4C8GA

Ispf (burkholderia cenocepacia) cmp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
153
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
total genus 51
structure length 153
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8gA00
1U3PA 1IV3A 1KNJA 1YQNA 3F0FA 3FBAA 1H47A 3Q8HA 2AMTA 1IV4A 3IEQA 3P0ZA 5B8FA 2PMPA 3P10A 1H48A 1T0AA 3EORA 3IKEA 4C82A 1W57A 1U3LA 4C8IA 3RE3A 3FPIA 3IEWA 3F0GA 1VH8A 1KNKA 3K14A 3ELCA 3KE1A 4C8GA 3B6NA 1GX1A 3JVHA 3F0DA 3ERNA 3IKFA 3F6MA 2GZLA 2UZHA 3F0EA 1JN1A 3GHZA 3QHDA 1IV1A 1W55A 3T80A 4C8EA 1JY8A 1U43A 3ESJA 4C81A 1IV2A 1U40A 3K2XA 3MBMA 1VHAA
chains in the Genus database with same CATH superfamily
2Q1YA 3JAWB 1JD1A 5IYZA 3NK7A 1R1MA 3J81M 4ZHQA 2Z1EA 1VH8A 2KG4A 4O2BB 2LCAA 4C8GA 4E6EA 1NJIH 4LNUB 2ZAUA 3ZP4A 3AGKA 3DC2A 1RA4A 3F0EA 1VQ7F 4ZI7B 4XCQA 2ALEA 1XV2A 2JNBA 5HY1A 4TV9A 3JASA 3P4EA 4X1KA 3LWRC 2RHHA 3OBWA 3N4YA 4G4WA 3MBMA 3F0FA 5J2TA 1Q7YH 1Q86H 2OHWA 4TV8A 2CSLA 3WJPA 4I55A 5EO3A 4O4HA 3JATB 4ZK7A 3NMUC 3CYPB 5GONA 1FFXA 1W5AA 3CG6A 3IR9A 3LWOC 3JAMM 5EZYB 2VXYA 3I55F 3FFMA 2CHTA 3ON1A 1TUBB 4X20A 3UT5A 4HNAB 1ONIA 2BTUA 5C8YB 3OONA 3Q8HA 5JVDB 3LWPC 4G4YA 1VQOF 3WGKA 5BMVA 5EB0A 3CCEF 3RYHA 3VMFB 3JVHA 2K1SA 3F0DA 3PLAC 3I7TA 4I4TB 2KGWA 4FFBA 1M90H 2HS3A 1UFYA 2HP0A 3RA6A 5IYZB 4O2BA 5HY2A 5FJ4C 4C8EA 1U43A 3CPQA 3CC7F 1CLIA 4R40B 4ZOLB 1X7PA 1X52A 3LYBA 3MCAB 4ZI7A 4BVTA 1RLUA 3EORA 3IMPA 3WGNA 1VQ5F 2YXZA 4O4IB 2YYEA 5KMGB 4G4XA 3JASB 1W2BF 3JARB 3PAFA 2I6DA 2HP3A 4BVSA 2PHNA 1QAHA 1VK3A 3BYQA 5HP8A 4TV8B 1CK2A 3I56F 4I55B 1YGYA 2LBWA 1VQ4F 3MQWA 3D54A 4O4JB 1FFXB 1VHAA 4ZHYB 4EB6B 4TZZA 4EI9A 1GZ0A 3V4DA 5JCOC 1YJ9F 1X25A 2FC3A 1YITF 3WPXA 3VTIC 2UYKA 2RHLA 3LDTA 2OTMA 4B62A 1JJ2F 3NK6A 4G4ZA 2GLZA 2ZVYA 4X20B 1Z5WA 3QHDA 3UT5B 5LOVA 1W55A 3CC4F 4BT3A 4IIJB 3HKEA 4O4LB 5HWEA 4I4TA 1N8RH 2MQEA 2BTQB 2VAPA 1RQ7A 2AMTA 1W42A 3VI6A 1FSZA 1W57A 3E1YA 3VCZA 4FFBB 2CWJA 3HKCA 4ZOLA 2HP0B 3IEWA 4BT4A 2CW4A 5GIPC 5G4VC 3SIVA 3IKFA 1VQKF 3GHZA 3GTZA 4O4IA 5KMGA 5HXUA 2KTUA 3K0TA 5KX5A 1VQNF 3JARA 5ITZB 4C81A 2AIZP 1IV3A 2H6LA 4X3MA 2EWCA 5A2QM 5IJ9A 4BT2A 1H7MA 5IJ0A 3J80M 5J2UA 3ZP7A 4ERHA 3RYCA 2CHSA 4U3JB 5HXZA 3RYIA 5MN6A 3M84A 1Q8RA 5HY4A 4O4JA 4BT7A 4BY9D 3OBYA 3R0PA 5CB4A 3KE1A 3D01A 4EB6A 3B6NA 1QD9A 2HS4A 2Z1UA 1GO0A 2UZHA 1IV1A 2R6R1 1VQLF 3KJKA 3KJJA 1ODEA 3U0OA 2BTOA 3CCMF 1W5FA 4BVRA 1IV2A 1FNKA 3HKBA 2RHOA 4IHJA 3FBAA 5EAZA 2PMPA 4IIJA 2LBTA 4O4LA 5LOVB 3E22A 1DBFA 1SDSA 1T0KB 1K9MH 3HKEB 5EIBC 3TD5A 3V7EA 3JAKA 1S72F 2QEXF 3CMAF 1VQ9F 3J7AR 2WALA 3N4ZA 5G4UC 4YJ2A 4G88A 1W40A 4B5CA 3O85A 2ZF8A 2I6RA 1FNJA 3ZOPA 3HKCB 1W59A 1H47A 3TD4A 5LP6A 2IAFA 3VYSC 1VQMF 3CD6F 3P10A 3MCQA 1H48A 3G71F 5GIOC 4C8IA 5ITZA 5LXTB 3CXCF 5EIBD 3LWQC 4EI8A 1YIJF 3C9RA 3ELCA 3NVIB 1VQ8F 5KX5B 4U3JA 3HAXD 1YI2F 3N2GB 5IJ0B 5IJ9B 3S06A 2V9YA 5J2UB 4LCKA 3RYCB 3CB2A 3RYIB 3L7QA 1JFFA 1NQ3A 1DT9A 4PWTA 2QA4F 5CB4B 2P6YA 2HS0A 5HY0A 3C9TA 1W581 4YJ3A 2DT4A 2NMUA 2CZWA 1KC8H 5EYPA 3CCQF 1COMA 1YJNF 3C8LA 3S0YA 3TD3A 5HP7A 5FNVA 2HX0A 4C4WC 3LMEA 2RHJA 3ERNA 3HKBB 1K8AH 4IHJB 4KWEA 1SZQA 2ZOVA 3CCVF 2UYJA 4B45A 5LA6B 3WPWA 2G9IA 3C9SA 3I3FA 3M1XA 1RLGA 2B33A 4O2AA 2AIFA 3DDNA 3E22B 2UYPA 5GINC 2ZODA 3HWUA 3JAKB 3VIUA 3FPIA 2VGMA 3JALA 3N2KA 4I50B 4YJ2B 1QU9A 1VQVA 2OTJF 3G6EF 1W3EX 4EI7A 1QVFF 4X3LA 1Z5VA 5LXTA 1XBIA 3VYUC 3WJQA 2VAMA 5LP6B 2F9ZC 3T80A 2HQSC 2FGYA 3CCRF 1X7OA 1TVKA 4WBNB 2OZBA 2RB9A 2OTLF 2GVIA 3N2GA 5JH7A 2BO1A 5IT9M 4C82A 3V7QA 3NVKE 5AVMA 1QVGF 2QI2A 3D00A 3WXMB 1CN7A 2L26A 1VQPF 3WGMA 3HKDB 1JFFB 5DCVA 1J7HA 1XHOA 4ZHWA 4G4VA 4B46A 4RHAA 1KD1H 4TUYA 5CA0A 4YJ3B 5MN5A 4DRXA 2UYNB 4ZHVA 5CA1A 5JQGB 1VQ6F 5EYPB 5GANK 2DYYA 2IQQA 5FNVB 3G4SF 3M4SA 1YJWF 5B8FA 3S02A 5LYJB 4NQ3A 2N48A 4NWOB 5LA6A 3S03A 1KQSF 4X1YB 5FLXM 1IPAA 3RYHB 1GX1A 2GZLA 1PF5A 3VYTC 2HRYA 1XRGA 2Z1FA 4O2AB 4I50A 3JCMM 3HJWC 1JY8A 1OFUA 1UI9A 1SA0A 4X1IB 3GYQA 3OW2F 4DXDA 3RA5A 3F0GA 1U3PA 4F6RA 3JALB 3N2KB 1K73H 5EB1B 3HTNA 3P0ZA 3IKEA 3LWVC 3VO8A 3FD5A 5LP6C 1W5BA 4WBNA 2VGNA 4U39A 1YHQF 3VOBA 3JAWA 1KNKA 3K14A 4BT6A 3RYFB 1TVKB 3CCJF 3SIUA 5JH7B 3QTYA 5EWRA 1NMUB 4NUTA 4LNUA 3S0WA 5GAPK 3CYQA 4ZHQB 3HKDA 3CCLF 3CPWF 2H8CA 1OAPA 3S0HA 3MDOA 1KNJA 2QTPA 3K12A 2CVLA 3V3TA 2HVYD 2R751 1M1KH 2H8EA 2UYNA 5JQGA 2W8BC 4TV9B 4X1KB 4BT5A 1RQ2A 4TUYB 1Q81H 5CA0B 4DRXB 3F6MA 3CCUF 3JATA 5LYJA 5CA1B 5J2TB 1JN1A 3C9UA 3KIZA 1GO1A 1W41A 3CC2F 1W5EA 4O4HB 4X1YA 5GONB 3WJRA 2Q1XA 5JCOA 5EZYA 4RQOA 1YQNA 3QUWA 2Z1TA 1E7KA 4M8IA 1IV4A 3IEQA 5MN4A 2ZVZA 1T0AA 1TUBA 1U3LA 3E20B 4X1IA 3RE3A 3LFOA 2HRUA 4HNAA 3FD6A 4BVQA 5C8YA 1PXWA 5JVDA 1ZWZA 3CMEF 3WGJA 1SA0B 3CCSF 3ZO8A 4BW0B 3VOAA 2VAWA 2IG8A 1Q82H 4F6RB 2Z01A 3RYFA 2LBXA 3ESJA 3KHNA 3WGLA 5BMVB 3K2XA 2KTVA 1U40A
chains in the Genus database with same CATH topology
1U3PA 1IV3A 1KNJA 1YQNA 3F0FA 3FBAA 1H47A 3Q8HA 2AMTA 1IV4A 3IEQA 3P0ZA 5B8FA 2PMPA 3P10A 1H48A 1T0AA 3EORA 3IKEA 4C82A 1W57A 1U3LA 4C8IA 3RE3A 3FPIA 3IEWA 3F0GA 1VH8A 1KNKA 3K14A 3ELCA 3KE1A 4C8GA 3B6NA 1GX1A 3JVHA 3F0DA 3ERNA 3IKFA 3F6MA 2GZLA 2UZHA 3F0EA 1JN1A 3GHZA 3QHDA 1IV1A 1W55A 3T80A 4C8EA 1JY8A 1U43A 3ESJA 4C81A 1IV2A 1U40A 3K2XA 3MBMA 1VHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3P A;  1IV3 A;  1KNJ A;  1YQN A;  3F0F A;  3FBA A;  1H47 A;  3Q8H A;  2AMT A;  1IV4 A;  3IEQ A;  3P0Z A;  5B8F A;  2PMP A;  3P10 A;  1H48 A;  1T0A A;  3EOR A;  3IKE A;  4C82 A;  1W57 A;  1U3L A;  4C8I A;  3RE3 A;  3FPI A;  3IEW A;  3F0G A;  1VH8 A;  1KNK A;  3K14 A;  3ELC A;  3KE1 A;  4C8G A;  3B6N A;  1GX1 A;  3JVH A;  3F0D A;  3ERN A;  3IKF A;  3F6M A;  2GZL A;  2UZH A;  3F0E A;  1JN1 A;  3GHZ A;  3QHD A;  1IV1 A;  1W55 A;  3T80 A;  4C8E A;  1JY8 A;  1U43 A;  3ESJ A;  4C81 A;  1IV2 A;  1U40 A;  3K2X A;  3MBM A;  1VHA A; 
#chains in the Genus database with same CATH topology
 2Q1Y A;  3JAW B;  1JD1 A;  5IYZ A;  3NK7 A;  1R1M A;  3J81 M;  4ZHQ A;  2Z1E A;  1VH8 A;  2KG4 A;  4O2B B;  2LCA A;  4C8G A;  4E6E A;  1NJI H;  4LNU B;  2ZAU A;  3ZP4 A;  3AGK A;  3DC2 A;  1RA4 A;  3F0E A;  1VQ7 F;  4ZI7 B;  4XCQ A;  2ALE A;  1XV2 A;  2JNB A;  5HY1 A;  4TV9 A;  3JAS A;  3P4E A;  4X1K A;  3LWR C;  2RHH A;  3OBW A;  3N4Y A;  4G4W A;  3MBM A;  3F0F A;  5J2T A;  1Q7Y H;  1Q86 H;  2OHW A;  4TV8 A;  2CSL A;  3WJP A;  4I55 A;  5EO3 A;  4O4H A;  3JAT B;  4ZK7 A;  3NMU C;  3CYP B;  5GON A;  1FFX A;  1W5A A;  3CG6 A;  3IR9 A;  3LWO C;  3JAM M;  5EZY B;  2VXY A;  3I55 F;  3FFM A;  2CHT A;  3ON1 A;  1TUB B;  4X20 A;  3UT5 A;  4HNA B;  1ONI A;  2BTU A;  5C8Y B;  3OON A;  3Q8H A;  5JVD B;  3LWP C;  4G4Y A;  1VQO F;  3WGK A;  5BMV A;  5EB0 A;  3CCE F;  3RYH A;  3VMF B;  3JVH A;  2K1S A;  3F0D A;  3PLA C;  3I7T A;  4I4T B;  2KGW A;  4FFB A;  1M90 H;  2HS3 A;  1UFY A;  2HP0 A;  3RA6 A;  5IYZ B;  4O2B A;  5HY2 A;  5FJ4 C;  4C8E A;  1U43 A;  3CPQ A;  3CC7 F;  1CLI A;  4R40 B;  4ZOL B;  1X7P A;  1X52 A;  3LYB A;  3MCA B;  4ZI7 A;  4BVT A;  1RLU A;  3EOR A;  3IMP A;  3WGN A;  1VQ5 F;  2YXZ A;  4O4I B;  2YYE A;  5KMG B;  4G4X A;  3JAS B;  1W2B F;  3JAR B;  3PAF A;  2I6D A;  2HP3 A;  4BVS A;  2PHN A;  1QAH A;  1VK3 A;  3BYQ A;  5HP8 A;  4TV8 B;  1CK2 A;  3I56 F;  4I55 B;  1YGY A;  2LBW A;  1VQ4 F;  3MQW A;  3D54 A;  4O4J B;  1FFX B;  1VHA A;  4ZHY B;  4EB6 B;  4TZZ A;  4EI9 A;  1GZ0 A;  3V4D A;  5JCO C;  1YJ9 F;  1X25 A;  2FC3 A;  1YIT F;  3WPX A;  3VTI C;  2UYK A;  2RHL A;  3LDT A;  2OTM A;  4B62 A;  1JJ2 F;  3NK6 A;  4G4Z A;  2GLZ A;  2ZVY A;  4X20 B;  1Z5W A;  3QHD A;  3UT5 B;  5LOV A;  1W55 A;  3CC4 F;  4BT3 A;  4IIJ B;  3HKE A;  4O4L B;  5HWE A;  4I4T A;  1N8R H;  2MQE A;  2BTQ B;  2VAP A;  1RQ7 A;  2AMT A;  1W42 A;  3VI6 A;  1FSZ A;  1W57 A;  3E1Y A;  3VCZ A;  4FFB B;  2CWJ A;  3HKC A;  4ZOL A;  2HP0 B;  3IEW A;  4BT4 A;  2CW4 A;  5GIP C;  5G4V C;  3SIV A;  3IKF A;  1VQK F;  3GHZ A;  3GTZ A;  4O4I A;  5KMG A;  5HXU A;  2KTU A;  3K0T A;  5KX5 A;  1VQN F;  3JAR A;  5ITZ B;  4C81 A;  2AIZ P;  1IV3 A;  2H6L A;  4X3M A;  2EWC A;  5A2Q M;  5IJ9 A;  4BT2 A;  1H7M A;  5IJ0 A;  3J80 M;  5J2U A;  3ZP7 A;  4ERH A;  3RYC A;  2CHS A;  4U3J B;  5HXZ A;  3RYI A;  5MN6 A;  3M84 A;  1Q8R A;  5HY4 A;  4O4J A;  4BT7 A;  4BY9 D;  3OBY A;  3R0P A;  5CB4 A;  3KE1 A;  3D01 A;  4EB6 A;  3B6N A;  1QD9 A;  2HS4 A;  2Z1U A;  1GO0 A;  2UZH A;  1IV1 A;  2R6R 1;  1VQL F;  3KJK A;  3KJJ A;  1ODE A;  3U0O A;  2BTO A;  3CCM F;  1W5F A;  4BVR A;  1IV2 A;  1FNK A;  3HKB A;  2RHO A;  4IHJ A;  3FBA A;  5EAZ A;  2PMP A;  4IIJ A;  2LBT A;  4O4L A;  5LOV B;  3E22 A;  1DBF A;  1SDS A;  1T0K B;  1K9M H;  3HKE B;  5EIB C;  3TD5 A;  3V7E A;  3JAK A;  1S72 F;  2QEX F;  3CMA F;  1VQ9 F;  3J7A R;  2WAL A;  3N4Z A;  5G4U C;  4YJ2 A;  4G88 A;  1W40 A;  4B5C A;  3O85 A;  2ZF8 A;  2I6R A;  1FNJ A;  3ZOP A;  3HKC B;  1W59 A;  1H47 A;  3TD4 A;  5LP6 A;  2IAF A;  3VYS C;  1VQM F;  3CD6 F;  3P10 A;  3MCQ A;  1H48 A;  3G71 F;  5GIO C;  4C8I A;  5ITZ A;  5LXT B;  3CXC F;  5EIB D;  3LWQ C;  4EI8 A;  1YIJ F;  3C9R A;  3ELC A;  3NVI B;  1VQ8 F;  5KX5 B;  4U3J A;  3HAX D;  1YI2 F;  3N2G B;  5IJ0 B;  5IJ9 B;  3S06 A;  2V9Y A;  5J2U B;  4LCK A;  3RYC B;  3CB2 A;  3RYI B;  3L7Q A;  1JFF A;  1NQ3 A;  1DT9 A;  4PWT A;  2QA4 F;  5CB4 B;  2P6Y A;  2HS0 A;  5HY0 A;  3C9T A;  1W58 1;  4YJ3 A;  2DT4 A;  2NMU A;  2CZW A;  1KC8 H;  5EYP A;  3CCQ F;  1COM A;  1YJN F;  3C8L A;  3S0Y A;  3TD3 A;  5HP7 A;  5FNV A;  2HX0 A;  4C4W C;  3LME A;  2RHJ A;  3ERN A;  3HKB B;  1K8A H;  4IHJ B;  4KWE A;  1SZQ A;  2ZOV A;  3CCV F;  2UYJ A;  4B45 A;  5LA6 B;  3WPW A;  2G9I A;  3C9S A;  3I3F A;  3M1X A;  1RLG A;  2B33 A;  4O2A A;  2AIF A;  3DDN A;  3E22 B;  2UYP A;  5GIN C;  2ZOD A;  3HWU A;  3JAK B;  3VIU A;  3FPI A;  2VGM A;  3JAL A;  3N2K A;  4I50 B;  4YJ2 B;  1QU9 A;  1VQV A;  2OTJ F;  3G6E F;  1W3E X;  4EI7 A;  1QVF F;  4X3L A;  1Z5V A;  5LXT A;  1XBI A;  3VYU C;  3WJQ A;  2VAM A;  5LP6 B;  2F9Z C;  3T80 A;  2HQS C;  2FGY A;  3CCR F;  1X7O A;  1TVK A;  4WBN B;  2OZB A;  2RB9 A;  2OTL F;  2GVI A;  3N2G A;  5JH7 A;  2BO1 A;  5IT9 M;  4C82 A;  3V7Q A;  3NVK E;  5AVM A;  1QVG F;  2QI2 A;  3D00 A;  3WXM B;  1CN7 A;  2L26 A;  1VQP F;  3WGM A;  3HKD B;  1JFF B;  5DCV A;  1J7H A;  1XHO A;  4ZHW A;  4G4V A;  4B46 A;  4RHA A;  1KD1 H;  4TUY A;  5CA0 A;  4YJ3 B;  5MN5 A;  4DRX A;  2UYN B;  4ZHV A;  5CA1 A;  5JQG B;  1VQ6 F;  5EYP B;  5GAN K;  2DYY A;  2IQQ A;  5FNV B;  3G4S F;  3M4S A;  1YJW F;  5B8F A;  3S02 A;  5LYJ B;  4NQ3 A;  2N48 A;  4NWO B;  5LA6 A;  3S03 A;  1KQS F;  4X1Y B;  5FLX M;  1IPA A;  3RYH B;  1GX1 A;  2GZL A;  1PF5 A;  3VYT C;  2HRY A;  1XRG A;  2Z1F A;  4O2A B;  4I50 A;  3JCM M;  3HJW C;  1JY8 A;  1OFU A;  1UI9 A;  1SA0 A;  4X1I B;  3GYQ A;  3OW2 F;  4DXD A;  3RA5 A;  3F0G A;  1U3P A;  4F6R A;  3JAL B;  3N2K B;  1K73 H;  5EB1 B;  3HTN A;  3P0Z A;  3IKE A;  3LWV C;  3VO8 A;  3FD5 A;  5LP6 C;  1W5B A;  4WBN A;  2VGN A;  4U39 A;  1YHQ F;  3VOB A;  3JAW A;  1KNK A;  3K14 A;  4BT6 A;  3RYF B;  1TVK B;  3CCJ F;  3SIU A;  5JH7 B;  3QTY A;  5EWR A;  1NMU B;  4NUT A;  4LNU A;  3S0W A;  5GAP K;  3CYQ A;  4ZHQ B;  3HKD A;  3CCL F;  3CPW F;  2H8C A;  1OAP A;  3S0H A;  3MDO A;  1KNJ A;  2QTP A;  3K12 A;  2CVL A;  3V3T A;  2HVY D;  2R75 1;  1M1K H;  2H8E A;  2UYN A;  5JQG A;  2W8B C;  4TV9 B;  4X1K B;  4BT5 A;  1RQ2 A;  4TUY B;  1Q81 H;  5CA0 B;  4DRX B;  3F6M A;  3CCU F;  3JAT A;  5LYJ A;  5CA1 B;  5J2T B;  1JN1 A;  3C9U A;  3KIZ A;  1GO1 A;  1W41 A;  3CC2 F;  1W5E A;  4O4H B;  4X1Y A;  5GON B;  3WJR A;  2Q1X A;  5JCO A;  5EZY A;  4RQO A;  1YQN A;  3QUW A;  2Z1T A;  1E7K A;  4M8I A;  1IV4 A;  3IEQ A;  5MN4 A;  2ZVZ A;  1T0A A;  1TUB A;  1U3L A;  3E20 B;  4X1I A;  3RE3 A;  3LFO A;  2HRU A;  4HNA A;  3FD6 A;  4BVQ A;  5C8Y A;  1PXW A;  5JVD A;  1ZWZ A;  3CME F;  3WGJ A;  1SA0 B;  3CCS F;  3ZO8 A;  4BW0 B;  3VOA A;  2VAW A;  2IG8 A;  1Q82 H;  4F6R B;  2Z01 A;  3RYF A;  2LBX A;  3ESJ A;  3KHN A;  3WGL A;  5BMV B;  3K2X A;  2KTV A;  1U40 A; 
#chains in the Genus database with same CATH homology
 1U3P A;  1IV3 A;  1KNJ A;  1YQN A;  3F0F A;  3FBA A;  1H47 A;  3Q8H A;  2AMT A;  1IV4 A;  3IEQ A;  3P0Z A;  5B8F A;  2PMP A;  3P10 A;  1H48 A;  1T0A A;  3EOR A;  3IKE A;  4C82 A;  1W57 A;  1U3L A;  4C8I A;  3RE3 A;  3FPI A;  3IEW A;  3F0G A;  1VH8 A;  1KNK A;  3K14 A;  3ELC A;  3KE1 A;  4C8G A;  3B6N A;  1GX1 A;  3JVH A;  3F0D A;  3ERN A;  3IKF A;  3F6M A;  2GZL A;  2UZH A;  3F0E A;  1JN1 A;  3GHZ A;  3QHD A;  1IV1 A;  1W55 A;  3T80 A;  4C8E A;  1JY8 A;  1U43 A;  3ESJ A;  4C81 A;  1IV2 A;  1U40 A;  3K2X A;  3MBM A;  1VHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...