4C8GA

Ispf (burkholderia cenocepacia) cmp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
153
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 51
structure length 153
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8gA00
3ESJA 3ELCA 3QHDA 1IV1A 1W57A 1GX1A 3EORA 1H48A 1IV3A 3F0GA 3FBAA 4C81A 4C82A 1U40A 1IV4A 3F0EA 1VHAA 1H47A 3P10A 1U43A 3IKEA 2GZLA 2PMPA 3FPIA 4C8IA 3K2XA 1W55A 3ERNA 3GHZA 3K14A 3KE1A 3P0ZA 3IEWA 2UZHA 1U3PA 5B8FA 1KNJA 3F0DA 1IV2A 3RE3A 3B6NA 1YQNA 3T80A 2AMTA 3F6MA 4C8EA 4C8GA 1JN1A 3JVHA 1VH8A 1T0AA 1U3LA 3Q8HA 1JY8A 1KNKA 3F0FA 3MBMA 3IKFA 3IEQA
chains in the Genus database with same CATH superfamily
1W5BA 3QHDA 2ZOVA 3UT5A 1XV2A 3CC7F 3OBWA 4BT5A 3WGMA 1FNJA 2H6LA 1VQ5F 1SA0A 1VQ9F 4E6EA 5KX5A 3LYBA 1TVKB 5HY2A 2VXYA 4TV8A 2H8EA 4X1YB 3WJPA 1CK2A 5C8YA 4TV9B 5JVDB 3FD5A 3PAFA 3CCJF 1Q86H 1VQVA 4LNUA 5FLXM 3AGKA 1T0AA 4X20B 2CVLA 1JY8A 2V9YA 3KIZA 3VO8A 3LWPC 3JASB 3E22A 3HTNA 2F9ZC 3HWUA 3ZP4A 5EYPA 4BVQA 4C81A 2AIZP 1SZQA 2RB9A 4YJ3B 1H47A 2MQEA 3VCZA 5GONB 1W581 2BTUA 4KWEA 3S06A 1J7HA 1YJWF 1TUBB 5EB1B 1ODEA 1SA0B 1GO1A 1W40A 3T80A 3CXCF 3NK6A 1RLUA 2WALA 3O85A 2NMUA 2YXZA 3WGKA 3HJWC 1W2BF 5J2TA 2ZVZA 5EZYB 5CB4B 2HS3A 4U3JB 5HP7A 3CCQF 4G4YA 1UFYA 3HKCA 5C8YB 1NJIH 5LYJB 1PF5A 4B46A 5JH7A 3FFMA 5MN5A 1XHOA 4PWTA 5LXTB 4LNUB 2GLZA 4F6RA 5CA1B 4BT6A 5EIBC 5GIOC 5LA6B 4EI8A 5FNVA 3RYIB 5EYPB 3ZOPA 3WXMB 1KNJA 4BT2A 2BTQB 4IIJB 3RE3A 3K0TA 4G4XA 5G4VC 2P6YA 1RQ7A 5HY4A 3CCSF 3MCQA 1RA4A 4YJ2B 4BY9D 1PXWA 5CA0A 4HNAA 5KMGA 3NK7A 3L7QA 3N2KB 3CMAF 3LWRC 2HS4A 3JATA 3MQWA 4ERHA 3IR9A 3VYUC 3BYQA 4BVTA 3J80M 1IPAA 4ZHVA 1YHQF 3JALB 2G9IA 2Z1UA 3MDOA 4I55B 3CYQA 4NUTA 5LP6A 1W42A 3HKDA 3VYSC 3N2GB 4ZOLA 4O2BB 2BTOA 1KNKA 4WBNB 2L26A 4DRXA 3E1YA 1Q81H 1COMA 3JAKB 1KD1H 2ZVYA 5GAPK 3I7TA 5IJ9A 4IHJB 5ITZA 1VQNF 2HS0A 2RHOA 3HKEA 3N4YA 2YYEA 1N8RH 2JNBA 4X3LA 3IMPA 1FFXA 2PHNA 4HNAB 3HKBA 1QU9A 2CHSA 2R751 3C9RA 3V7QA 1X7PA 3F0DA 3C9TA 2OTMA 3JAWA 1K9MH 3S0YA 3WGJA 3OBYA 4X3MA 4BVSA 1GO0A 3U0OA 3I3FA 2ZAUA 5J2UA 5IYZA 4BVRA 5LP6B 3HKDB 4X1IA 1S72F 2HP0A 1YJNF 3QTYA 4U39A 3CCEF 1Q7YH 2UYNB 3CYPB 4DRXB 1W55A 1XBIA 2VAPA 3J81M 2R6R1 4LCKA 2UZHA 1R1MA 5IJ9B 4TZZA 3OW2F 2KTVA 3WPXA 5ITZB 4NWOB 4O4JA 3HKEB 5EAZA 2ZF8A 1VH8A 1VQMF 5EIBD 3MBMA 2CHTA 3IEQA 5LP6C 5MN4A 4BW0B 3CPQA 3J7AR 5JQGA 1U40A 4I50A 5IJ0A 1M1KH 4TUYB 3CD6F 3CMEF 1E7KA 1SDSA 5BMVA 4BT3A 3VYTC 4O4IB 4B5CA 3RYFA 3N4ZA 2LBWA 4X1KB 3JARA 5J2UB 3D00A 4G4VA 3UT5B 5IYZB 1JJ2F 1FNKA 5KX5B 3M1XA 3CCUF 5HXUA 3NVKE 2RHHA 3CPWF 4TV8B 4O2AA 3WJRA 3RYHA 1RQ2A 2IG8A 2GVIA 2QEXF 2H8CA 4FFBA 5A2QM 2OZBA 2HQSC 4C8IA 1Q8RA 1JD1A 4G4WA 3E20B 3E22B 3VIUA 1ONIA 5JQGB 2Z1FA 3RA5A 1W5EA 2LCAA 5IJ0B 1K8AH 2CSLA 4C8EA 5BMVB 4EI7A 3JVHA 4O4HA 3IKFA 1UI9A 2QI2A 3RYCA 2OTJF 3D54A 3R0PA 3LFOA 5HWEA 1YIJF 2ALEA 4B45A 2RHLA 2LBXA 1U43A 4ZI7A 3IKEA 5MN6A 1OAPA 2PMPA 2Z1TA 5J2TB 1NQ3A 1YI2F 3K14A 3KE1A 1JFFA 3HKCB 2B33A 1IV2A 3G4SF 5JH7B 1VQ6F 4C4WC 1Q82H 2OTLF 2CWJA 3Q8HA 5HP8A 3F0FA 4F6RB 4EI9A 3ELCA 1GX1A 3EORA 5FNVB 1IV3A 4ZHQA 1W5AA 3FD6A 1VQ4F 4I4TA 4O4HB 3K2XA 1OFUA 4BT4A 3RYCB 3I55F 3KJJA 1YGYA 5CA0B 5KMGB 2HRYA 3VOBA 1W41A 1QAHA 3HAXD 1T0KB 4XCQA 1QVGF 1TVKA 3WJQA 5GINC 4ZI7B 3DDNA 3JATB 3LDTA 2RHJA 3V4DA 3TD5A 1W57A 3CC4F 1VQKF 5JVDA 3TD3A 1FSZA 2Q1YA 3OONA 3F0EA 3CB2A 4B62A 2HRUA 3CCLF 4ZOLB 2GZLA 1ZWZA 3JASA 4G4ZA 3JCMM 2Q1XA 3P4EA 1W5FA 5EB0A 2FGYA 1Z5WA 2VAMA 4G88A 5GONA 4RQOA 1QVFF 5LOVA 4NQ3A 5FJ4C 3QUWA 3NMUC 1FFXB 1TUBA 3C8LA 3HKBB 3KHNA 1H7MA 3JAWB 3WPWA 4M8IA 3SIVA 4O4LA 2UYJA 3JAMM 5EZYA 3VTIC 5CB4A 3G71F 2Z01A 4U3JA 1DBFA 3P0ZA 5LYJA 1U3PA 5LXTA 3I56F 3CG6A 3LWOC 1YQNA 2AMTA 4X1IB 1JN1A 1VQOF 5CA1A 2HP0B 5IT9M 5LA6A 4RHAA 2QTPA 2KTUA 3RYIA 3WGLA 3CCRF 2OHWA 5HXZA 3FBAA 2HX0A 4IIJA 1VQ7F 3CCMF 1VHAA 5HY0A 4O4JB 3S0HA 2BO1A 3LMEA 2DT4A 2HP3A 4YJ2A 1XRGA 2FC3A 3FPIA 3ON1A 5LOVB 3V7EA 4EB6A 1CLIA 1K73H 3ERNA 3GHZA 3M4SA 4DXDA 3ZP7A 3IEWA 1VQPF 1W3EX 3N2KA 3G6EF 3MCAB 2CW4A 2I6RA 4ZK7A 1YJ9F 4I50B 3F6MA 4ZHYB 3VMFB 2VGNA 4O4LB 5JCOA 3VOAA 3RYFB 1GZ0A 3JALA 1X7OA 2W8BC 3JARB 2KG4A 4I55A 4BT7A 1NMUB 2DYYA 2N48A 3CCVF 2AIFA 1X52A 3N2GA 4O2BA 4WBNA 3SIUA 2EWCA 4O2AB 2QA4F 4R40B 3LWVC 3JAKA 3RYHB 4IHJA 3S0WA 3V3TA 1KQSF 3NVIB 3WGNA 2UYKA 5EWRA 3PLAC 4FFBB 1U3LA 2VAWA 3ESJA 4EB6B 3TD4A 3LWQC 1H48A 5AVMA 2HVYD 3ZO8A 3S02A 1M90H 2I6DA 1IV4A 3RA6A 3D01A 3M84A 2VGMA 3C9UA 3VI6A 2ZODA 1KC8H 4ZHWA 5HY1A 3DC2A 5GANK 5B8FA 2UYPA 3K12A 3GYQA 5G4UC 3B6NA 3CC2F 1W59A 2LBTA 1VK3A 4C82A 2UYNA 3P10A 1IV1A 4X1YA 1RLGA 1JFFB 3F0GA 4TV9A 1DT9A 5JCOC 5EO3A 1VQ8F 2IAFA 2KGWA 2CZWA 3KJKA 4X20A 1VQLF 1Z5VA 3GTZA 2IQQA 3C9SA 4ZHQB 4TUYA 5DCVA 1X25A 1QD9A 4C8GA 2K1SA 1YITF 4O4IA 1CN7A 2Z1EA 5GIPC 4YJ3A 4X1KA 4I4TB 3S03A
chains in the Genus database with same CATH topology
3ESJA 3ELCA 3QHDA 1IV1A 1W57A 1GX1A 3EORA 1H48A 1IV3A 3F0GA 3FBAA 4C81A 4C82A 1U40A 1IV4A 3F0EA 1VHAA 1H47A 3P10A 1U43A 3IKEA 2GZLA 2PMPA 3FPIA 4C8IA 3K2XA 1W55A 3ERNA 3GHZA 3K14A 3KE1A 3P0ZA 3IEWA 2UZHA 1U3PA 5B8FA 1KNJA 3F0DA 1IV2A 3RE3A 3B6NA 1YQNA 3T80A 2AMTA 3F6MA 4C8EA 4C8GA 1JN1A 3JVHA 1VH8A 1T0AA 1U3LA 3Q8HA 1JY8A 1KNKA 3F0FA 3MBMA 3IKFA 3IEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESJ A;  3ELC A;  3QHD A;  1IV1 A;  1W57 A;  1GX1 A;  3EOR A;  1H48 A;  1IV3 A;  3F0G A;  3FBA A;  4C81 A;  4C82 A;  1U40 A;  1IV4 A;  3F0E A;  1VHA A;  1H47 A;  3P10 A;  1U43 A;  3IKE A;  2GZL A;  2PMP A;  3FPI A;  4C8I A;  3K2X A;  1W55 A;  3ERN A;  3GHZ A;  3K14 A;  3KE1 A;  3P0Z A;  3IEW A;  2UZH A;  1U3P A;  5B8F A;  1KNJ A;  3F0D A;  1IV2 A;  3RE3 A;  3B6N A;  1YQN A;  3T80 A;  2AMT A;  3F6M A;  4C8E A;  4C8G A;  1JN1 A;  3JVH A;  1VH8 A;  1T0A A;  1U3L A;  3Q8H A;  1JY8 A;  1KNK A;  3F0F A;  3MBM A;  3IKF A;  3IEQ A; 
#chains in the Genus database with same CATH topology
 1W5B A;  3QHD A;  2ZOV A;  3UT5 A;  1XV2 A;  3CC7 F;  3OBW A;  4BT5 A;  3WGM A;  1FNJ A;  2H6L A;  1VQ5 F;  1SA0 A;  1VQ9 F;  4E6E A;  5KX5 A;  3LYB A;  1TVK B;  5HY2 A;  2VXY A;  4TV8 A;  2H8E A;  4X1Y B;  3WJP A;  1CK2 A;  5C8Y A;  4TV9 B;  5JVD B;  3FD5 A;  3PAF A;  3CCJ F;  1Q86 H;  1VQV A;  4LNU A;  5FLX M;  3AGK A;  1T0A A;  4X20 B;  2CVL A;  1JY8 A;  2V9Y A;  3KIZ A;  3VO8 A;  3LWP C;  3JAS B;  3E22 A;  3HTN A;  2F9Z C;  3HWU A;  3ZP4 A;  5EYP A;  4BVQ A;  4C81 A;  2AIZ P;  1SZQ A;  2RB9 A;  4YJ3 B;  1H47 A;  2MQE A;  3VCZ A;  5GON B;  1W58 1;  2BTU A;  4KWE A;  3S06 A;  1J7H A;  1YJW F;  1TUB B;  5EB1 B;  1ODE A;  1SA0 B;  1GO1 A;  1W40 A;  3T80 A;  3CXC F;  3NK6 A;  1RLU A;  2WAL A;  3O85 A;  2NMU A;  2YXZ A;  3WGK A;  3HJW C;  1W2B F;  5J2T A;  2ZVZ A;  5EZY B;  5CB4 B;  2HS3 A;  4U3J B;  5HP7 A;  3CCQ F;  4G4Y A;  1UFY A;  3HKC A;  5C8Y B;  1NJI H;  5LYJ B;  1PF5 A;  4B46 A;  5JH7 A;  3FFM A;  5MN5 A;  1XHO A;  4PWT A;  5LXT B;  4LNU B;  2GLZ A;  4F6R A;  5CA1 B;  4BT6 A;  5EIB C;  5GIO C;  5LA6 B;  4EI8 A;  5FNV A;  3RYI B;  5EYP B;  3ZOP A;  3WXM B;  1KNJ A;  4BT2 A;  2BTQ B;  4IIJ B;  3RE3 A;  3K0T A;  4G4X A;  5G4V C;  2P6Y A;  1RQ7 A;  5HY4 A;  3CCS F;  3MCQ A;  1RA4 A;  4YJ2 B;  4BY9 D;  1PXW A;  5CA0 A;  4HNA A;  5KMG A;  3NK7 A;  3L7Q A;  3N2K B;  3CMA F;  3LWR C;  2HS4 A;  3JAT A;  3MQW A;  4ERH A;  3IR9 A;  3VYU C;  3BYQ A;  4BVT A;  3J80 M;  1IPA A;  4ZHV A;  1YHQ F;  3JAL B;  2G9I A;  2Z1U A;  3MDO A;  4I55 B;  3CYQ A;  4NUT A;  5LP6 A;  1W42 A;  3HKD A;  3VYS C;  3N2G B;  4ZOL A;  4O2B B;  2BTO A;  1KNK A;  4WBN B;  2L26 A;  4DRX A;  3E1Y A;  1Q81 H;  1COM A;  3JAK B;  1KD1 H;  2ZVY A;  5GAP K;  3I7T A;  5IJ9 A;  4IHJ B;  5ITZ A;  1VQN F;  2HS0 A;  2RHO A;  3HKE A;  3N4Y A;  2YYE A;  1N8R H;  2JNB A;  4X3L A;  3IMP A;  1FFX A;  2PHN A;  4HNA B;  3HKB A;  1QU9 A;  2CHS A;  2R75 1;  3C9R A;  3V7Q A;  1X7P A;  3F0D A;  3C9T A;  2OTM A;  3JAW A;  1K9M H;  3S0Y A;  3WGJ A;  3OBY A;  4X3M A;  4BVS A;  1GO0 A;  3U0O A;  3I3F A;  2ZAU A;  5J2U A;  5IYZ A;  4BVR A;  5LP6 B;  3HKD B;  4X1I A;  1S72 F;  2HP0 A;  1YJN F;  3QTY A;  4U39 A;  3CCE F;  1Q7Y H;  2UYN B;  3CYP B;  4DRX B;  1W55 A;  1XBI A;  2VAP A;  3J81 M;  2R6R 1;  4LCK A;  2UZH A;  1R1M A;  5IJ9 B;  4TZZ A;  3OW2 F;  2KTV A;  3WPX A;  5ITZ B;  4NWO B;  4O4J A;  3HKE B;  5EAZ A;  2ZF8 A;  1VH8 A;  1VQM F;  5EIB D;  3MBM A;  2CHT A;  3IEQ A;  5LP6 C;  5MN4 A;  4BW0 B;  3CPQ A;  3J7A R;  5JQG A;  1U40 A;  4I50 A;  5IJ0 A;  1M1K H;  4TUY B;  3CD6 F;  3CME F;  1E7K A;  1SDS A;  5BMV A;  4BT3 A;  3VYT C;  4O4I B;  4B5C A;  3RYF A;  3N4Z A;  2LBW A;  4X1K B;  3JAR A;  5J2U B;  3D00 A;  4G4V A;  3UT5 B;  5IYZ B;  1JJ2 F;  1FNK A;  5KX5 B;  3M1X A;  3CCU F;  5HXU A;  3NVK E;  2RHH A;  3CPW F;  4TV8 B;  4O2A A;  3WJR A;  3RYH A;  1RQ2 A;  2IG8 A;  2GVI A;  2QEX F;  2H8C A;  4FFB A;  5A2Q M;  2OZB A;  2HQS C;  4C8I A;  1Q8R A;  1JD1 A;  4G4W A;  3E20 B;  3E22 B;  3VIU A;  1ONI A;  5JQG B;  2Z1F A;  3RA5 A;  1W5E A;  2LCA A;  5IJ0 B;  1K8A H;  2CSL A;  4C8E A;  5BMV B;  4EI7 A;  3JVH A;  4O4H A;  3IKF A;  1UI9 A;  2QI2 A;  3RYC A;  2OTJ F;  3D54 A;  3R0P A;  3LFO A;  5HWE A;  1YIJ F;  2ALE A;  4B45 A;  2RHL A;  2LBX A;  1U43 A;  4ZI7 A;  3IKE A;  5MN6 A;  1OAP A;  2PMP A;  2Z1T A;  5J2T B;  1NQ3 A;  1YI2 F;  3K14 A;  3KE1 A;  1JFF A;  3HKC B;  2B33 A;  1IV2 A;  3G4S F;  5JH7 B;  1VQ6 F;  4C4W C;  1Q82 H;  2OTL F;  2CWJ A;  3Q8H A;  5HP8 A;  3F0F A;  4F6R B;  4EI9 A;  3ELC A;  1GX1 A;  3EOR A;  5FNV B;  1IV3 A;  4ZHQ A;  1W5A A;  3FD6 A;  1VQ4 F;  4I4T A;  4O4H B;  3K2X A;  1OFU A;  4BT4 A;  3RYC B;  3I55 F;  3KJJ A;  1YGY A;  5CA0 B;  5KMG B;  2HRY A;  3VOB A;  1W41 A;  1QAH A;  3HAX D;  1T0K B;  4XCQ A;  1QVG F;  1TVK A;  3WJQ A;  5GIN C;  4ZI7 B;  3DDN A;  3JAT B;  3LDT A;  2RHJ A;  3V4D A;  3TD5 A;  1W57 A;  3CC4 F;  1VQK F;  5JVD A;  3TD3 A;  1FSZ A;  2Q1Y A;  3OON A;  3F0E A;  3CB2 A;  4B62 A;  2HRU A;  3CCL F;  4ZOL B;  2GZL A;  1ZWZ A;  3JAS A;  4G4Z A;  3JCM M;  2Q1X A;  3P4E A;  1W5F A;  5EB0 A;  2FGY A;  1Z5W A;  2VAM A;  4G88 A;  5GON A;  4RQO A;  1QVF F;  5LOV A;  4NQ3 A;  5FJ4 C;  3QUW A;  3NMU C;  1FFX B;  1TUB A;  3C8L A;  3HKB B;  3KHN A;  1H7M A;  3JAW B;  3WPW A;  4M8I A;  3SIV A;  4O4L A;  2UYJ A;  3JAM M;  5EZY A;  3VTI C;  5CB4 A;  3G71 F;  2Z01 A;  4U3J A;  1DBF A;  3P0Z A;  5LYJ A;  1U3P A;  5LXT A;  3I56 F;  3CG6 A;  3LWO C;  1YQN A;  2AMT A;  4X1I B;  1JN1 A;  1VQO F;  5CA1 A;  2HP0 B;  5IT9 M;  5LA6 A;  4RHA A;  2QTP A;  2KTU A;  3RYI A;  3WGL A;  3CCR F;  2OHW A;  5HXZ A;  3FBA A;  2HX0 A;  4IIJ A;  1VQ7 F;  3CCM F;  1VHA A;  5HY0 A;  4O4J B;  3S0H A;  2BO1 A;  3LME A;  2DT4 A;  2HP3 A;  4YJ2 A;  1XRG A;  2FC3 A;  3FPI A;  3ON1 A;  5LOV B;  3V7E A;  4EB6 A;  1CLI A;  1K73 H;  3ERN A;  3GHZ A;  3M4S A;  4DXD A;  3ZP7 A;  3IEW A;  1VQP F;  1W3E X;  3N2K A;  3G6E F;  3MCA B;  2CW4 A;  2I6R A;  4ZK7 A;  1YJ9 F;  4I50 B;  3F6M A;  4ZHY B;  3VMF B;  2VGN A;  4O4L B;  5JCO A;  3VOA A;  3RYF B;  1GZ0 A;  3JAL A;  1X7O A;  2W8B C;  3JAR B;  2KG4 A;  4I55 A;  4BT7 A;  1NMU B;  2DYY A;  2N48 A;  3CCV F;  2AIF A;  1X52 A;  3N2G A;  4O2B A;  4WBN A;  3SIU A;  2EWC A;  4O2A B;  2QA4 F;  4R40 B;  3LWV C;  3JAK A;  3RYH B;  4IHJ A;  3S0W A;  3V3T A;  1KQS F;  3NVI B;  3WGN A;  2UYK A;  5EWR A;  3PLA C;  4FFB B;  1U3L A;  2VAW A;  3ESJ A;  4EB6 B;  3TD4 A;  3LWQ C;  1H48 A;  5AVM A;  2HVY D;  3ZO8 A;  3S02 A;  1M90 H;  2I6D A;  1IV4 A;  3RA6 A;  3D01 A;  3M84 A;  2VGM A;  3C9U A;  3VI6 A;  2ZOD A;  1KC8 H;  4ZHW A;  5HY1 A;  3DC2 A;  5GAN K;  5B8F A;  2UYP A;  3K12 A;  3GYQ A;  5G4U C;  3B6N A;  3CC2 F;  1W59 A;  2LBT A;  1VK3 A;  4C82 A;  2UYN A;  3P10 A;  1IV1 A;  4X1Y A;  1RLG A;  1JFF B;  3F0G A;  4TV9 A;  1DT9 A;  5JCO C;  5EO3 A;  1VQ8 F;  2IAF A;  2KGW A;  2CZW A;  3KJK A;  4X20 A;  1VQL F;  1Z5V A;  3GTZ A;  2IQQ A;  3C9S A;  4ZHQ B;  4TUY A;  5DCV A;  1X25 A;  1QD9 A;  4C8G A;  2K1S A;  1YIT F;  4O4I A;  1CN7 A;  2Z1E A;  5GIP C;  4YJ3 A;  4X1K A;  4I4T B;  3S03 A; 
#chains in the Genus database with same CATH homology
 3ESJ A;  3ELC A;  3QHD A;  1IV1 A;  1W57 A;  1GX1 A;  3EOR A;  1H48 A;  1IV3 A;  3F0G A;  3FBA A;  4C81 A;  4C82 A;  1U40 A;  1IV4 A;  3F0E A;  1VHA A;  1H47 A;  3P10 A;  1U43 A;  3IKE A;  2GZL A;  2PMP A;  3FPI A;  4C8I A;  3K2X A;  1W55 A;  3ERN A;  3GHZ A;  3K14 A;  3KE1 A;  3P0Z A;  3IEW A;  2UZH A;  1U3P A;  5B8F A;  1KNJ A;  3F0D A;  1IV2 A;  3RE3 A;  3B6N A;  1YQN A;  3T80 A;  2AMT A;  3F6M A;  4C8E A;  4C8G A;  1JN1 A;  3JVH A;  1VH8 A;  1T0A A;  1U3L A;  3Q8H A;  1JY8 A;  1KNK A;  3F0F A;  3MBM A;  3IKF A;  3IEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...