1QD9A

Bacillus subtilis yabj
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
TKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGDIKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVIALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PURINE REGULATORY PROTEIN YABJ
publication title Crystal structure of Bacillus subtilis YabJ, a purine regulatory protein and member of the highly conserved YjgF family.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 35
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1qd9A00
2UYPA 1PF5A 3KJKA 5HP7A 1COMA 2CW4A 3QUWA 3K0TA 3V4DA 3D01A 2EWCA 3I3FA 4NWOB 1QAHA 2CWJA 3L7QA 1DBFA 3LYBA 4ZK7A 1JD1A 3ZOPA 2CHTA 1X25A 2OTMA 3GTZA 2UYJA 2DYYA 2CVLA 3ZP4A 1NQ3A 1ONIA 2UYNA 3R0PA 1QD9A 3K12A 1QU9A 2CSLA 1XRGA 3LMEA 3MQWA 3ZP7A 1J7HA 3ZO8A 1UI9A 1XHOA 2B33A 2UYKA 3M1XA 2CHSA 5HP8A 1FNKA 3KJJA 1UFYA 1ODEA 2IG8A 3M4SA 3VCZA 2UYNB 1FNJA 3I7TA
chains in the Genus database with same CATH superfamily
1U3LA 2GZLA 4O4HA 5EIBC 3WPWA 5C8YB 4X1YB 4ERHA 3DC2A 3JAWB 3UT5B 3OBYA 3N2GA 1Q81H 1YJ9F 2ZOVA 2ZODA 3ON1A 1KC8H 1ONIA 2HP0A 4ZI7B 3E1YA 2AIFA 4I4TB 3RYIA 5HXZA 2VGMA 4O4IB 1T0KB 1IV3A 3CYQA 3M1XA 5JQGA 3IMPA 2IG8A 3S0WA 4X1IB 2OHWA 3OBWA 5AVMA 5FLXM 3WGMA 3V7EA 2NMUA 3I56F 1COMA 5MN5A 1QVGF 1Z5WA 2BO1A 5GIPC 5ITZA 3QTYA 2JNBA 1U40A 3JASA 3FFMA 5LYJB 4C8IA 1JY8A 4O4HB 3HTNA 4O2AA 3N4ZA 3HKBA 1GZ0A 3N2GB 1XHOA 3MCAB 1H48A 3ESJA 3GHZA 5J2TA 1FNKA 5DCVA 4X1KA 3F0EA 5IJ9A 3CCEF 2HP0B 3D00A 1GO1A 1W42A 1E7KA 3RYIB 3C9RA 1PF5A 4ZHWA 5JQGB 4PWTA 1VQ4F 3LYBA 3FBAA 3LWVC 3CC4F 2CHTA 3WXMB 3V7QA 3VOBA 3MBMA 3TD4A 5ITZB 3CCJF 2CSLA 3JASB 3ZP7A 3CB2A 2UYKA 3HKEA 1YITF 3CCUF 3NVIB 2I6DA 1Z5VA 4O2AB 3VCZA 5A2QM 2VAWA 5GAPK 4B45A 5EWRA 1OAPA 3FPIA 2QI2A 3HKBB 4G88A 4BT6A 3SIUA 1H47A 4I55A 1RA4A 2HS4A 5HP7A 5EB1B 4BVRA 2YXZA 2L26A 3K14A 3D01A 3CCRF 5J2TB 1YQNA 2EWCA 2W8BC 4X1KB 5IJ9B 2LBXA 3F6MA 2UYJA 3JAMM 3LFOA 3CC7F 1VK3A 3S06A 4BT2A 1R1MA 3S03A 5KMGA 2FC3A 3ZO8A 1UI9A 5CA0A 1JFFA 4ZOLA 5LXTA 3CPQA 1W59A 3QHDA 3V3TA 1IV4A 1DT9A 3RE3A 3RYFA 3S0HA 1VQ7F 3LDTA 2UYPA 3VOAA 3HKEB 3QUWA 3K0TA 5EAZA 3RA5A 1IV1A 3RA6A 1RLGA 2HX0A 2Z1FA 4ZHYB 1S72F 2HRUA 4BVTA 4I55B 3GTZA 1QD9A 4IIJA 3OW2F 2VXYA 3ELCA 3JALA 5FNVA 5KX5A 3WGNA 4B46A 1SZQA 3C9TA 1FNJA 3I7TA 2H8CA 1VHAA 3TD3A 5KMGB 5CA0B 3C8LA 4RHAA 2RHJA 3V4DA 5JVDA 4C4WC 3CCQF 1JFFB 3FD5A 4ZOLB 5LXTB 3G6EF 4NWOB 1YI2F 3RYFB 2KG4A 5EO3A 5HY0A 1ZWZA 2HVYD 3MCQA 3CPWF 4I50A 3MQWA 3S02A 3OONA 3IEQA 2BTOA 4B5CA 1K73H 1VQ5F 4G4YA 4IIJB 3JALB 1TVKA 4F6RA 5FNVB 5KX5B 1Q86H 3GYQA 3SIVA 2PHNA 3VMFB 3U0OA 4ZK7A 1X25A 2DT4A 3RYHA 1FFXA 2N48A 4G4VA 5JVDB 4C8GA 2DYYA 2RHOA 5MN4A 3PLAC 5MN6A 1OFUA 2Z1EA 3N2KA 5J2UA 1J7HA 3B6NA 2RHLA 3VYTC 3MDOA 1UFYA 5JH7A 4TZZA 4TUYA 3NK7A 3E20B 2LCAA 4I50B 4O4LA 1GO0A 1H7MA 3JATA 1W5BA 1VQLF 3IKEA 1W41A 3L7QA 3F0FA 2LBTA 4KWEA 1T0AA 1YJNF 2RB9A 1KD1H 2ZAUA 1TVKB 1IV2A 4F6RB 1SDSA 5HWEA 5LP6A 2CVLA 5LP6C 1K8AH 5G4UC 5GINC 2GVIA 4G4WA 4BW0B 2AIZP 3RYHB 1FFXB 5EIBD 4C8EA 4EB6A 2Z1UA 1X52A 3N2KB 5J2UB 4ZHQA 1YGYA 5LOVA 3WJRA 4YJ2A 1VQNF 3JCMM 5JH7B 4TUYB 1Q82H 2VAMA 4O4LB 3C9UA 4EI7A 4ZHVA 2G9IA 3JATB 4RQOA 3JAKA 4NUTA 5GANK 1NQ3A 3LWRC 4YJ3A 2I6RA 1VQKF 5EZYA 1SA0A 2QEXF 1Q7YH 2RHHA 2CZWA 2H8EA 3KHNA 3CCSF 1W5AA 5LP6B 4BT5A 1RQ2A 1CLIA 3DDNA 3K2XA 4B62A 2CW4A 1YIJF 1YJWF 3I3FA 3CCMF 1QAHA 5HY2A 1DBFA 2Z1TA 4EB6B 4G4ZA 4HNAA 1XBIA 3CMAF 1JD1A 2QTPA 3WGKA 3CYPB 4C81A 4ZHQB 3HKCA 4BVSA 5LOVB 4YJ2B 4X20A 3KIZA 3R0PA 3VTIC 3HAXD 1VQVA 4O2BA 2R751 1W40A 2OTJF 2AMTA 5EYPA 2ZVZA 3AGKA 2K1SA 4G4XA 3WGJA 3JAKB 1NJIH 5IT9M 4LCKA 1KQSF 1TUBA 2HS3A 4YJ3B 5JCOA 5EZYB 4C82A 2Q1XA 1SA0B 2H6LA 5EB0A 5JCOC 5CA1A 1VQMF 2IQQA 1VQ9F 5CB4A 1W5FA 1VQOF 3IKFA 2HRYA 4X3LA 5GONA 3E22A 4M8IA 2KGWA 3J7AR 3NK6A 1JJ2F 4HNAB 4R40B 3HKCB 3CD6F 3WGLA 2HQSC 2ZVYA 5LA6A 2VAPA 4X20B 4BY9D 2VGNA 4O2BB 2F9ZC 5EYPB 3FD6A 1VQ8F 1XV2A 4WBNA 1W581 1RLUA 1TUBB 3WPXA 1W55A 4FFBA 1NMUB 3J80M 5CA1B 3CCLF 1FSZA 5CB4B 5HY1A 3K12A 3I55F 4U39A 5GONB 3LWQC 3CCVF 3E22B 3IEWA 3VIUA 4O4JA 2ZF8A 2UZHA 2Q1YA 2V9YA 3CMEF 1N8RH 1KNKA 2GLZA 4BVQA 1VQ6F 4U3JA 1M90H 1W5EA 3M84A 3G71F 1GX1A 5FJ4C 4EI8A 1M1KH 5LA6B 5B8FA 2CWJA 5IYZA 3D54A 3ZOPA 2OTMA 3IR9A 3LWPC 2P6YA 1VQPF 4WBNB 2QA4F 4TV9A 1W57A 1XRGA 1U3PA 3JARA 3Q8HA 1JN1A 2FGYA 4IHJA 3CC2F 4FFBB 2BTQB 3NMUC 2CHSA 4NQ3A 3T80A 5IJ0A 3KJJA 3M4SA 1ODEA 2OZBA 3P10A 5HY4A 3WJPA 4BT3A 3RYCA 2YYEA 3CXCF 5HXUA 3TD5A 2OTLF 4TV8A 4O4JB 3P4EA 3C9SA 2IAFA 4U3JB 2HS0A 2WALA 3O85A 3S0YA 3ZP4A 1X7PA 1X7OA 3WJQA 4DXDA 4LNUA 1QU9A 3LMEA 5IYZB 3VYUC 5BMVA 3P0ZA 4TV9B 3KE1A 2ALEA 1VH8A 1PXWA 3JARB 3PAFA 4IHJB 4DRXA 1W2BF 1QVFF 3KJKA 4BT7A 1CK2A 3EORA 3F0GA 5IJ0B 1YHQF 2HP3A 3JVHA 3HKDA 3RYCB 3BYQA 4E6EA 3J81M 4TV8B 2BTUA 2UYNA 3VO8A 4BT4A 2R6R1 1RQ7A 2LBWA 2MQEA 1Q8RA 1U43A 5GIOC 5HP8A 5C8YA 4X1YA 1W3EX 3LWOC 3JAWA 3HWUA 1K9MH 3UT5A 2Z01A 4LNUB 3NVKE 5G4VC 1KNJA 4XCQA 5BMVB 3VYSC 4ZI7A 4EI9A 4I4TA 3HJWC 1CN7A 4O4IA 4DRXB 3N4YA 4X1IA 3ERNA 2KTUA 3VI6A 3HKDB 2PMPA 3CG6A 4X3MA 3F0DA 3G4SF 2B33A 2UYNB 2KTVA 1IPAA 5LYJA
chains in the Genus database with same CATH topology
2UYPA 1PF5A 3KJKA 5HP7A 1COMA 2CW4A 3QUWA 3K0TA 3V4DA 3D01A 2EWCA 3I3FA 4NWOB 1QAHA 2CWJA 3L7QA 1DBFA 3LYBA 4ZK7A 1JD1A 3ZOPA 2CHTA 1X25A 2OTMA 3GTZA 2UYJA 2DYYA 2CVLA 3ZP4A 1NQ3A 1ONIA 2UYNA 3R0PA 1QD9A 3K12A 1QU9A 2CSLA 1XRGA 3LMEA 3MQWA 3ZP7A 1J7HA 3ZO8A 1UI9A 1XHOA 2B33A 2UYKA 3M1XA 2CHSA 5HP8A 1FNKA 3KJJA 1UFYA 1ODEA 2IG8A 3M4SA 3VCZA 2UYNB 1FNJA 3I7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYP A;  1PF5 A;  3KJK A;  5HP7 A;  1COM A;  2CW4 A;  3QUW A;  3K0T A;  3V4D A;  3D01 A;  2EWC A;  3I3F A;  4NWO B;  1QAH A;  2CWJ A;  3L7Q A;  1DBF A;  3LYB A;  4ZK7 A;  1JD1 A;  3ZOP A;  2CHT A;  1X25 A;  2OTM A;  3GTZ A;  2UYJ A;  2DYY A;  2CVL A;  3ZP4 A;  1NQ3 A;  1ONI A;  2UYN A;  3R0P A;  1QD9 A;  3K12 A;  1QU9 A;  2CSL A;  1XRG A;  3LME A;  3MQW A;  3ZP7 A;  1J7H A;  3ZO8 A;  1UI9 A;  1XHO A;  2B33 A;  2UYK A;  3M1X A;  2CHS A;  5HP8 A;  1FNK A;  3KJJ A;  1UFY A;  1ODE A;  2IG8 A;  3M4S A;  3VCZ A;  2UYN B;  1FNJ A;  3I7T A; 
#chains in the Genus database with same CATH topology
 1U3L A;  2GZL A;  4O4H A;  5EIB C;  3WPW A;  5C8Y B;  4X1Y B;  4ERH A;  3DC2 A;  3JAW B;  3UT5 B;  3OBY A;  3N2G A;  1Q81 H;  1YJ9 F;  2ZOV A;  2ZOD A;  3ON1 A;  1KC8 H;  1ONI A;  2HP0 A;  4ZI7 B;  3E1Y A;  2AIF A;  4I4T B;  3RYI A;  5HXZ A;  2VGM A;  4O4I B;  1T0K B;  1IV3 A;  3CYQ A;  3M1X A;  5JQG A;  3IMP A;  2IG8 A;  3S0W A;  4X1I B;  2OHW A;  3OBW A;  5AVM A;  5FLX M;  3WGM A;  3V7E A;  2NMU A;  3I56 F;  1COM A;  5MN5 A;  1QVG F;  1Z5W A;  2BO1 A;  5GIP C;  5ITZ A;  3QTY A;  2JNB A;  1U40 A;  3JAS A;  3FFM A;  5LYJ B;  4C8I A;  1JY8 A;  4O4H B;  3HTN A;  4O2A A;  3N4Z A;  3HKB A;  1GZ0 A;  3N2G B;  1XHO A;  3MCA B;  1H48 A;  3ESJ A;  3GHZ A;  5J2T A;  1FNK A;  5DCV A;  4X1K A;  3F0E A;  5IJ9 A;  3CCE F;  2HP0 B;  3D00 A;  1GO1 A;  1W42 A;  1E7K A;  3RYI B;  3C9R A;  1PF5 A;  4ZHW A;  5JQG B;  4PWT A;  1VQ4 F;  3LYB A;  3FBA A;  3LWV C;  3CC4 F;  2CHT A;  3WXM B;  3V7Q A;  3VOB A;  3MBM A;  3TD4 A;  5ITZ B;  3CCJ F;  2CSL A;  3JAS B;  3ZP7 A;  3CB2 A;  2UYK A;  3HKE A;  1YIT F;  3CCU F;  3NVI B;  2I6D A;  1Z5V A;  4O2A B;  3VCZ A;  5A2Q M;  2VAW A;  5GAP K;  4B45 A;  5EWR A;  1OAP A;  3FPI A;  2QI2 A;  3HKB B;  4G88 A;  4BT6 A;  3SIU A;  1H47 A;  4I55 A;  1RA4 A;  2HS4 A;  5HP7 A;  5EB1 B;  4BVR A;  2YXZ A;  2L26 A;  3K14 A;  3D01 A;  3CCR F;  5J2T B;  1YQN A;  2EWC A;  2W8B C;  4X1K B;  5IJ9 B;  2LBX A;  3F6M A;  2UYJ A;  3JAM M;  3LFO A;  3CC7 F;  1VK3 A;  3S06 A;  4BT2 A;  1R1M A;  3S03 A;  5KMG A;  2FC3 A;  3ZO8 A;  1UI9 A;  5CA0 A;  1JFF A;  4ZOL A;  5LXT A;  3CPQ A;  1W59 A;  3QHD A;  3V3T A;  1IV4 A;  1DT9 A;  3RE3 A;  3RYF A;  3S0H A;  1VQ7 F;  3LDT A;  2UYP A;  3VOA A;  3HKE B;  3QUW A;  3K0T A;  5EAZ A;  3RA5 A;  1IV1 A;  3RA6 A;  1RLG A;  2HX0 A;  2Z1F A;  4ZHY B;  1S72 F;  2HRU A;  4BVT A;  4I55 B;  3GTZ A;  1QD9 A;  4IIJ A;  3OW2 F;  2VXY A;  3ELC A;  3JAL A;  5FNV A;  5KX5 A;  3WGN A;  4B46 A;  1SZQ A;  3C9T A;  1FNJ A;  3I7T A;  2H8C A;  1VHA A;  3TD3 A;  5KMG B;  5CA0 B;  3C8L A;  4RHA A;  2RHJ A;  3V4D A;  5JVD A;  4C4W C;  3CCQ F;  1JFF B;  3FD5 A;  4ZOL B;  5LXT B;  3G6E F;  4NWO B;  1YI2 F;  3RYF B;  2KG4 A;  5EO3 A;  5HY0 A;  1ZWZ A;  2HVY D;  3MCQ A;  3CPW F;  4I50 A;  3MQW A;  3S02 A;  3OON A;  3IEQ A;  2BTO A;  4B5C A;  1K73 H;  1VQ5 F;  4G4Y A;  4IIJ B;  3JAL B;  1TVK A;  4F6R A;  5FNV B;  5KX5 B;  1Q86 H;  3GYQ A;  3SIV A;  2PHN A;  3VMF B;  3U0O A;  4ZK7 A;  1X25 A;  2DT4 A;  3RYH A;  1FFX A;  2N48 A;  4G4V A;  5JVD B;  4C8G A;  2DYY A;  2RHO A;  5MN4 A;  3PLA C;  5MN6 A;  1OFU A;  2Z1E A;  3N2K A;  5J2U A;  1J7H A;  3B6N A;  2RHL A;  3VYT C;  3MDO A;  1UFY A;  5JH7 A;  4TZZ A;  4TUY A;  3NK7 A;  3E20 B;  2LCA A;  4I50 B;  4O4L A;  1GO0 A;  1H7M A;  3JAT A;  1W5B A;  1VQL F;  3IKE A;  1W41 A;  3L7Q A;  3F0F A;  2LBT A;  4KWE A;  1T0A A;  1YJN F;  2RB9 A;  1KD1 H;  2ZAU A;  1TVK B;  1IV2 A;  4F6R B;  1SDS A;  5HWE A;  5LP6 A;  2CVL A;  5LP6 C;  1K8A H;  5G4U C;  5GIN C;  2GVI A;  4G4W A;  4BW0 B;  2AIZ P;  3RYH B;  1FFX B;  5EIB D;  4C8E A;  4EB6 A;  2Z1U A;  1X52 A;  3N2K B;  5J2U B;  4ZHQ A;  1YGY A;  5LOV A;  3WJR A;  4YJ2 A;  1VQN F;  3JCM M;  5JH7 B;  4TUY B;  1Q82 H;  2VAM A;  4O4L B;  3C9U A;  4EI7 A;  4ZHV A;  2G9I A;  3JAT B;  4RQO A;  3JAK A;  4NUT A;  5GAN K;  1NQ3 A;  3LWR C;  4YJ3 A;  2I6R A;  1VQK F;  5EZY A;  1SA0 A;  2QEX F;  1Q7Y H;  2RHH A;  2CZW A;  2H8E A;  3KHN A;  3CCS F;  1W5A A;  5LP6 B;  4BT5 A;  1RQ2 A;  1CLI A;  3DDN A;  3K2X A;  4B62 A;  2CW4 A;  1YIJ F;  1YJW F;  3I3F A;  3CCM F;  1QAH A;  5HY2 A;  1DBF A;  2Z1T A;  4EB6 B;  4G4Z A;  4HNA A;  1XBI A;  3CMA F;  1JD1 A;  2QTP A;  3WGK A;  3CYP B;  4C81 A;  4ZHQ B;  3HKC A;  4BVS A;  5LOV B;  4YJ2 B;  4X20 A;  3KIZ A;  3R0P A;  3VTI C;  3HAX D;  1VQV A;  4O2B A;  2R75 1;  1W40 A;  2OTJ F;  2AMT A;  5EYP A;  2ZVZ A;  3AGK A;  2K1S A;  4G4X A;  3WGJ A;  3JAK B;  1NJI H;  5IT9 M;  4LCK A;  1KQS F;  1TUB A;  2HS3 A;  4YJ3 B;  5JCO A;  5EZY B;  4C82 A;  2Q1X A;  1SA0 B;  2H6L A;  5EB0 A;  5JCO C;  5CA1 A;  1VQM F;  2IQQ A;  1VQ9 F;  5CB4 A;  1W5F A;  1VQO F;  3IKF A;  2HRY A;  4X3L A;  5GON A;  3E22 A;  4M8I A;  2KGW A;  3J7A R;  3NK6 A;  1JJ2 F;  4HNA B;  4R40 B;  3HKC B;  3CD6 F;  3WGL A;  2HQS C;  2ZVY A;  5LA6 A;  2VAP A;  4X20 B;  4BY9 D;  2VGN A;  4O2B B;  2F9Z C;  5EYP B;  3FD6 A;  1VQ8 F;  1XV2 A;  4WBN A;  1W58 1;  1RLU A;  1TUB B;  3WPX A;  1W55 A;  4FFB A;  1NMU B;  3J80 M;  5CA1 B;  3CCL F;  1FSZ A;  5CB4 B;  5HY1 A;  3K12 A;  3I55 F;  4U39 A;  5GON B;  3LWQ C;  3CCV F;  3E22 B;  3IEW A;  3VIU A;  4O4J A;  2ZF8 A;  2UZH A;  2Q1Y A;  2V9Y A;  3CME F;  1N8R H;  1KNK A;  2GLZ A;  4BVQ A;  1VQ6 F;  4U3J A;  1M90 H;  1W5E A;  3M84 A;  3G71 F;  1GX1 A;  5FJ4 C;  4EI8 A;  1M1K H;  5LA6 B;  5B8F A;  2CWJ A;  5IYZ A;  3D54 A;  3ZOP A;  2OTM A;  3IR9 A;  3LWP C;  2P6Y A;  1VQP F;  4WBN B;  2QA4 F;  4TV9 A;  1W57 A;  1XRG A;  1U3P A;  3JAR A;  3Q8H A;  1JN1 A;  2FGY A;  4IHJ A;  3CC2 F;  4FFB B;  2BTQ B;  3NMU C;  2CHS A;  4NQ3 A;  3T80 A;  5IJ0 A;  3KJJ A;  3M4S A;  1ODE A;  2OZB A;  3P10 A;  5HY4 A;  3WJP A;  4BT3 A;  3RYC A;  2YYE A;  3CXC F;  5HXU A;  3TD5 A;  2OTL F;  4TV8 A;  4O4J B;  3P4E A;  3C9S A;  2IAF A;  4U3J B;  2HS0 A;  2WAL A;  3O85 A;  3S0Y A;  3ZP4 A;  1X7P A;  1X7O A;  3WJQ A;  4DXD A;  4LNU A;  1QU9 A;  3LME A;  5IYZ B;  3VYU C;  5BMV A;  3P0Z A;  4TV9 B;  3KE1 A;  2ALE A;  1VH8 A;  1PXW A;  3JAR B;  3PAF A;  4IHJ B;  4DRX A;  1W2B F;  1QVF F;  3KJK A;  4BT7 A;  1CK2 A;  3EOR A;  3F0G A;  5IJ0 B;  1YHQ F;  2HP3 A;  3JVH A;  3HKD A;  3RYC B;  3BYQ A;  4E6E A;  3J81 M;  4TV8 B;  2BTU A;  2UYN A;  3VO8 A;  4BT4 A;  2R6R 1;  1RQ7 A;  2LBW A;  2MQE A;  1Q8R A;  1U43 A;  5GIO C;  5HP8 A;  5C8Y A;  4X1Y A;  1W3E X;  3LWO C;  3JAW A;  3HWU A;  1K9M H;  3UT5 A;  2Z01 A;  4LNU B;  3NVK E;  5G4V C;  1KNJ A;  4XCQ A;  5BMV B;  3VYS C;  4ZI7 A;  4EI9 A;  4I4T A;  3HJW C;  1CN7 A;  4O4I A;  4DRX B;  3N4Y A;  4X1I A;  3ERN A;  2KTU A;  3VI6 A;  3HKD B;  2PMP A;  3CG6 A;  4X3M A;  3F0D A;  3G4S F;  2B33 A;  2UYN B;  2KTV A;  1IPA A;  5LYJ A; 
#chains in the Genus database with same CATH homology
 2UYP A;  1PF5 A;  3KJK A;  5HP7 A;  1COM A;  2CW4 A;  3QUW A;  3K0T A;  3V4D A;  3D01 A;  2EWC A;  3I3F A;  4NWO B;  1QAH A;  2CWJ A;  3L7Q A;  1DBF A;  3LYB A;  4ZK7 A;  1JD1 A;  3ZOP A;  2CHT A;  1X25 A;  2OTM A;  3GTZ A;  2UYJ A;  2DYY A;  2CVL A;  3ZP4 A;  1NQ3 A;  1ONI A;  2UYN A;  3R0P A;  1QD9 A;  3K12 A;  1QU9 A;  2CSL A;  1XRG A;  3LME A;  3MQW A;  3ZP7 A;  1J7H A;  3ZO8 A;  1UI9 A;  1XHO A;  2B33 A;  2UYK A;  3M1X A;  2CHS A;  5HP8 A;  1FNK A;  3KJJ A;  1UFY A;  1ODE A;  2IG8 A;  3M4S A;  3VCZ A;  2UYN B;  1FNJ A;  3I7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...