1NJIH

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1njiH00
3E1YA 2VGMA 3OBWA 1KD1H 3HJWC 1GO1A 3CMEF 2OZBA 1RA4A 2LBWA 2FC3A 5GAPK 5FLXM 3CPWF 2OTLF 1SDSA 3CG6A 1VQLF 3CXCF 3O85A 1YHQF 1KQSF 2WALA 4BW0B 3LWPC 3LWQC 3LWOC 3CMAF 1Q82H 3CCMF 1IPAA 3WXMB 1CN7A 3J81M 3CCUF 1W41A 3NMUC 3N4ZA 3PAFA 3V7QA 5EO3A 1VQNF 5G4UC 1VQ4F 5FJ4C 1H7MA 2KG4A 1K8AH 5DCVA 3V7EA 1YJWF 1M1KH 2LBXA 2OTJF 1DT9A 3PLAC 3JAMM 4X3LA 1VQ7F 3AGKA 4BY9D 2I6DA 3CCQF 3HAXD 1E7KA 3N4YA 3J80M 3LFOA 3IR9A 1XBIA 1X52A 3CCEF 3GYQA 3CC2F 1Q7YH 1CK2A 1VQPF 5EWRA 3VMFB 1PXWA 1W40A 3LWRC 1JJ2F 5IT9M 5GIPC 1GO0A 1NMUB 3SIVA 1GZ0A 3SIUA 2QI2A 1VQ8F 3CCRF 1QVGF 3JCMM 3G71F 3RA5A 3OW2F 3CC7F 3I56F 1X7PA 4LCKA 3CCLF 4NUTA 3CCSF 1VQ5F 3CCJF 3G4SF 1W42A 3NK7A 4TZZA 3MCAB 1RLGA 3NVKE 3RA6A 3LWVC 5GANK 2BO1A 3CPQA 1YI2F 1VQ9F 1T0KB 1N8RH 1K9MH 1W3EX 2JNBA 1VQKF 3CC4F 1ZWZA 1Q81H 2OHWA 3VI6A 1S72F 3G6EF 1K73H 3J7AR 1YJNF 1VQ6F 1Q86H 4X3MA 5GINC 1VQMF 2CZWA 1QVFF 2AIFA 2VGNA 1YITF 2KTVA 1NJIH 1M90H 2QEXF 3CCVF 3FFMA 5A2QM 3I55F 5GIOC 2KTUA 3E20B 1VQOF 3CD6F 2HVYD 4C4WC 1YJ9F 3NVIB 3ON1A 2ALEA 1YIJF 1KC8H 2QA4F 3NK6A 1W2BF 1X7OA 5G4VC 3OBYA
chains in the Genus database with same CATH superfamily
2OTMA 4X1YA 3CYPB 1SA0B 3WGJA 4X1KA 5BMVB 1GO1A 4TV8A 3RYHB 3Q8HA 2ZF8A 2RHHA 3FBAA 1Q8RA 2HRUA 3IMPA 5GAPK 4G4VA 5FLXM 1SDSA 2EWCA 3F0FA 3CG6A 2DT4A 2WALA 1U3PA 4O4IB 2LCAA 4FFBA 5KX5A 4YJ3B 1OFUA 3LWOC 3CMAF 1FFXA 2GVIA 3CCMF 1TUBB 1W41A 2RHJA 1VQNF 1JY8A 2RHLA 5G4UC 5CA0B 2LBXA 4ZK7A 4YJ2A 3JAMM 4I55A 3WJQA 5IYZA 1E7KA 3N2GA 3N4YA 3LFOA 3T80A 4BVSA 2Z1FA 5J2UA 3IR9A 4O4LA 1XBIA 2CW4A 3VCZA 2VXYA 5EZYB 3F0GA 5EWRA 4WBNA 5HP7A 4O4HA 5KMGB 5GIPC 3GHZA 1NMUB 3QUWA 5C8YB 4I4TA 4BT4A 1GZ0A 4DXDA 2QI2A 5MN6A 1VQ8F 3S02A 4X20A 3VIUA 2N48A 3JAWB 3RA5A 4ZOLB 3EORA 2BTOA 4R40B 2HP0A 4EI7A 3CCJF 2RB9A 3G4SF 3NK7A 5IJ9A 3UT5A 3RYFB 5GANK 1N8RH 3HKEB 4B45A 5IJ0B 1IV2A 2PHNA 3D00A 1VQKF 2H8CA 2V9YA 4C82A 1XHOA 3F6MA 2OHWA 1Q81H 1K73H 3G6EF 2VAPA 3E22A 3HKBA 3LYBA 3HWUA 5LXTB 1Q86H 4X3MA 1X25A 5GINC 4HNAB 2CZWA 3ZP4A 5JH7B 2PMPA 3FFMA 2IAFA 2KTUA 1RLUA 5LA6A 3JATA 3RYCA 4O2BB 3CD6F 5LP6C 3HKDB 2ALEA 2CWJA 3C9TA 5LP6A 3CYQA 1X7OA 5G4VC 4IHJA 3E1YA 2VGMA 3JVHA 4XCQA 3HJWC 3S0WA 3I3FA 1TVKA 1FNKA 4O4JA 1W5EA 1IV4A 5EYPB 4X1YB 1QAHA 3F0DA 2AMTA 1RA4A 5HXUA 4X1KB 3DDNA 4TV8B 3JARA 1SZQA 2AIZP 2ZVZA 3TD4A 3GTZA 2Q1XA 2VAWA 1VQLF 3CXCF 4G4WA 4I50A 1YHQF 3WJRA 3LWPC 3ESJA 2I6RA 5HWEA 1IPAA 3WXMB 2FGYA 3J81M 3CCUF 4FFBB 5KX5B 3NMUC 3N4ZA 1FFXB 3V3TA 3PAFA 2CHTA 3OONA 4B46A 3LMEA 3HKCA 4KWEA 1M1KH 5EB1B 4X3LA 5HY0A 4BY9D 2I6DA 3CCQF 4YJ2B 3S0YA 5LYJA 3JAKA 1XRGA 3JALA 3WGLA 5LOVA 3R0PA 4I55B 5IYZB 2MQEA 3C9RA 3N2GB 3CCEF 3ZP7A 3C9SA 3CC2F 5J2UB 1VQPF 4O4LB 3VMFB 5JCOC 3M84A 2CSLA 1W40A 1JJ2F 1GO0A 3SIVA 2HS4A 4WBNB 4DRXA 5MN5A 3CCRF 1COMA 4O4HB 3D01A 3OW2F 3CC7F 5J2TA 2BTQB 1KNKA 4I4TB 5EAZA 5JVDA 2YXZA 4LCKA 3CCLF 3P10A 4X20B 1VQ5F 3TD5A 1U40A 2Z1EA 1JFFA 5ITZA 3MCAB 3VYUC 3RA6A 3LWVC 2BO1A 2HP0B 1YI2F 1FSZA 3MBMA 1VQ9F 1T0KB 4ZHVA 2Z01A 1YGYA 5IJ9B 3UT5B 3CC4F 3VI6A 1DBFA 1IV1A 3VOBA 4BT6A 3C8LA 1W55A 2AIFA 2VGNA 1YITF 1QVFF 3VOAA 3E22B 3HKBB 1KNJA 5A2QM 3S06A 1VK3A 1ONIA 3M4SA 4BT7A 1VQOF 2HS3A 3WGMA 4EI9A 4O2AA 4C4WC 3MCQA 5LA6B 3JATB 2QA4F 2Z1UA 3RYCB 4TV9A 3NK6A 3ELCA 3IKEA 5AVMA 3OBYA 1IV3A 3OBWA 2DYYA 4G4ZA 5LP6B 2Q1YA 4EB6A 2K1SA 1QD9A 2OZBA 4IHJB 1T0AA 3M1XA 1TVKB 2FC3A 4O4JB 3CPWF 4ZI7A 1VQVA 4B5CA 2UYJA 1W57A 1KQSF 3JARB 3U0OA 3CB2A 1VH8A 4I50B 5GONA 1CN7A 3KE1A 1OAPA 1W5FA 3V7QA 5CB4A 1QU9A 4ERHA 5FJ4C 1H7MA 5DCVA 5EIBC 2R6R1 2YYEA 1K8AH 3VYSC 3FPIA 1YJWF 3MDOA 2OTJF 1VQ7F 1YQNA 1CLIA 3AGKA 4X1IA 4EI8A 2ZODA 3HKCB 4LNUA 3HAXD 1W581 3F0EA 1NQ3A 4BVQA 1FNJA 2GZLA 1RQ2A 2L26A 4NWOB 3LDTA 1U43A 3WPXA 5LYJB 3JAKB 4E6EA 3JALB 3GYQA 1Q7YH 5LOVB 1CK2A 4BVRA 2HX0A 3ERNA 4IIJA 3LWRC 5IT9M 5FNVA 4TUYA 2W8BC 3FD6A 4RHAA 5CA1A 2HRYA 2RHOA 4F6RA 5HXZA 3JCMM 3G71F 5HP8A 3I56F 3HTNA 4NUTA 4DRXB 5MN4A 5HY2A 5J2TB 3KJKA 4M8IA 5JVDB 1RLGA 1VHAA 3JASA 3RE3A 4U3JA 3VYTC 4ZHYB 1W3EX 1JFFB 3N2KA 5EIBD 1PF5A 3RYIA 3FD5A 5ITZB 2CHSA 3S03A 1GX1A 2UYNA 3J7AR 5JQGA 3S0HA 5JCOA 4ZHQA 1W59A 4C81A 3KHNA 1VQMF 1W5BA 3L7QA 1NJIH 5HY4A 3KIZA 1JN1A 1Z5VA 1J7HA 3I55F 5GIOC 3E20B 3K12A 5HY1A 2HQSC 2HVYD 1Z5WA 1YIJF 1KC8H 1SA0A 3ZO8A 3IEWA 4BVTA 5BMVA 3K14A 4O2AB 3RYHA 3B6NA 1KD1H 2F9ZC 4TV9B 1XV2A 4RQOA 3IKFA 3CMEF 5EB0A 3D54A 4B62A 3V4DA 3TD3A 4BT5A 4EB6B 2HP3A 1R1MA 2LBWA 4O4IA 3C9UA 2OTLF 4YJ3A 2UYPA 3O85A 3QTYA 1TUBA 4BW0B 4BT3A 4ZI7B 3K2XA 2LBTA 3LWQC 3WPWA 1Q82H 2BTUA 4G88A 4BT2A 2UZHA 5CA0A 5EO3A 4U39A 3QHDA 5GONB 1H47A 1VQ4F 1H48A 2KG4A 3V7EA 1U3LA 5CB4B 1DT9A 3PLAC 3IEQA 4G4YA 4C8GA 2IG8A 2ZOVA 5EZYA 4X1IB 3J80M 1UI9A 4LNUB 2CVLA 4PWTA 5B8FA 1X52A 5KMGA 2VAMA 3WGNA 4C8IA 2ZVYA 2H6LA 3K0TA 5C8YA 2P6YA 4C8EA 1PXWA 2ZAUA 3JAWA 3WGKA 4ZOLA 2KGWA 3SIUA 4NQ3A 1QVGF 4IIJB 5FNVB 4TUYB 5CA1B 2R751 3WJPA 1X7PA 4F6RB 3RYFA 3CCSF 4ZHWA 4G4XA 2QTPA 3HKEA 1W42A 5IJ0A 1UFYA 4TZZA 3BYQA 3NVKE 3ZOPA 2H8EA 3CPQA 2G9IA 2GLZA 1ODEA 1K9MH 5LXTA 2JNBA 4HNAA 1ZWZA 3JASB 1W5AA 2B33A 5JH7A 4U3JB 1S72F 3N2KB 3P0ZA 3P4EA 3RYIB 1YJNF 1VQ6F 1JD1A 3I7TA 2KTVA 2Z1TA 4O2BA 2UYNB 2QEXF 2NMUA 5JQGB 3CCVF 4ZHQB 3HKDA 3MQWA 1RQ7A 3VTIC 3DC2A 1YJ9F 3NVIB 3ON1A 2IQQA 2UYKA 2HS0A 1W2BF 3VO8A 5EYPA 3KJJA 1M90H
chains in the Genus database with same CATH topology
3E1YA 2VGMA 3OBWA 1KD1H 4XCQA 2F9ZC 3HJWC 1GO1A 3CMEF 2OZBA 1RA4A 5HXUA 2LBWA 2FC3A 5GAPK 5FLXM 3CPWF 2OTLF 1SDSA 3CG6A 1VQLF 3CXCF 3O85A 1YHQF 1KQSF 2WALA 4BW0B 3LWPC 3LWQC 3LWOC 3CMAF 1Q82H 3CCMF 5HWEA 1IPAA 3WXMB 1CN7A 2FGYA 3J81M 3CCUF 1W41A 3NMUC 3N4ZA 3V3TA 3PAFA 3V7QA 5EO3A 1VQNF 5G4UC 1VQ4F 5FJ4C 1H7MA 2KG4A 1K8AH 5DCVA 3V7EA 1YJWF 1M1KH 2LBXA 2OTJF 1DT9A 3PLAC 3JAMM 4X3LA 1VQ7F 3AGKA 5HY0A 4EI8A 4BY9D 2I6DA 3CCQF 3HAXD 1E7KA 3N4YA 4BVQA 3J80M 3LFOA 4BVSA 3IR9A 1XBIA 1X52A 3CCEF 3GYQA 3CC2F 1Q7YH 1CK2A 4BVRA 1VQPF 5EWRA 3VMFB 1PXWA 1W40A 3LWRC 1JJ2F 5IT9M 5GIPC 1GO0A 1NMUB 3SIVA 1GZ0A 3SIUA 2QI2A 1VQ8F 5HXZA 4NQ3A 3CCRF 1QVGF 3JCMM 3G71F 3RA5A 3OW2F 3CC7F 3I56F 1X7PA 4LCKA 3CCLF 4NUTA 3CCSF 1VQ5F 4EI7A 3CCJF 3G4SF 1W42A 5HY2A 3NK7A 4TZZA 3MCAB 1RLGA 3NVKE 3RA6A 3LWVC 5GANK 2BO1A 3CPQA 1YI2F 1VQ9F 1T0KB 1N8RH 2GLZA 1K9MH 1W3EX 3D00A 2JNBA 1VQKF 3CC4F 1ZWZA 1Q81H 2OHWA 3VI6A 1S72F 3G6EF 1K73H 3J7AR 1YJNF 1VQ6F 1Q86H 4X3MA 5GINC 1VQMF 2CZWA 1QVFF 2AIFA 2VGNA 1YITF 2KTVA 1NJIH 1M90H 5HY4A 2QEXF 3CCVF 3FFMA 5A2QM 3I55F 5GIOC 2KTUA 3E20B 5HY1A 1VQOF 3CD6F 4EI9A 2HVYD 4C4WC 1YJ9F 3NVIB 3ON1A 2ALEA 1YIJF 1KC8H 2QA4F 3NK6A 4BVTA 1W2BF 1X7OA 5G4VC 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1Y A;  2VGM A;  3OBW A;  1KD1 H;  3HJW C;  1GO1 A;  3CME F;  2OZB A;  1RA4 A;  2LBW A;  2FC3 A;  5GAP K;  5FLX M;  3CPW F;  2OTL F;  1SDS A;  3CG6 A;  1VQL F;  3CXC F;  3O85 A;  1YHQ F;  1KQS F;  2WAL A;  4BW0 B;  3LWP C;  3LWQ C;  3LWO C;  3CMA F;  1Q82 H;  3CCM F;  1IPA A;  3WXM B;  1CN7 A;  3J81 M;  3CCU F;  1W41 A;  3NMU C;  3N4Z A;  3PAF A;  3V7Q A;  5EO3 A;  1VQN F;  5G4U C;  1VQ4 F;  5FJ4 C;  1H7M A;  2KG4 A;  1K8A H;  5DCV A;  3V7E A;  1YJW F;  1M1K H;  2LBX A;  2OTJ F;  1DT9 A;  3PLA C;  3JAM M;  4X3L A;  1VQ7 F;  3AGK A;  4BY9 D;  2I6D A;  3CCQ F;  3HAX D;  1E7K A;  3N4Y A;  3J80 M;  3LFO A;  3IR9 A;  1XBI A;  1X52 A;  3CCE F;  3GYQ A;  3CC2 F;  1Q7Y H;  1CK2 A;  1VQP F;  5EWR A;  3VMF B;  1PXW A;  1W40 A;  3LWR C;  1JJ2 F;  5IT9 M;  5GIP C;  1GO0 A;  1NMU B;  3SIV A;  1GZ0 A;  3SIU A;  2QI2 A;  1VQ8 F;  3CCR F;  1QVG F;  3JCM M;  3G71 F;  3RA5 A;  3OW2 F;  3CC7 F;  3I56 F;  1X7P A;  4LCK A;  3CCL F;  4NUT A;  3CCS F;  1VQ5 F;  3CCJ F;  3G4S F;  1W42 A;  3NK7 A;  4TZZ A;  3MCA B;  1RLG A;  3NVK E;  3RA6 A;  3LWV C;  5GAN K;  2BO1 A;  3CPQ A;  1YI2 F;  1VQ9 F;  1T0K B;  1N8R H;  1K9M H;  1W3E X;  2JNB A;  1VQK F;  3CC4 F;  1ZWZ A;  1Q81 H;  2OHW A;  3VI6 A;  1S72 F;  3G6E F;  1K73 H;  3J7A R;  1YJN F;  1VQ6 F;  1Q86 H;  4X3M A;  5GIN C;  1VQM F;  2CZW A;  1QVF F;  2AIF A;  2VGN A;  1YIT F;  2KTV A;  1NJI H;  1M90 H;  2QEX F;  3CCV F;  3FFM A;  5A2Q M;  3I55 F;  5GIO C;  2KTU A;  3E20 B;  1VQO F;  3CD6 F;  2HVY D;  4C4W C;  1YJ9 F;  3NVI B;  3ON1 A;  2ALE A;  1YIJ F;  1KC8 H;  2QA4 F;  3NK6 A;  1W2B F;  1X7O A;  5G4V C;  3OBY A; 
#chains in the Genus database with same CATH topology
 2OTM A;  4X1Y A;  3CYP B;  1SA0 B;  3WGJ A;  4X1K A;  5BMV B;  1GO1 A;  4TV8 A;  3RYH B;  3Q8H A;  2ZF8 A;  2RHH A;  3FBA A;  1Q8R A;  2HRU A;  3IMP A;  5GAP K;  4G4V A;  5FLX M;  1SDS A;  2EWC A;  3F0F A;  3CG6 A;  2DT4 A;  2WAL A;  1U3P A;  4O4I B;  2LCA A;  4FFB A;  5KX5 A;  4YJ3 B;  1OFU A;  3LWO C;  3CMA F;  1FFX A;  2GVI A;  3CCM F;  1TUB B;  1W41 A;  2RHJ A;  1VQN F;  1JY8 A;  2RHL A;  5G4U C;  5CA0 B;  2LBX A;  4ZK7 A;  4YJ2 A;  3JAM M;  4I55 A;  3WJQ A;  5IYZ A;  1E7K A;  3N2G A;  3N4Y A;  3LFO A;  3T80 A;  4BVS A;  2Z1F A;  5J2U A;  3IR9 A;  4O4L A;  1XBI A;  2CW4 A;  3VCZ A;  2VXY A;  5EZY B;  3F0G A;  5EWR A;  4WBN A;  5HP7 A;  4O4H A;  5KMG B;  5GIP C;  3GHZ A;  1NMU B;  3QUW A;  5C8Y B;  4I4T A;  4BT4 A;  1GZ0 A;  4DXD A;  2QI2 A;  5MN6 A;  1VQ8 F;  3S02 A;  4X20 A;  3VIU A;  2N48 A;  3JAW B;  3RA5 A;  4ZOL B;  3EOR A;  2BTO A;  4R40 B;  2HP0 A;  4EI7 A;  3CCJ F;  2RB9 A;  3G4S F;  3NK7 A;  5IJ9 A;  3UT5 A;  3RYF B;  5GAN K;  1N8R H;  3HKE B;  4B45 A;  5IJ0 B;  1IV2 A;  2PHN A;  3D00 A;  1VQK F;  2H8C A;  2V9Y A;  4C82 A;  1XHO A;  3F6M A;  2OHW A;  1Q81 H;  1K73 H;  3G6E F;  2VAP A;  3E22 A;  3HKB A;  3LYB A;  3HWU A;  5LXT B;  1Q86 H;  4X3M A;  1X25 A;  5GIN C;  4HNA B;  2CZW A;  3ZP4 A;  5JH7 B;  2PMP A;  3FFM A;  2IAF A;  2KTU A;  1RLU A;  5LA6 A;  3JAT A;  3RYC A;  4O2B B;  3CD6 F;  5LP6 C;  3HKD B;  2ALE A;  2CWJ A;  3C9T A;  5LP6 A;  3CYQ A;  1X7O A;  5G4V C;  4IHJ A;  3E1Y A;  2VGM A;  3JVH A;  4XCQ A;  3HJW C;  3S0W A;  3I3F A;  1TVK A;  1FNK A;  4O4J A;  1W5E A;  1IV4 A;  5EYP B;  4X1Y B;  1QAH A;  3F0D A;  2AMT A;  1RA4 A;  5HXU A;  4X1K B;  3DDN A;  4TV8 B;  3JAR A;  1SZQ A;  2AIZ P;  2ZVZ A;  3TD4 A;  3GTZ A;  2Q1X A;  2VAW A;  1VQL F;  3CXC F;  4G4W A;  4I50 A;  1YHQ F;  3WJR A;  3LWP C;  3ESJ A;  2I6R A;  5HWE A;  1IPA A;  3WXM B;  2FGY A;  3J81 M;  3CCU F;  4FFB B;  5KX5 B;  3NMU C;  3N4Z A;  1FFX B;  3V3T A;  3PAF A;  2CHT A;  3OON A;  4B46 A;  3LME A;  3HKC A;  4KWE A;  1M1K H;  5EB1 B;  4X3L A;  5HY0 A;  4BY9 D;  2I6D A;  3CCQ F;  4YJ2 B;  3S0Y A;  5LYJ A;  3JAK A;  1XRG A;  3JAL A;  3WGL A;  5LOV A;  3R0P A;  4I55 B;  5IYZ B;  2MQE A;  3C9R A;  3N2G B;  3CCE F;  3ZP7 A;  3C9S A;  3CC2 F;  5J2U B;  1VQP F;  4O4L B;  3VMF B;  5JCO C;  3M84 A;  2CSL A;  1W40 A;  1JJ2 F;  1GO0 A;  3SIV A;  2HS4 A;  4WBN B;  4DRX A;  5MN5 A;  3CCR F;  1COM A;  4O4H B;  3D01 A;  3OW2 F;  3CC7 F;  5J2T A;  2BTQ B;  1KNK A;  4I4T B;  5EAZ A;  5JVD A;  2YXZ A;  4LCK A;  3CCL F;  3P10 A;  4X20 B;  1VQ5 F;  3TD5 A;  1U40 A;  2Z1E A;  1JFF A;  5ITZ A;  3MCA B;  3VYU C;  3RA6 A;  3LWV C;  2BO1 A;  2HP0 B;  1YI2 F;  1FSZ A;  3MBM A;  1VQ9 F;  1T0K B;  4ZHV A;  2Z01 A;  1YGY A;  5IJ9 B;  3UT5 B;  3CC4 F;  3VI6 A;  1DBF A;  1IV1 A;  3VOB A;  4BT6 A;  3C8L A;  1W55 A;  2AIF A;  2VGN A;  1YIT F;  1QVF F;  3VOA A;  3E22 B;  3HKB B;  1KNJ A;  5A2Q M;  3S06 A;  1VK3 A;  1ONI A;  3M4S A;  4BT7 A;  1VQO F;  2HS3 A;  3WGM A;  4EI9 A;  4O2A A;  4C4W C;  3MCQ A;  5LA6 B;  3JAT B;  2QA4 F;  2Z1U A;  3RYC B;  4TV9 A;  3NK6 A;  3ELC A;  3IKE A;  5AVM A;  3OBY A;  1IV3 A;  3OBW A;  2DYY A;  4G4Z A;  5LP6 B;  2Q1Y A;  4EB6 A;  2K1S A;  1QD9 A;  2OZB A;  4IHJ B;  1T0A A;  3M1X A;  1TVK B;  2FC3 A;  4O4J B;  3CPW F;  4ZI7 A;  1VQV A;  4B5C A;  2UYJ A;  1W57 A;  1KQS F;  3JAR B;  3U0O A;  3CB2 A;  1VH8 A;  4I50 B;  5GON A;  1CN7 A;  3KE1 A;  1OAP A;  1W5F A;  3V7Q A;  5CB4 A;  1QU9 A;  4ERH A;  5FJ4 C;  1H7M A;  5DCV A;  5EIB C;  2R6R 1;  2YYE A;  1K8A H;  3VYS C;  3FPI A;  1YJW F;  3MDO A;  2OTJ F;  1VQ7 F;  1YQN A;  1CLI A;  3AGK A;  4X1I A;  4EI8 A;  2ZOD A;  3HKC B;  4LNU A;  3HAX D;  1W58 1;  3F0E A;  1NQ3 A;  4BVQ A;  1FNJ A;  2GZL A;  1RQ2 A;  2L26 A;  4NWO B;  3LDT A;  1U43 A;  3WPX A;  5LYJ B;  3JAK B;  4E6E A;  3JAL B;  3GYQ A;  1Q7Y H;  5LOV B;  1CK2 A;  4BVR A;  2HX0 A;  3ERN A;  4IIJ A;  3LWR C;  5IT9 M;  5FNV A;  4TUY A;  2W8B C;  3FD6 A;  4RHA A;  5CA1 A;  2HRY A;  2RHO A;  4F6R A;  5HXZ A;  3JCM M;  3G71 F;  5HP8 A;  3I56 F;  3HTN A;  4NUT A;  4DRX B;  5MN4 A;  5HY2 A;  5J2T B;  3KJK A;  4M8I A;  5JVD B;  1RLG A;  1VHA A;  3JAS A;  3RE3 A;  4U3J A;  3VYT C;  4ZHY B;  1W3E X;  1JFF B;  3N2K A;  5EIB D;  1PF5 A;  3RYI A;  3FD5 A;  5ITZ B;  2CHS A;  3S03 A;  1GX1 A;  2UYN A;  3J7A R;  5JQG A;  3S0H A;  5JCO A;  4ZHQ A;  1W59 A;  4C81 A;  3KHN A;  1VQM F;  1W5B A;  3L7Q A;  1NJI H;  5HY4 A;  3KIZ A;  1JN1 A;  1Z5V A;  1J7H A;  3I55 F;  5GIO C;  3E20 B;  3K12 A;  5HY1 A;  2HQS C;  2HVY D;  1Z5W A;  1YIJ F;  1KC8 H;  1SA0 A;  3ZO8 A;  3IEW A;  4BVT A;  5BMV A;  3K14 A;  4O2A B;  3RYH A;  3B6N A;  1KD1 H;  2F9Z C;  4TV9 B;  1XV2 A;  4RQO A;  3IKF A;  3CME F;  5EB0 A;  3D54 A;  4B62 A;  3V4D A;  3TD3 A;  4BT5 A;  4EB6 B;  2HP3 A;  1R1M A;  2LBW A;  4O4I A;  3C9U A;  2OTL F;  4YJ3 A;  2UYP A;  3O85 A;  3QTY A;  1TUB A;  4BW0 B;  4BT3 A;  4ZI7 B;  3K2X A;  2LBT A;  3LWQ C;  3WPW A;  1Q82 H;  2BTU A;  4G88 A;  4BT2 A;  2UZH A;  5CA0 A;  5EO3 A;  4U39 A;  3QHD A;  5GON B;  1H47 A;  1VQ4 F;  1H48 A;  2KG4 A;  3V7E A;  1U3L A;  5CB4 B;  1DT9 A;  3PLA C;  3IEQ A;  4G4Y A;  4C8G A;  2IG8 A;  2ZOV A;  5EZY A;  4X1I B;  3J80 M;  1UI9 A;  4LNU B;  2CVL A;  4PWT A;  5B8F A;  1X52 A;  5KMG A;  2VAM A;  3WGN A;  4C8I A;  2ZVY A;  2H6L A;  3K0T A;  5C8Y A;  2P6Y A;  4C8E A;  1PXW A;  2ZAU A;  3JAW A;  3WGK A;  4ZOL A;  2KGW A;  3SIU A;  4NQ3 A;  1QVG F;  4IIJ B;  5FNV B;  4TUY B;  5CA1 B;  2R75 1;  3WJP A;  1X7P A;  4F6R B;  3RYF A;  3CCS F;  4ZHW A;  4G4X A;  2QTP A;  3HKE A;  1W42 A;  5IJ0 A;  1UFY A;  4TZZ A;  3BYQ A;  3NVK E;  3ZOP A;  2H8E A;  3CPQ A;  2G9I A;  2GLZ A;  1ODE A;  1K9M H;  5LXT A;  2JNB A;  4HNA A;  1ZWZ A;  3JAS B;  1W5A A;  2B33 A;  5JH7 A;  4U3J B;  1S72 F;  3N2K B;  3P0Z A;  3P4E A;  3RYI B;  1YJN F;  1VQ6 F;  1JD1 A;  3I7T A;  2KTV A;  2Z1T A;  4O2B A;  2UYN B;  2QEX F;  2NMU A;  5JQG B;  3CCV F;  4ZHQ B;  3HKD A;  3MQW A;  1RQ7 A;  3VTI C;  3DC2 A;  1YJ9 F;  3NVI B;  3ON1 A;  2IQQ A;  2UYK A;  2HS0 A;  1W2B F;  3VO8 A;  5EYP A;  3KJJ A;  1M90 H; 
#chains in the Genus database with same CATH homology
 3E1Y A;  2VGM A;  3OBW A;  1KD1 H;  4XCQ A;  2F9Z C;  3HJW C;  1GO1 A;  3CME F;  2OZB A;  1RA4 A;  5HXU A;  2LBW A;  2FC3 A;  5GAP K;  5FLX M;  3CPW F;  2OTL F;  1SDS A;  3CG6 A;  1VQL F;  3CXC F;  3O85 A;  1YHQ F;  1KQS F;  2WAL A;  4BW0 B;  3LWP C;  3LWQ C;  3LWO C;  3CMA F;  1Q82 H;  3CCM F;  5HWE A;  1IPA A;  3WXM B;  1CN7 A;  2FGY A;  3J81 M;  3CCU F;  1W41 A;  3NMU C;  3N4Z A;  3V3T A;  3PAF A;  3V7Q A;  5EO3 A;  1VQN F;  5G4U C;  1VQ4 F;  5FJ4 C;  1H7M A;  2KG4 A;  1K8A H;  5DCV A;  3V7E A;  1YJW F;  1M1K H;  2LBX A;  2OTJ F;  1DT9 A;  3PLA C;  3JAM M;  4X3L A;  1VQ7 F;  3AGK A;  5HY0 A;  4EI8 A;  4BY9 D;  2I6D A;  3CCQ F;  3HAX D;  1E7K A;  3N4Y A;  4BVQ A;  3J80 M;  3LFO A;  4BVS A;  3IR9 A;  1XBI A;  1X52 A;  3CCE F;  3GYQ A;  3CC2 F;  1Q7Y H;  1CK2 A;  4BVR A;  1VQP F;  5EWR A;  3VMF B;  1PXW A;  1W40 A;  3LWR C;  1JJ2 F;  5IT9 M;  5GIP C;  1GO0 A;  1NMU B;  3SIV A;  1GZ0 A;  3SIU A;  2QI2 A;  1VQ8 F;  5HXZ A;  4NQ3 A;  3CCR F;  1QVG F;  3JCM M;  3G71 F;  3RA5 A;  3OW2 F;  3CC7 F;  3I56 F;  1X7P A;  4LCK A;  3CCL F;  4NUT A;  3CCS F;  1VQ5 F;  4EI7 A;  3CCJ F;  3G4S F;  1W42 A;  5HY2 A;  3NK7 A;  4TZZ A;  3MCA B;  1RLG A;  3NVK E;  3RA6 A;  3LWV C;  5GAN K;  2BO1 A;  3CPQ A;  1YI2 F;  1VQ9 F;  1T0K B;  1N8R H;  2GLZ A;  1K9M H;  1W3E X;  3D00 A;  2JNB A;  1VQK F;  3CC4 F;  1ZWZ A;  1Q81 H;  2OHW A;  3VI6 A;  1S72 F;  3G6E F;  1K73 H;  3J7A R;  1YJN F;  1VQ6 F;  1Q86 H;  4X3M A;  5GIN C;  1VQM F;  2CZW A;  1QVF F;  2AIF A;  2VGN A;  1YIT F;  2KTV A;  1NJI H;  1M90 H;  5HY4 A;  2QEX F;  3CCV F;  3FFM A;  5A2Q M;  3I55 F;  5GIO C;  2KTU A;  3E20 B;  5HY1 A;  1VQO F;  3CD6 F;  4EI9 A;  2HVY D;  4C4W C;  1YJ9 F;  3NVI B;  3ON1 A;  2ALE A;  1YIJ F;  1KC8 H;  2QA4 F;  3NK6 A;  4BVT A;  1W2B F;  1X7O A;  5G4V C;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...