1QD9A

Bacillus subtilis yabj
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
TKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGDIKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVIALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE REGULATORY PROTEIN YABJ
publication title Crystal structure of Bacillus subtilis YabJ, a purine regulatory protein and member of the highly conserved YjgF family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 35
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 1999-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1qd9A00
3KJKA 2CSLA 5HP8A 3ZP4A 1UI9A 3R0PA 3LMEA 4ZK7A 2CHSA 2B33A 1QD9A 3LYBA 2CWJA 3I3FA 1XHOA 2DYYA 2UYNA 3M1XA 2UYJA 3MQWA 1FNJA 3ZP7A 3K0TA 1XRGA 2CW4A 3K12A 1FNKA 4NWOB 1COMA 3ZOPA 1JD1A 5HP7A 1UFYA 1PF5A 3QUWA 1NQ3A 1QAHA 2IG8A 3ZO8A 1J7HA 1ODEA 2UYNB 3I7TA 3M4SA 1X25A 1ONIA 1QU9A 2UYPA 2EWCA 3KJJA 2UYKA 3V4DA 1DBFA 3D01A 3VCZA 2CHTA 2CVLA 3GTZA 2OTMA 3L7QA
chains in the Genus database with same CATH superfamily
2CSLA 2Z1TA 4BT6A 3CMEF 4X1YB 3E22A 2AIZP 3K14A 1XRGA 3WGMA 3J80M 3FD6A 2H8CA 4EI7A 3FBAA 3FPIA 1DT9A 5LXTA 1ODEA 1R1MA 3E22B 3HKDA 1KQSF 5DCVA 1SA0A 5CA1A 5C8YA 1H48A 3J81M 2LBWA 5IYZA 5FLXM 3IKFA 5LXTB 3OONA 1SA0B 2CHSA 2Z1UA 3PAFA 5C8YB 4ERHA 4R40B 5CA1B 3CXCF 1GO1A 3C9RA 3CC2F 3FFMA 4HNAA 5ITZA 1W5BA 5IYZB 3FD5A 3HTNA 3D00A 4O2BA 1UFYA 1PF5A 3RYCA 5GANK 2BTOA 3CCJF 4G4YA 5MN6A 2HP3A 3WGKA 5EIBC 1W581 3HWUA 1VQLF 3F6MA 4BVQA 4O2BB 5GONA 4NUTA 3RA6A 2CVLA 5KX5B 3DDNA 5KMGA 2V9YA 3ZP4A 3R0PA 3RA5A 3LMEA 3I56F 3B6NA 3UT5A 4BT3A 5EWRA 1KD1H 2UYJA 5GONB 2IAFA 1U40A 2HRUA 3LDTA 3VIUA 4O4HB 3CG6A 2CW4A 5KMGB 3N2KA 2WALA 4EB6A 1W2BF 3S02A 3EORA 3S0WA 2NMUA 3IR9A 1VQ4F 3UT5B 4X1IB 3I7TA 4C81A 1Z5VA 4U3JA 3N2KB 4EB6B 4I55A 5J2TA 2H8EA 5JCOC 4F6RA 3ON1A 3S06A 4EI8A 5G4VC 1OFUA 4U3JB 1M1KH 3MQWA 4I55B 5J2TB 2Q1YA 4B5CA 4BW0B 4ZHWA 3HAXD 3JAMM 3T80A 5G4UC 1COMA 1VQVA 5HP7A 4YJ3B 2QA4F 3WGJA 1RQ2A 2Z1FA 1PXWA 1SZQA 2FC3A 2AMTA 2H6LA 3WJQA 5LYJA 5FJ4C 1KC8H 3F0FA 5LOVA 4O2AA 3LWRC 2ZF8A 1SDSA 2CZWA 3CCEF 3V3TA 4DXDA 5HY1A 2ZVYA 3HKCA 3RYHA 3LWOC 3VTIC 2G9IA 3WPWA 5LYJB 3IEQA 4O2AB 1W57A 3TD5A 1CN7A 3P4EA 3JARA 1W59A 5GAPK 1KNJA 1ZWZA 2LBXA 4B46A 1IV2A 3HKCB 3RYHB 3WXMB 1CLIA 2HS0A 3CCRF 4X1KA 1VQKF 1E7KA 2UYPA 3V4DA 2Z01A 1DBFA 3WGLA 3LWVC 2RHLA 1TVKA 4X1KB 3CMAF 4G4VA 1RLGA 1VQ9F 3J7AR 1XHOA 3DC2A 5BMVA 3JVHA 3MBMA 4BT7A 1TVKB 1IPAA 2YYEA 5EYPA 5MN4A 3K12A 3OBYA 4O4IA 4WBNA 3OW2F 3PLAC 3QUWA 3LWQC 3N4YA 1T0AA 5BMVB 5EYPB 3KJJA 2PMPA 3SIUA 1W41A 4O4IB 2OTLF 4WBNB 3AGKA 3VO8A 2CHTA 5CA0A 3S03A 1VQ7F 3MCQA 4ZK7A 3HKDB 2FGYA 5HY0A 3I3FA 3G4SF 3GYQA 2KG4A 5CA0B 4TZZA 5J2UA 4XCQA 5AVMA 5JQGA 1QVFF 2OZBA 1KNKA 5IT9M 1J7HA 3S0YA 2ZODA 2RB9A 4HNAB 5J2UB 5ITZB 3JCMM 1VQPF 5JQGB 3VCZA 3CCVF 3RYCB 2GZLA 5HP8A 4IIJA 2HVYD 1GX1A 3CPQA 5JH7A 3CCMF 3U0OA 5HWEA 1U3LA 3N2GA 4IIJB 1W5AA 5JH7B 1W5EA 3V7EA 4PWTA 1RQ7A 1X25A 3K2XA 3N2GB 4I50A 3D01A 4BT2A 4EI9A 3L7QA 4ZHQA 1JFFA 1VHAA 1Q7YH 3RE3A 2YXZA 3VI6A 4ZHVA 4X20A 3ZP7A 1RA4A 2QI2A 5GIOC 1TUBA 4TV8A 4F6RB 2BO1A 4ZHQB 3P10A 3D54A 3WGNA 3RYIA 2AIFA 3C8LA 3KHNA 1Q82H 3CCUF 3JASA 4I4TA 2BTQB 1TUBB 4TV8B 2W8BC 2ZVZA 3RYIB 3CCQF 1YITF 2HQSC 2KTUA 3LWPC 5IJ0A 1FFXA 1Q86H 3I55F 3JASB 4I4TB 4KWEA 3JALA 3JAWA 2B33A 1QD9A 3IEWA 3KIZA 3N4ZA 1FNJA 4BT4A 3K0TA 2LCAA 5LOVB 3ELCA 5IJ0B 2QTPA 4ZOLA 3VOAA 1FFXB 4BT5A 1JD1A 1U3PA 3E1YA 3HKBA 3JALB 1VH8A 3JAWB 3CYQA 2VGMA 1RLUA 2QEXF 5HXZA 5CB4A 1W3EX 2L26A 3JARB 2IQQA 2GVIA 2UYKA 4ZHYB 4YJ2A 1XBIA 3BYQA 3HKBB 2I6RA 3F0EA 4B45A 2VAWA 1QVGF 1IV4A 5CB4B 3F0GA 4O4LA 3IKEA 5EIBD 5HXUA 1X7OA 3RYFA 3P0ZA 3LFOA 3O85A 4YJ2B 3VMFB 3VYTC 2GLZA 5A2QM 3QTYA 2DT4A 4BVSA 2F9ZC 2HP0A 5HY2A 1FSZA 4O4LB 2MQEA 1S72F 1Z5WA 3G71F 2N48A 2ZAUA 3JATA 3RYFB 1VK3A 4TV9A 4G88A 3KE1A 4DRXA 3GHZA 3Q8HA 4BY9D 5JVDA 3CB2A 3HKEA 2OTJF 4G4ZA 3CCLF 2OTMA 3JATB 1X7PA 3CD6F 4TV9B 1UI9A 5MN5A 2KTVA 4DRXB 2HX0A 2CWJA 5JVDB 4BVRA 5B8FA 1YJNF 2DYYA 3MDOA 3HKEB 3VYSC 4FFBA 4C8GA 2VXYA 5EB0A 4NQ3A 1QAHA 2HS4A 3VOBA 4G4XA 4C8IA 2UZHA 4LNUA 3IMPA 4FFBB 1QU9A 4IHJA 3CPWF 2EWCA 3CCSF 1H47A 1T0KB 5LP6A 4RQOA 3GTZA 3VYUC 2RHHA 1JJ2F 4LNUB 5EO3A 4IHJB 1CK2A 1W5FA 2R6R1 1VQMF 1VQOF 4U39A 1VQNF 4LCKA 5LP6B 1XV2A 2HRYA 4RHAA 5JCOA 2RHJA 5KX5A 5IJ9A 3G6EF 1VQ8F 1JY8A 1Q8RA 1YHQF 1OAPA 1NJIH 1ONIA 3NK7A 2Z1EA 2VGNA 4C82A 1IV1A 1Q81H 3ERNA 3C9TA 4O4HA 1YI2F 4C4WC 5IJ9B 3KJKA 3F0DA 4C8EA 1YGYA 3WJPA 3WPXA 1VQ6F 3LYBA 3C9SA 4X1IA 1M90H 2UYNA 2R751 4I50B 3NVIB 3JAKA 5GINC 5GIPC 5LP6C 3ESJA 1JN1A 2I6DA 4ZI7A 1W42A 1JFFB 2K1SA 2Q1XA 3MCAB 2ALEA 1K8AH 2VAPA 3TD4A 3ZO8A 2UYNB 1H7MA 3M4SA 3JAKB 4X20B 2LBTA 3V7QA 4ZI7B 3HJWC 3M84A 1U43A 3CC4F 3NVKE 4BVTA 4YJ3A 1W40A 4X3MA 5LA6A 1YIJF 2ZOVA 4G4WA 3ZOPA 5EZYA 2JNBA 3CYPB 1NQ3A 1GO0A 2OHWA 5LA6B 1VQ5F 2KGWA 3SIVA 1YQNA 4X3LA 4ZOLB 1K73H 5EZYB 5EB1B 1X52A 4O4JA 2HS3A 1YJ9F 2PHNA 3CC7F 1YJWF 4E6EA 4TUYA 4B62A 3S0HA 3M1XA 5HY4A 2P6YA 1W55A 4O4JB 1FNKA 3TD3A 3WJRA 5FNVA 4NWOB 2BTUA 1N8RH 1GZ0A 1NMUB 2IG8A 4TUYB 1K9MH 3E20B 1IV3A 3C9UA 3QHDA 5EAZA 5FNVB 2RHOA 4X1YA 2HP0B 3OBWA 3NK6A 2VAMA 4M8IA 3NMUC
chains in the Genus database with same CATH topology
3KJKA 2CSLA 5HP8A 3ZP4A 1UI9A 3R0PA 3LMEA 4ZK7A 2CHSA 2B33A 1QD9A 3LYBA 2CWJA 3I3FA 1XHOA 2DYYA 2UYNA 3M1XA 2UYJA 3MQWA 1FNJA 3ZP7A 3K0TA 1XRGA 2CW4A 3K12A 1FNKA 4NWOB 1COMA 3ZOPA 1JD1A 5HP7A 1UFYA 1PF5A 3QUWA 1NQ3A 1QAHA 2IG8A 3ZO8A 1J7HA 1ODEA 2UYNB 3I7TA 3M4SA 1X25A 1ONIA 1QU9A 2UYPA 2EWCA 3KJJA 2UYKA 3V4DA 1DBFA 3D01A 3VCZA 2CHTA 2CVLA 3GTZA 2OTMA 3L7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJK A;  2CSL A;  5HP8 A;  3ZP4 A;  1UI9 A;  3R0P A;  3LME A;  4ZK7 A;  2CHS A;  2B33 A;  1QD9 A;  3LYB A;  2CWJ A;  3I3F A;  1XHO A;  2DYY A;  2UYN A;  3M1X A;  2UYJ A;  3MQW A;  1FNJ A;  3ZP7 A;  3K0T A;  1XRG A;  2CW4 A;  3K12 A;  1FNK A;  4NWO B;  1COM A;  3ZOP A;  1JD1 A;  5HP7 A;  1UFY A;  1PF5 A;  3QUW A;  1NQ3 A;  1QAH A;  2IG8 A;  3ZO8 A;  1J7H A;  1ODE A;  2UYN B;  3I7T A;  3M4S A;  1X25 A;  1ONI A;  1QU9 A;  2UYP A;  2EWC A;  3KJJ A;  2UYK A;  3V4D A;  1DBF A;  3D01 A;  3VCZ A;  2CHT A;  2CVL A;  3GTZ A;  2OTM A;  3L7Q A; 
#chains in the Genus database with same CATH topology
 2CSL A;  2Z1T A;  4BT6 A;  3CME F;  4X1Y B;  3E22 A;  2AIZ P;  3K14 A;  1XRG A;  3WGM A;  3J80 M;  3FD6 A;  2H8C A;  4EI7 A;  3FBA A;  3FPI A;  1DT9 A;  5LXT A;  1ODE A;  1R1M A;  3E22 B;  3HKD A;  1KQS F;  5DCV A;  1SA0 A;  5CA1 A;  5C8Y A;  1H48 A;  3J81 M;  2LBW A;  5IYZ A;  5FLX M;  3IKF A;  5LXT B;  3OON A;  1SA0 B;  2CHS A;  2Z1U A;  3PAF A;  5C8Y B;  4ERH A;  4R40 B;  5CA1 B;  3CXC F;  1GO1 A;  3C9R A;  3CC2 F;  3FFM A;  4HNA A;  5ITZ A;  1W5B A;  5IYZ B;  3FD5 A;  3HTN A;  3D00 A;  4O2B A;  1UFY A;  1PF5 A;  3RYC A;  5GAN K;  2BTO A;  3CCJ F;  4G4Y A;  5MN6 A;  2HP3 A;  3WGK A;  5EIB C;  1W58 1;  3HWU A;  1VQL F;  3F6M A;  4BVQ A;  4O2B B;  5GON A;  4NUT A;  3RA6 A;  2CVL A;  5KX5 B;  3DDN A;  5KMG A;  2V9Y A;  3ZP4 A;  3R0P A;  3RA5 A;  3LME A;  3I56 F;  3B6N A;  3UT5 A;  4BT3 A;  5EWR A;  1KD1 H;  2UYJ A;  5GON B;  2IAF A;  1U40 A;  2HRU A;  3LDT A;  3VIU A;  4O4H B;  3CG6 A;  2CW4 A;  5KMG B;  3N2K A;  2WAL A;  4EB6 A;  1W2B F;  3S02 A;  3EOR A;  3S0W A;  2NMU A;  3IR9 A;  1VQ4 F;  3UT5 B;  4X1I B;  3I7T A;  4C81 A;  1Z5V A;  4U3J A;  3N2K B;  4EB6 B;  4I55 A;  5J2T A;  2H8E A;  5JCO C;  4F6R A;  3ON1 A;  3S06 A;  4EI8 A;  5G4V C;  1OFU A;  4U3J B;  1M1K H;  3MQW A;  4I55 B;  5J2T B;  2Q1Y A;  4B5C A;  4BW0 B;  4ZHW A;  3HAX D;  3JAM M;  3T80 A;  5G4U C;  1COM A;  1VQV A;  5HP7 A;  4YJ3 B;  2QA4 F;  3WGJ A;  1RQ2 A;  2Z1F A;  1PXW A;  1SZQ A;  2FC3 A;  2AMT A;  2H6L A;  3WJQ A;  5LYJ A;  5FJ4 C;  1KC8 H;  3F0F A;  5LOV A;  4O2A A;  3LWR C;  2ZF8 A;  1SDS A;  2CZW A;  3CCE F;  3V3T A;  4DXD A;  5HY1 A;  2ZVY A;  3HKC A;  3RYH A;  3LWO C;  3VTI C;  2G9I A;  3WPW A;  5LYJ B;  3IEQ A;  4O2A B;  1W57 A;  3TD5 A;  1CN7 A;  3P4E A;  3JAR A;  1W59 A;  5GAP K;  1KNJ A;  1ZWZ A;  2LBX A;  4B46 A;  1IV2 A;  3HKC B;  3RYH B;  3WXM B;  1CLI A;  2HS0 A;  3CCR F;  4X1K A;  1VQK F;  1E7K A;  2UYP A;  3V4D A;  2Z01 A;  1DBF A;  3WGL A;  3LWV C;  2RHL A;  1TVK A;  4X1K B;  3CMA F;  4G4V A;  1RLG A;  1VQ9 F;  3J7A R;  1XHO A;  3DC2 A;  5BMV A;  3JVH A;  3MBM A;  4BT7 A;  1TVK B;  1IPA A;  2YYE A;  5EYP A;  5MN4 A;  3K12 A;  3OBY A;  4O4I A;  4WBN A;  3OW2 F;  3PLA C;  3QUW A;  3LWQ C;  3N4Y A;  1T0A A;  5BMV B;  5EYP B;  3KJJ A;  2PMP A;  3SIU A;  1W41 A;  4O4I B;  2OTL F;  4WBN B;  3AGK A;  3VO8 A;  2CHT A;  5CA0 A;  3S03 A;  1VQ7 F;  3MCQ A;  4ZK7 A;  3HKD B;  2FGY A;  5HY0 A;  3I3F A;  3G4S F;  3GYQ A;  2KG4 A;  5CA0 B;  4TZZ A;  5J2U A;  4XCQ A;  5AVM A;  5JQG A;  1QVF F;  2OZB A;  1KNK A;  5IT9 M;  1J7H A;  3S0Y A;  2ZOD A;  2RB9 A;  4HNA B;  5J2U B;  5ITZ B;  3JCM M;  1VQP F;  5JQG B;  3VCZ A;  3CCV F;  3RYC B;  2GZL A;  5HP8 A;  4IIJ A;  2HVY D;  1GX1 A;  3CPQ A;  5JH7 A;  3CCM F;  3U0O A;  5HWE A;  1U3L A;  3N2G A;  4IIJ B;  1W5A A;  5JH7 B;  1W5E A;  3V7E A;  4PWT A;  1RQ7 A;  1X25 A;  3K2X A;  3N2G B;  4I50 A;  3D01 A;  4BT2 A;  4EI9 A;  3L7Q A;  4ZHQ A;  1JFF A;  1VHA A;  1Q7Y H;  3RE3 A;  2YXZ A;  3VI6 A;  4ZHV A;  4X20 A;  3ZP7 A;  1RA4 A;  2QI2 A;  5GIO C;  1TUB A;  4TV8 A;  4F6R B;  2BO1 A;  4ZHQ B;  3P10 A;  3D54 A;  3WGN A;  3RYI A;  2AIF A;  3C8L A;  3KHN A;  1Q82 H;  3CCU F;  3JAS A;  4I4T A;  2BTQ B;  1TUB B;  4TV8 B;  2W8B C;  2ZVZ A;  3RYI B;  3CCQ F;  1YIT F;  2HQS C;  2KTU A;  3LWP C;  5IJ0 A;  1FFX A;  1Q86 H;  3I55 F;  3JAS B;  4I4T B;  4KWE A;  3JAL A;  3JAW A;  2B33 A;  1QD9 A;  3IEW A;  3KIZ A;  3N4Z A;  1FNJ A;  4BT4 A;  3K0T A;  2LCA A;  5LOV B;  3ELC A;  5IJ0 B;  2QTP A;  4ZOL A;  3VOA A;  1FFX B;  4BT5 A;  1JD1 A;  1U3P A;  3E1Y A;  3HKB A;  3JAL B;  1VH8 A;  3JAW B;  3CYQ A;  2VGM A;  1RLU A;  2QEX F;  5HXZ A;  5CB4 A;  1W3E X;  2L26 A;  3JAR B;  2IQQ A;  2GVI A;  2UYK A;  4ZHY B;  4YJ2 A;  1XBI A;  3BYQ A;  3HKB B;  2I6R A;  3F0E A;  4B45 A;  2VAW A;  1QVG F;  1IV4 A;  5CB4 B;  3F0G A;  4O4L A;  3IKE A;  5EIB D;  5HXU A;  1X7O A;  3RYF A;  3P0Z A;  3LFO A;  3O85 A;  4YJ2 B;  3VMF B;  3VYT C;  2GLZ A;  5A2Q M;  3QTY A;  2DT4 A;  4BVS A;  2F9Z C;  2HP0 A;  5HY2 A;  1FSZ A;  4O4L B;  2MQE A;  1S72 F;  1Z5W A;  3G71 F;  2N48 A;  2ZAU A;  3JAT A;  3RYF B;  1VK3 A;  4TV9 A;  4G88 A;  3KE1 A;  4DRX A;  3GHZ A;  3Q8H A;  4BY9 D;  5JVD A;  3CB2 A;  3HKE A;  2OTJ F;  4G4Z A;  3CCL F;  2OTM A;  3JAT B;  1X7P A;  3CD6 F;  4TV9 B;  1UI9 A;  5MN5 A;  2KTV A;  4DRX B;  2HX0 A;  2CWJ A;  5JVD B;  4BVR A;  5B8F A;  1YJN F;  2DYY A;  3MDO A;  3HKE B;  3VYS C;  4FFB A;  4C8G A;  2VXY A;  5EB0 A;  4NQ3 A;  1QAH A;  2HS4 A;  3VOB A;  4G4X A;  4C8I A;  2UZH A;  4LNU A;  3IMP A;  4FFB B;  1QU9 A;  4IHJ A;  3CPW F;  2EWC A;  3CCS F;  1H47 A;  1T0K B;  5LP6 A;  4RQO A;  3GTZ A;  3VYU C;  2RHH A;  1JJ2 F;  4LNU B;  5EO3 A;  4IHJ B;  1CK2 A;  1W5F A;  2R6R 1;  1VQM F;  1VQO F;  4U39 A;  1VQN F;  4LCK A;  5LP6 B;  1XV2 A;  2HRY A;  4RHA A;  5JCO A;  2RHJ A;  5KX5 A;  5IJ9 A;  3G6E F;  1VQ8 F;  1JY8 A;  1Q8R A;  1YHQ F;  1OAP A;  1NJI H;  1ONI A;  3NK7 A;  2Z1E A;  2VGN A;  4C82 A;  1IV1 A;  1Q81 H;  3ERN A;  3C9T A;  4O4H A;  1YI2 F;  4C4W C;  5IJ9 B;  3KJK A;  3F0D A;  4C8E A;  1YGY A;  3WJP A;  3WPX A;  1VQ6 F;  3LYB A;  3C9S A;  4X1I A;  1M90 H;  2UYN A;  2R75 1;  4I50 B;  3NVI B;  3JAK A;  5GIN C;  5GIP C;  5LP6 C;  3ESJ A;  1JN1 A;  2I6D A;  4ZI7 A;  1W42 A;  1JFF B;  2K1S A;  2Q1X A;  3MCA B;  2ALE A;  1K8A H;  2VAP A;  3TD4 A;  3ZO8 A;  2UYN B;  1H7M A;  3M4S A;  3JAK B;  4X20 B;  2LBT A;  3V7Q A;  4ZI7 B;  3HJW C;  3M84 A;  1U43 A;  3CC4 F;  3NVK E;  4BVT A;  4YJ3 A;  1W40 A;  4X3M A;  5LA6 A;  1YIJ F;  2ZOV A;  4G4W A;  3ZOP A;  5EZY A;  2JNB A;  3CYP B;  1NQ3 A;  1GO0 A;  2OHW A;  5LA6 B;  1VQ5 F;  2KGW A;  3SIV A;  1YQN A;  4X3L A;  4ZOL B;  1K73 H;  5EZY B;  5EB1 B;  1X52 A;  4O4J A;  2HS3 A;  1YJ9 F;  2PHN A;  3CC7 F;  1YJW F;  4E6E A;  4TUY A;  4B62 A;  3S0H A;  3M1X A;  5HY4 A;  2P6Y A;  1W55 A;  4O4J B;  1FNK A;  3TD3 A;  3WJR A;  5FNV A;  4NWO B;  2BTU A;  1N8R H;  1GZ0 A;  1NMU B;  2IG8 A;  4TUY B;  1K9M H;  3E20 B;  1IV3 A;  3C9U A;  3QHD A;  5EAZ A;  5FNV B;  2RHO A;  4X1Y A;  2HP0 B;  3OBW A;  3NK6 A;  2VAM A;  4M8I A;  3NMU C; 
#chains in the Genus database with same CATH homology
 3KJK A;  2CSL A;  5HP8 A;  3ZP4 A;  1UI9 A;  3R0P A;  3LME A;  4ZK7 A;  2CHS A;  2B33 A;  1QD9 A;  3LYB A;  2CWJ A;  3I3F A;  1XHO A;  2DYY A;  2UYN A;  3M1X A;  2UYJ A;  3MQW A;  1FNJ A;  3ZP7 A;  3K0T A;  1XRG A;  2CW4 A;  3K12 A;  1FNK A;  4NWO B;  1COM A;  3ZOP A;  1JD1 A;  5HP7 A;  1UFY A;  1PF5 A;  3QUW A;  1NQ3 A;  1QAH A;  2IG8 A;  3ZO8 A;  1J7H A;  1ODE A;  2UYN B;  3I7T A;  3M4S A;  1X25 A;  1ONI A;  1QU9 A;  2UYP A;  2EWC A;  3KJJ A;  2UYK A;  3V4D A;  1DBF A;  3D01 A;  3VCZ A;  2CHT A;  2CVL A;  3GTZ A;  2OTM A;  3L7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...