RQ2A 1FFXA 4U3JA 5GIOC 3OBYA 4RHAA 4O4HB 2VAPA 3VYSC 3WJPA 3CMAF 3G6EF 5GINC 3LFOA 5J2UA 1KQSF 1S72F 3PAFA 4LNUB 3L7QA 3FD5A 1YJNF 3NVIB 2AIFA 2IG8A 5HY1A 3CCRF 4KWEA 2Q1YA 3WGKA 3JAKB 3HKEA 3UT5A 5EZYB 5C8YB 3I56F 4C4WC 3CB2A 3J7AR 2PMPA 5LXTB 1PF5A 5J2TB 2OTMA 5EAZA 3P10A 2VGNA 1TUBA 3NK7A 3QUWA 1W41A 5MN5A 5IJ0B 3C8LA 2I6DA 1JY8A 3N4YA 4BVSA 5JQGA 1TUBB 3GTZA 4NWOB 3VIUA 4G88A 4BT4A 2VAMA 2AIZP 4RQOA 1RLUA 2NMUA 1W42A 3ELCA 3GHZA 4X20A 2Z1TA 2CZWA 3RYHA 1W40A 4ZI7A 3DDNA 5MN6A 4B5CA 2RHLA 1FFXB 2BTUA 4U3JB 2VGMA 3JCMM 3VYTC 3K14A 1Q82H 1IV1A 3QHDA 5KX5A 1X7PA 3G4SF 4IIJA 1U3PA 3FPIA 3KE1A 3JAWB 1E7KA 3WGMA 2B33A 4ZK7A 3WJRA 3RA6A 4F6RB 4BT5A 5HP7A 4NUTA 2ZF8A 3LYBA 1W5AA 3CD6F 5BMVB 3I3FA 5LA6B 3WXMB 1YJ9F 5EB0A 4G4ZA 4ZHVA 5JCOC 2UYPA 1U40A 5AVMA 3KIZA 4WBNB 2UZHA 3RE3A 4C8EA 3RYCA 1YIJF 4O4JB 4TUYA 4I55B 1DBFA 4EI9A 4ZI7B 3TD3A 1IV3A 2LBXA 2BTOA 3M4SA 5CB4B 3C9TA 3RYIA 4XCQA 4YJ3A 3ZO8A 3NMUC 3LWQC 1OFUA 1VQPF 4X3LA 3JAWA 1OAPA 1VQOF 1W5BA 3JASB 4TV9B 1CN7A 4O4LA 1IPAA 2ZOVA 5CB4A 1Q8RA 1NQ3A 5GONB 2F9ZC 3N4ZA 2UYKA 1TVKB 3OBWA 4EI7A 3FD6A 5EO3A 3VYUC 3C9SA 3JATB 3N2GB 1T0AA 3JVHA 4O4IA 2R6R1 5LP6B 3KJKA 2ZAUA 5GONA 4IHJB 5MN4A 3CMEF 2KG4A 3HKDA 2V9YA 4F6RA 1U43A 1VQ8F 3V7QA 1QD9A 4X1KB 1W57A 4BT6A 5J2UB 5JVDB 4EB6A 3E20B 2QEXF 4O2BA 3N2KB 3ZP7A 2UYJA 4IHJA 1T0KB 1JFFB 3RYFB 1VQ4F 2OZBA 3D01A 2CHTA 3P4EA 2H8CA 1YGYA 3CCEF 5G4UC 3VTIC 4B62A 5J2TA 1Q81H 5LOVA 3IEWA 3Q8HA 1XBIA 1QVFF 3QTYA 5EYPA 3HAXD 1NMUB 3MCAB 4X3MA 2GZLA 4DRXA 1JN1A 4YJ2A 5IYZA 2ZVZA 5HP8A 1SA0B 5JH7A 3SIVA 3K12A 1R1MA 4BVRA 3IR9A 2K1SA 5KMGA 1KNKA 5IYZB 2Z1FA 3HKCA 5HY2A 3M84A 3C9UA 4ZHQA 3OW2F 3HKBB 3B6NA
chains in the Genus database with same CATH topology
3KE1A 1VH8A 3K2XA 3F6MA 1W55A 1VHAA 1IV4A 1JY8A 3IEQA 3IEWA 3Q8HA 3ESJA 4C82A 1IV2A 5B8FA 1U43A 3EORA 4C8IA 2GZLA 3B6NA 1W57A 3F0FA 1JN1A 1H48A 3F0GA 3F0DA 3ELCA 3GHZA 1H47A 3T80A 1U3LA 3IKFA 1GX1A 1YQNA 3IKEA 3MBMA 1KNJA 3FBAA 2PMPA 1U40A 2AMTA 2UZHA 3F0EA 1KNKA 3ERNA 3RE3A 4C8EA 3K14A 3P0ZA 1IV1A 3P10A 3QHDA 4C81A 4C8GA 3JVHA 1IV3A 1T0AA 1U3PA 3FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE1 A;  1VH8 A;  3K2X A;  3F6M A;  1W55 A;  1VHA A;  1IV4 A;  1JY8 A;  3IEQ A;  3IEW A;  3Q8H A;  3ESJ A;  4C82 A;  1IV2 A;  5B8F A;  1U43 A;  3EOR A;  4C8I A;  2GZL A;  3B6N A;  1W57 A;  3F0F A;  1JN1 A;  1H48 A;  3F0G A;  3F0D A;  3ELC A;  3GHZ A;  1H47 A;  3T80 A;  1U3L A;  3IKF A;  1GX1 A;  1YQN A;  3IKE A;  3MBM A;  1KNJ A;  3FBA A;  2PMP A;  1U40 A;  2AMT A;  2UZH A;  3F0E A;  1KNK A;  3ERN A;  3RE3 A;  4C8E A;  3K14 A;  3P0Z A;  1IV1 A;  3P10 A;  3QHD A;  4C81 A;  4C8G A;  3JVH A;  1IV3 A;  1T0A A;  1U3P A;  3FPI A; 
#chains in the Genus database with same CATH topology
 2Z01 A;  4YJ2 B;  4O4L B;  4WBN A;  1XV2 A;  4IIJ B;  1M1K H;  3RA5 A;  4C8I A;  3G71 F;  3F0F A;  3CXC F;  4X1I A;  1ONI A;  2P6Y A;  3JAR B;  1KD1 H;  3S0Y A;  3CG6 A;  2VAW A;  3FBA A;  3N2G A;  2HS4 A;  2CSL A;  2HP0 A;  5EWR A;  4C8G A;  4B45 A;  4FFB A;  2HP3 A;  1UFY A;  3V4D A;  3AGK A;  5JQG B;  3K2X A;  3IMP A;  3JAM M;  1Z5W A;  3MCQ A;  3S0W A;  3MQW A;  2ZOD A;  4C82 A;  1QVG F;  1VQV A;  3LDT A;  5CA1 A;  4O2A B;  1K8A H;  3ZP4 A;  5CA0 A;  1X25 A;  5LP6 A;  3F0G A;  2YXZ A;  5LXT A;  3CC2 F;  3HKD B;  1JFF A;  1QAH A;  3J81 M;  3IKE A;  3RYF A;  1W58 1;  3CPW F;  3V3T A;  3WGN A;  1VQM F;  2JNB A;  4EB6 B;  4LNU A;  5IJ9 A;  3CCU F;  2HVY D;  2EWC A;  5FNV A;  3ESJ A;  2UYN B;  3OON A;  2KGW A;  3LWR C;  4O4H A;  4BT3 A;  3NVK E;  2RB9 A;  4PWT A;  2H6L A;  1J7H A;  5JH7 B;  4ERH A;  3DC2 A;  1W5F A;  5HY4 A;  4I50 B;  2KTU A;  2W8B C;  3TD5 A;  1KNJ A;  3TD4 A;  3WGJ A;  4TUY B;  3ERN A;  2UYN A;  3LWP C;  4BT2 A;  1JJ2 F;  3ZOP A;  2MQE A;  2HRU A;  3VMF B;  3LWV C;  5EYP B;  1FNK A;  1IV4 A;  5KMG B;  3JAS A;  5LA6 A;  3CC7 F;  4X1Y A;  5LYJ B;  3CC4 F;  2HS3 A;  3BYQ A;  4ZHQ B;  3S03 A;  2RHH A;  1DT9 A;  5GAP K;  3D00 A;  4U39 A;  3T80 A;  4O4J A;  1GX1 A;  5IJ0 A;  3CYQ A;  5EB1 B;  3CPQ A;  1YHQ F;  1Z5V A;  1SA0 A;  4C81 A;  4ZOL A;  2RHJ A;  2CWJ A;  3C9R A;  3VO8 A;  2DYY A;  3V7E A;  2HS0 A;  1FNJ A;  1X7O A;  5IJ9 B;  2LCA A;  3HTN A;  2CHS A;  3RYH B;  1JD1 A;  3WPW A;  2IAF A;  3HWU A;  4X1K A;  2WAL A;  3I7T A;  4DXD A;  3J80 M;  4ZHY B;  3S02 A;  4ZOL B;  3S0H A;  4I4T B;  1U3L A;  3MBM A;  4FFB B;  1RLG A;  1GO1 A;  1FSZ A;  1VQ9 F;  3E1Y A;  3CCV F;  1W59 A;  2OHW A;  4YJ3 B;  1K73 H;  5ITZ B;  5GAN K;  2KTV A;  4NQ3 A;  5G4V C;  2HRY A;  3MDO A;  1Q86 H;  1CK2 A;  1W3E X;  1W55 A;  1VHA A;  3JAR A;  4G4X A;  1VQL F;  5HY0 A;  2I6R A;  4I4T A;  5EIB D;  1ODE A;  3JAK A;  3FFM A;  1YJW F;  5EZY A;  4TV8 B;  3S06 A;  4O4I B;  3RYI B;  3VOB A;  1RQ7 A;  1RA4 A;  1N8R H;  1SZQ A;  5ITZ A;  2BTQ B;  2VXY A;  3CCM F;  3CCS F;  4G4Y A;  1X52 A;  2OTJ F;  3HKC B;  2ZVY A;  3E22 A;  1Q7Y H;  3P0Z A;  3O85 A;  5FNV B;  5HWE A;  2ALE A;  4TV9 A;  2G9I A;  2RHO A;  2DT4 A;  1K9M H;  4BW0 B;  4I55 A;  1UI9 A;  4HNA A;  2GVI A;  1XRG A;  5BMV A;  1IV2 A;  1QU9 A;  3U0O A;  4BT7 A;  4X1I B;  3LME A;  3GYQ A;  1VQN F;  1H47 A;  5CA0 B;  1GO0 A;  1YQN A;  3WJQ A;  3LWO C;  2AMT A;  3F0E A;  4M8I A;  3NK6 A;  5LOV B;  4G4W A;  1KC8 H;  2N48 A;  4O2B B;  4X20 B;  4BVT A;  1XHO A;  1COM A;  5FJ4 C;  3JAT A;  1YI2 F;  2FGY A;  3SIU A;  1H7M A;  3D54 A;  3N2K A;  4O2A A;  1VQ7 F;  5KX5 B;  3EOR A;  4G4V A;  1M90 H;  3M1X A;  4LCK A;  2GLZ A;  3R0P A;  2YYE A;  4TV8 A;  3HJW C;  1H48 A;  1VQ6 F;  1VQK F;  5LP6 C;  2PHN A;  3ON1 A;  1W2B F;  1VQ5 F;  1YIT F;  5JVD A;  3HKE B;  3UT5 B;  4X1Y B;  5LYJ A;  2LBW A;  1NJI H;  1VK3 A;  2Z1E A;  4BVQ A;  3K0T A;  1W5E A;  3VI6 A;  2BO1 A;  1VH8 A;  3VOA A;  4EI8 A;  3IEQ A;  2HQS C;  5B8F A;  5GIP C;  1SDS A;  4I50 A;  1PXW A;  2HP0 B;  1TVK A;  2Q1X A;  2IQQ A;  2OTL F;  3I55 F;  3HKB A;  3IKF A;  5C8Y A;  5FLX M;  4E6E A;  5EIB C;  3VCZ A;  4B46 A;  4TZZ A;  3CCQ F;  2CW4 A;  4BY9 D;  2QI2 A;  2HX0 A;  3CYP B;  1ZWZ A;  2R75 1;  5A2Q M;  5CA1 B;  5JCO A;  5HXZ A;  3F6M A;  3WGL A;  3JAL B;  5DCV A;  2L26 A;  3KHN A;  4DRX B;  3WPX A;  2CVL A;  3PLA C;  1CLI A;  2H8E A;  3RYC B;  5IT9 M;  2QTP A;  3E22 B;  3F0D A;  4ZHW A;  2FC3 A;  2Z1U A;  3CCJ F;  3KJJ A;  3CCL F;  2LBT A;  2QA4 F;  4R40 B;  5HXU A;  1GZ0 A;  3JAL A;  4HNA B;  1RQ2 A;  1FFX A;  4U3J A;  5GIO C;  3OBY A;  4RHA A;  4O4H B;  2VAP A;  3VYS C;  3WJP A;  3CMA F;  3G6E F;  5GIN C;  3LFO A;  5J2U A;  1KQS F;  1S72 F;  3PAF A;  4LNU B;  3L7Q A;  3FD5 A;  1YJN F;  3NVI B;  2AIF A;  2IG8 A;  5HY1 A;  3CCR F;  4KWE A;  2Q1Y A;  3WGK A;  3JAK B;  3HKE A;  3UT5 A;  5EZY B;  5C8Y B;  3I56 F;  4C4W C;  3CB2 A;  3J7A R;  2PMP A;  5LXT B;  1PF5 A;  5J2T B;  2OTM A;  5EAZ A;  3P10 A;  2VGN A;  1TUB A;  3NK7 A;  3QUW A;  1W41 A;  5MN5 A;  5IJ0 B;  3C8L A;  2I6D A;  1JY8 A;  3N4Y A;  4BVS A;  5JQG A;  1TUB B;  3GTZ A;  4NWO B;  3VIU A;  4G88 A;  4BT4 A;  2VAM A;  2AIZ P;  4RQO A;  1RLU A;  2NMU A;  1W42 A;  3ELC A;  3GHZ A;  4X20 A;  2Z1T A;  2CZW A;  3RYH A;  1W40 A;  4ZI7 A;  3DDN A;  5MN6 A;  4B5C A;  2RHL A;  1FFX B;  2BTU A;  4U3J B;  2VGM A;  3JCM M;  3VYT C;  3K14 A;  1Q82 H;  1IV1 A;  3QHD A;  5KX5 A;  1X7P A;  3G4S F;  4IIJ A;  1U3P A;  3FPI A;  3KE1 A;  3JAW B;  1E7K A;  3WGM A;  2B33 A;  4ZK7 A;  3WJR A;  3RA6 A;  4F6R B;  4BT5 A;  5HP7 A;  4NUT A;  2ZF8 A;  3LYB A;  1W5A A;  3CD6 F;  5BMV B;  3I3F A;  5LA6 B;  3WXM B;  1YJ9 F;  5EB0 A;  4G4Z A;  4ZHV A;  5JCO C;  2UYP A;  1U40 A;  5AVM A;  3KIZ A;  4WBN B;  2UZH A;  3RE3 A;  4C8E A;  3RYC A;  1YIJ F;  4O4J B;  4TUY A;  4I55 B;  1DBF A;  4EI9 A;  4ZI7 B;  3TD3 A;  1IV3 A;  2LBX A;  2BTO A;  3M4S A;  5CB4 B;  3C9T A;  3RYI A;  4XCQ A;  4YJ3 A;  3ZO8 A;  3NMU C;  3LWQ C;  1OFU A;  1VQP F;  4X3L A;  3JAW A;  1OAP A;  1VQO F;  1W5B A;  3JAS B;  4TV9 B;  1CN7 A;  4O4L A;  1IPA A;  2ZOV A;  5CB4 A;  1Q8R A;  1NQ3 A;  5GON B;  2F9Z C;  3N4Z A;  2UYK A;  1TVK B;  3OBW A;  4EI7 A;  3FD6 A;  5EO3 A;  3VYU C;  3C9S A;  3JAT B;  3N2G B;  1T0A A;  3JVH A;  4O4I A;  2R6R 1;  5LP6 B;  3KJK A;  2ZAU A;  5GON A;  4IHJ B;  5MN4 A;  3CME F;  2KG4 A;  3HKD A;  2V9Y A;  4F6R A;  1U43 A;  1VQ8 F;  3V7Q A;  1QD9 A;  4X1K B;  1W57 A;  4BT6 A;  5J2U B;  5JVD B;  4EB6 A;  3E20 B;  2QEX F;  4O2B A;  3N2K B;  3ZP7 A;  2UYJ A;  4IHJ A;  1T0K B;  1JFF B;  3RYF B;  1VQ4 F;  2OZB A;  3D01 A;  2CHT A;  3P4E A;  2H8C A;  1YGY A;  3CCE F;  5G4U C;  3VTI C;  4B62 A;  5J2T A;  1Q81 H;  5LOV A;  3IEW A;  3Q8H A;  1XBI A;  1QVF F;  3QTY A;  5EYP A;  3HAX D;  1NMU B;  3MCA B;  4X3M A;  2GZL A;  4DRX A;  1JN1 A;  4YJ2 A;  5IYZ A;  2ZVZ A;  5HP8 A;  1SA0 B;  5JH7 A;  3SIV A;  3K12 A;  1R1M A;  4BVR A;  3IR9 A;  2K1S A;  5KMG A;  1KNK A;  5IYZ B;  2Z1F A;  3HKC A;  5HY2 A;  3M84 A;  3C9U A;  4ZHQ A;  3OW2 F;  3HKB B;  3B6N A; 
#chains in the Genus database with same CATH homology
 3KE1 A;  1VH8 A;  3K2X A;  3F6M A;  1W55 A;  1VHA A;  1IV4 A;  1JY8 A;  3IEQ A;  3IEW A;  3Q8H A;  3ESJ A;  4C82 A;  1IV2 A;  5B8F A;  1U43 A;  3EOR A;  4C8I A;  2GZL A;  3B6N A;  1W57 A;  3F0F A;  1JN1 A;  1H48 A;  3F0G A;  3F0D A;  3ELC A;  3GHZ A;  1H47 A;  3T80 A;  1U3L A;  3IKF A;  1GX1 A;  1YQN A;  3IKE A;  3MBM A;  1KNJ A;  3FBA A;  2PMP A;  1U40 A;  2AMT A;  2UZH A;  3F0E A;  1KNK A;  3ERN A;  3RE3 A;  4C8E A;  3K14 A;  3P0Z A;  1IV1 A;  3P10 A;  3QHD A;  4C81 A;  4C8G A;  3JVH A;  1IV3 A;  1T0A A;  1U3P A;  3FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...