1NJIH

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1njiH00
3VI6A 1Q86H 5DCVA 1VQ4F 3CD6F 2KTVA 3J81M 2HVYD 3CC2F 1RLGA 1YJWF 2OTJF 3V7QA 1K9MH 3HJWC 3J80M 3CMAF 5IT9M 5EWRA 3CXCF 1X7OA 3LWVC 3RA6A 1VQ6F 2CZWA 2QEXF 1KQSF 1YIJF 2ALEA 1IPAA 4X3LA 1RA4A 2WALA 1K8AH 3NK7A 3N4ZA 3OBWA 3E20B 1N8RH 2VGMA 2AIFA 4NUTA 3NVIB 1VQKF 3SIUA 1W42A 5EO3A 3LWPC 3V7EA 3CCEF 5GIOC 1E7KA 3OW2F 5FLXM 5FJ4C 3NMUC 3NK6A 3NVKE 3LWRC 1W3EX 3CC7F 3J7AR 5G4VC 1X7PA 2FC3A 3RA5A 1M1KH 1JJ2F 3VMFB 1VQNF 3GYQA 1DT9A 3G6EF 1PXWA 3OBYA 2QI2A 1CN7A 1VQ5F 4TZZA 3SIVA 2I6DA 2KG4A 1VQ7F 1VQLF 2OTLF 1GZ0A 3IR9A 5A2QM 3CPWF 1M90H 2OZBA 3CCLF 1S72F 1SDSA 3CPQA 3G71F 1QVGF 3LWQC 5GINC 3N4YA 1XBIA 1YJ9F 3JAMM 3FFMA 3JCMM 3PLAC 2JNBA 1YJNF 4LCKA 1W40A 1W2BF 1QVFF 3LWOC 3I55F 4X3MA 1KD1H 3CCSF 3G4SF 1YHQF 1CK2A 1YI2F 4C4WC 1NJIH 5GANK 5GAPK 3CG6A 1GO0A 3CC4F 2OHWA 4BW0B 2KTUA 2LBXA 3CCQF 4BY9D 1Q82H 3E1YA 1VQ8F 5G4UC 3MCAB 3AGKA 2QA4F 1W41A 3CMEF 1VQ9F 3CCRF 1VQPF 1Q7YH 3LFOA 3CCUF 2VGNA 1X52A 1GO1A 1ZWZA 3CCJF 1H7MA 1NMUB 5GIPC 1K73H 1VQOF 3CCVF 1YITF 3ON1A 3I56F 1T0KB 1KC8H 1VQMF 3HAXD 3PAFA 2LBWA 3CCMF 3WXMB 2BO1A 1Q81H 3O85A
chains in the Genus database with same CATH superfamily
3VI6A 2HRUA 4O2BA 1QU9A 3N2KA 3S06A 3CD6F 2CVLA 3M84A 4ZHWA 1DBFA 1KNKA 2R751 1OFUA 3CYPB 2IQQA 4ERHA 4DRXA 1K9MH 3OONA 3HJWC 1RQ7A 2HS4A 2QTPA 2ZAUA 3I3FA 1X7OA 3HKDA 4G4YA 3JARB 2H8CA 1VQ6F 3LMEA 1W5AA 1YGYA 4XCQA 3C9SA 5MN4A 3IKFA 3N2GA 4O4IB 3ZP7A 4X3LA 4BVSA 4ZK7A 3GTZA 4EB6A 2WALA 2N48A 3HKCB 4IIJA 3E20B 5FNVB 3ZOPA 5IYZA 3Q8HA 1XV2A 2H6LA 4NUTA 1T0AA 3RYCB 1RQ2A 2UZHA 2HQSC 3LWPC 1W57A 2BTUA 3CB2A 3E22B 4KWEA 2I6RA 5FLXM 1W3EX 5EIBD 3K12A 1FFXB 2Q1YA 4BVTA 4EI8A 2FC3A 4O4LB 3JAWB 3P0ZA 5J2UB 5KMGA 3KJJA 1VQNF 5HXUA 1FSZA 1Z5WA 5LP6B 3K2XA 2NMUA 4C82A 2QI2A 1U3LA 1CN7A 4BT5A 3SIVA 3RYHA 4X1YA 2ZF8A 4FFBB 1JFFB 2KG4A 2UYNA 3K14A 4X20A 2GVIA 2VAWA 5GONB 5JCOA 3S0WA 3TD5A 2OTLF 3IR9A 4WBNA 2HP3A 4YJ3B 2OZBA 5J2TA 3CCLF 1S72F 5LOVB 3CPQA 4R40B 4RHAA 4O2BB 3N2KB 3LWQC 3T80A 1XBIA 1QAHA 3S0YA 3V4DA 3JCMM 3PLAC 4U3JA 4DRXB 1XRGA 2JNBA 2HS3A 1YJNF 1SA0A 2UYJA 3HKDB 3VOAA 4TV9A 3LYBA 5C8YA 3CCSF 5BMVA 1YI2F 5GAPK 3CG6A 3N2GB 2OHWA 2LBXA 3CCQF 4EB6B 1NQ3A 4IIJB 4O2AA 2QA4F 1VQ9F 5IYZB 3EORA 5JH7A 3RYIA 4TV8A 5LP6C 4IHJA 1ZWZA 3CCJF 2UYKA 1TVKA 1H7MA 1NMUB 5EB1B 5B8FA 3I56F 1W581 3LDTA 3KHNA 3PAFA 3TD3A 5KMGB 3P4EA 1CLIA 5HY2A 5DCVA 4ZHVA 2KTVA 3WJQA 3RYHB 4X1YB 3JASA 2UYNB 4X20B 3V7QA 5IT9M 5EYPA 4WBNB 3R0PA 3CXCF 3LWVC 3P10A 2YYEA 5J2TB 2CZWA 3V3TA 2QEXF 1VHAA 2GLZA 1YIJF 2ALEA 1K8AH 4X1IA 5LXTA 1VH8A 3TD4A 2AIFA 4U3JB 4C8GA 2V9YA 1SA0B 1W42A 1Z5VA 3CCEF 2GZLA 4TV9B 5C8YB 1E7KA 2AIZP 5BMVB 4YJ2A 3NMUC 3NVKE 4G4WA 2CSLA 3RA5A 4B45A 2OTMA 2Z01A 3KE1A 1JJ2F 4O2AB 3FPIA 5JH7B 1W5EA 1UI9A 3RYIB 4TV8B 4IHJB 1UFYA 1VQ5F 2Z1EA 4C8EA 1TVKB 1OAPA 2HP0A 5CB4A 5JCOC 3B6NA 5EIBC 3DC2A 2BTQB 4BVQA 3N4YA 1JY8A 1YQNA 4O4JA 4BT2A 2IG8A 1PF5A 3JASB 3JAMM 2LCAA 3JAKA 4LCKA 2K1SA 5EYPB 1W40A 1W2BF 1QVFF 4G4ZA 1CK2A 3D00A 3ZP4A 2VAMA 1GO0A 5IJ0A 4I50A 3E1YA 4X1IB 5LXTB 3MCAB 2FGYA 3CMEF 2F9ZC 2Q1XA 5EAZA 2CHSA 5HY0A 1Q7YH 4O4HA 3LFOA 1X52A 4G4XA 1GO1A 5GIPC 3MBMA 5JVDA 2UYPA 1K73H 1H48A 4YJ2B 1VQOF 3HWUA 3VO8A 3WJRA 2VXYA 2Z1TA 3WGJA 3QTYA 3HAXD 3ERNA 2BO1A 2G9IA 1Q81H 5G4UC 3UT5A 3VYSC 5MN6A 3GHZA 4E6EA 4F6RA 4I4TA 1ONIA 1KNJA 4EI9A 2HVYD 3C9TA 4G88A 3CC2F 1RLGA 4ZOLA 1YJWF 2HP0B 5CB4B 5EWRA 4ZI7A 3MDOA 5HXZA 3HKBA 3JALA 1U43A 4BT3A 1KQSF 1IPAA 3WGMA 3WGKA 2W8BC 3S02A 1RA4A 2PHNA 5AVMA 2B33A 3NK7A 3ZO8A 4O4JB 1N8RH 1SZQA 2VGMA 3QHDA 3MQWA 3NVIB 3JAKB 1QD9A 5EO3A 3V7EA 5HP7A 2Z1FA 2RB9A 3BYQA 3CYQA 3IEQA 1U3PA 5EB0A 3OW2F 3RE3A 3F0DA 2ZVZA 4ZHQA 1Q8RA 2L26A 5FJ4C 3NK6A 5IJ0B 3LWRC 3J7AR 1W5FA 5ITZA 5G4VC 4I50B 1X7PA 4C81A 5KX5A 3FD5A 3GYQA 2PMPA 1DT9A 3OBYA 2RHJA 4O4HB 4TZZA 2H8EA 2I6DA 3HKEA 5HY4A 5JVDB 3L7QA 4RQOA 1GZ0A 5A2QM 3F0FA 3DDNA 3F0EA 4BT4A 1M90H 3MCQA 3VTIC 3UT5B 3S0HA 1SDSA 3JATA 3G71F 3I7TA 5JQGA 4F6RB 1QVGF 3FD6A 4I4TB 5GINC 4B5CA 4ZOLB 1IV4A 4NWOB 2EWCA 4ZI7B 5HWEA 2IAFA 4B46A 1W59A 4TUYA 2AMTA 3HKBB 3WPWA 4X3MA 1KD1H 3JALB 3K0TA 4NQ3A 2CHTA 3FBAA 3VIUA 1VQVA 4BW0B 1J7HA 5HY1A 3C9UA 5LA6A 4EI7A 1IV3A 3WJPA 1VQPF 3IKEA 3C8LA 2VGNA 4HNAA 1W55A 2CWJA 1TUBA 5CA0A 3CCVF 3C9RA 4ZHQB 4PWTA 1YITF 2RHLA 5ITZB 1VQMF 3F6MA 4BVRA 3QUWA 3WXMB 5KX5B 5EZYA 3O85A 3M4SA 1Q86H 1VQ4F 3J81M 2R6R1 1W5BA 2OTJF 3HKEB 1XHOA 3J80M 3CMAF 3S03A 2P6YA 3RA6A 3KJKA 2ZOVA 3RYFA 3JATB 3IMPA 2ZVYA 1JD1A 5JQGB 3U0OA 3N4ZA 3OBWA 2CW4A 4I55A 5LYJA 5CA1A 2DYYA 2LBTA 4BT6A 1IV2A 1VQKF 3SIUA 1R1MA 1H47A 4LNUA 4TUYB 5GIOC 5IJ9A 3HTNA 4DXDA 4X1KA 2KGWA 2ZODA 3CC7F 5LA6B 1M1KH 4BT7A 3VMFB 1IV1A 3G6EF 1PXWA 4C8IA 3VCZA 1GX1A 4HNAB 3VOBA 3WPXA 1VQ7F 5HP8A 1TUBB 1VQLF 5CA0B 2BTOA 3IEWA 3CPWF 3WGLA 1FNKA 3JARA 2HRYA 3ESJA 5EZYB 4O4IA 4ZHYB 1FNJA 3WGNA 1U40A 3HKCA 5FNVA 1YJ9F 3FFMA 3RYCA 2RHHA 4M8IA 3LWOC 3I55F 2HS0A 3VYUC 3E22A 4U39A 3G4SF 1YHQF 4C4WC 1NJIH 5GANK 4G4VA 3RYFB 3M1XA 3CC4F 1VK3A 2Z1UA 2KTUA 3ELCA 4BY9D 1FFXA 1Q82H 1VQ8F 5J2UA 4O4LA 3JAWA 5LYJB 4I55B 3JVHA 5CA1B 3AGKA 5MN5A 1W41A 2MQEA 3D54A 3F0GA 3CCRF 1JN1A 3KIZA 5LP6A 3VYTC 2HX0A 3CCUF 3D01A 4LNUB 2RHOA 1JFFA 4FFBA 1RLUA 5IJ9B 5GONA 4X1KB 1COMA 1X25A 3ON1A 4YJ3A 4B62A 1T0KB 2VAPA 1KC8H 1ODEA 2YXZA 2DT4A 2LBWA 3CCMF 5LOVA
chains in the Genus database with same CATH topology
3VI6A 1Q86H 5HY2A 5DCVA 1VQ4F 3CD6F 2KTVA 3J81M 4EI9A 2HVYD 3CC2F 1RLGA 1YJWF 2OTJF 3V7QA 1K9MH 3HJWC 3J80M 3CMAF 5IT9M 5EWRA 3CXCF 5HXZA 1X7OA 3LWVC 3RA6A 1VQ6F 2CZWA 3V3TA 2QEXF 1KQSF 2GLZA 4XCQA 4BVSA 1YIJF 2ALEA 1IPAA 4X3LA 1RA4A 2WALA 1K8AH 3NK7A 3N4ZA 3OBWA 3E20B 1N8RH 2VGMA 2AIFA 4NUTA 3NVIB 1VQKF 3SIUA 1W42A 5EO3A 3LWPC 3V7EA 3CCEF 5GIOC 1E7KA 3OW2F 5FLXM 5FJ4C 3NMUC 3NK6A 3NVKE 3LWRC 1W3EX 3CC7F 3J7AR 4BVTA 5G4VC 1X7PA 2FC3A 3RA5A 4EI8A 1M1KH 1JJ2F 3VMFB 1VQNF 3GYQA 1DT9A 5HXUA 3G6EF 1PXWA 3OBYA 2QI2A 1CN7A 1VQ5F 4TZZA 3SIVA 2I6DA 5HY4A 2KG4A 1VQ7F 1VQLF 2OTLF 1GZ0A 3IR9A 5A2QM 3CPWF 1M90H 2OZBA 3CCLF 1S72F 1SDSA 3CPQA 3G71F 1QVGF 3LWQC 4BVQA 5GINC 3N4YA 1XBIA 1YJ9F 3JAMM 3FFMA 3JCMM 3PLAC 2JNBA 1YJNF 4LCKA 1W40A 1W2BF 5HWEA 1QVFF 3LWOC 3I55F 4X3MA 1KD1H 3CCSF 3G4SF 4NQ3A 3D00A 1CK2A 1YHQF 1YI2F 1NJIH 5GANK 5GAPK 3CG6A 4C4WC 1GO0A 3CC4F 2OHWA 4BW0B 2KTUA 2LBXA 5HY1A 3CCQF 4BY9D 4EI7A 3E1YA 1Q82H 1VQ8F 5G4UC 3MCAB 3AGKA 2QA4F 1W41A 2FGYA 3CMEF 2F9ZC 1VQ9F 3CCRF 5HY0A 1VQPF 1Q7YH 3LFOA 3CCUF 2VGNA 1X52A 1GO1A 1ZWZA 3CCJF 1H7MA 1NMUB 5GIPC 1K73H 1VQOF 3CCVF 1YITF 3ON1A 3I56F 1T0KB 1KC8H 1VQMF 3HAXD 4BVRA 3PAFA 2LBWA 3CCMF 3WXMB 2BO1A 1Q81H 3O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  1Q86 H;  5DCV A;  1VQ4 F;  3CD6 F;  2KTV A;  3J81 M;  2HVY D;  3CC2 F;  1RLG A;  1YJW F;  2OTJ F;  3V7Q A;  1K9M H;  3HJW C;  3J80 M;  3CMA F;  5IT9 M;  5EWR A;  3CXC F;  1X7O A;  3LWV C;  3RA6 A;  1VQ6 F;  2CZW A;  2QEX F;  1KQS F;  1YIJ F;  2ALE A;  1IPA A;  4X3L A;  1RA4 A;  2WAL A;  1K8A H;  3NK7 A;  3N4Z A;  3OBW A;  3E20 B;  1N8R H;  2VGM A;  2AIF A;  4NUT A;  3NVI B;  1VQK F;  3SIU A;  1W42 A;  5EO3 A;  3LWP C;  3V7E A;  3CCE F;  5GIO C;  1E7K A;  3OW2 F;  5FLX M;  5FJ4 C;  3NMU C;  3NK6 A;  3NVK E;  3LWR C;  1W3E X;  3CC7 F;  3J7A R;  5G4V C;  1X7P A;  2FC3 A;  3RA5 A;  1M1K H;  1JJ2 F;  3VMF B;  1VQN F;  3GYQ A;  1DT9 A;  3G6E F;  1PXW A;  3OBY A;  2QI2 A;  1CN7 A;  1VQ5 F;  4TZZ A;  3SIV A;  2I6D A;  2KG4 A;  1VQ7 F;  1VQL F;  2OTL F;  1GZ0 A;  3IR9 A;  5A2Q M;  3CPW F;  1M90 H;  2OZB A;  3CCL F;  1S72 F;  1SDS A;  3CPQ A;  3G71 F;  1QVG F;  3LWQ C;  5GIN C;  3N4Y A;  1XBI A;  1YJ9 F;  3JAM M;  3FFM A;  3JCM M;  3PLA C;  2JNB A;  1YJN F;  4LCK A;  1W40 A;  1W2B F;  1QVF F;  3LWO C;  3I55 F;  4X3M A;  1KD1 H;  3CCS F;  3G4S F;  1YHQ F;  1CK2 A;  1YI2 F;  4C4W C;  1NJI H;  5GAN K;  5GAP K;  3CG6 A;  1GO0 A;  3CC4 F;  2OHW A;  4BW0 B;  2KTU A;  2LBX A;  3CCQ F;  4BY9 D;  1Q82 H;  3E1Y A;  1VQ8 F;  5G4U C;  3MCA B;  3AGK A;  2QA4 F;  1W41 A;  3CME F;  1VQ9 F;  3CCR F;  1VQP F;  1Q7Y H;  3LFO A;  3CCU F;  2VGN A;  1X52 A;  1GO1 A;  1ZWZ A;  3CCJ F;  1H7M A;  1NMU B;  5GIP C;  1K73 H;  1VQO F;  3CCV F;  1YIT F;  3ON1 A;  3I56 F;  1T0K B;  1KC8 H;  1VQM F;  3HAX D;  3PAF A;  2LBW A;  3CCM F;  3WXM B;  2BO1 A;  1Q81 H;  3O85 A; 
#chains in the Genus database with same CATH topology
 3VI6 A;  2HRU A;  4O2B A;  1QU9 A;  3N2K A;  3S06 A;  3CD6 F;  2CVL A;  3M84 A;  4ZHW A;  1DBF A;  1KNK A;  2R75 1;  1OFU A;  3CYP B;  2IQQ A;  4ERH A;  4DRX A;  1K9M H;  3OON A;  3HJW C;  1RQ7 A;  2HS4 A;  2QTP A;  2ZAU A;  3I3F A;  1X7O A;  3HKD A;  4G4Y A;  3JAR B;  2H8C A;  1VQ6 F;  3LME A;  1W5A A;  1YGY A;  4XCQ A;  3C9S A;  5MN4 A;  3IKF A;  3N2G A;  4O4I B;  3ZP7 A;  4X3L A;  4BVS A;  4ZK7 A;  3GTZ A;  4EB6 A;  2WAL A;  2N48 A;  3HKC B;  4IIJ A;  3E20 B;  5FNV B;  3ZOP A;  5IYZ A;  3Q8H A;  1XV2 A;  2H6L A;  4NUT A;  1T0A A;  3RYC B;  1RQ2 A;  2UZH A;  2HQS C;  3LWP C;  1W57 A;  2BTU A;  3CB2 A;  3E22 B;  4KWE A;  2I6R A;  5FLX M;  1W3E X;  5EIB D;  3K12 A;  1FFX B;  2Q1Y A;  4BVT A;  4EI8 A;  2FC3 A;  4O4L B;  3JAW B;  3P0Z A;  5J2U B;  5KMG A;  3KJJ A;  1VQN F;  5HXU A;  1FSZ A;  1Z5W A;  5LP6 B;  3K2X A;  2NMU A;  4C82 A;  2QI2 A;  1U3L A;  1CN7 A;  4BT5 A;  3SIV A;  3RYH A;  4X1Y A;  2ZF8 A;  4FFB B;  1JFF B;  2KG4 A;  2UYN A;  3K14 A;  4X20 A;  2GVI A;  2VAW A;  5GON B;  5JCO A;  3S0W A;  3TD5 A;  2OTL F;  3IR9 A;  4WBN A;  2HP3 A;  4YJ3 B;  2OZB A;  5J2T A;  3CCL F;  1S72 F;  5LOV B;  3CPQ A;  4R40 B;  4RHA A;  4O2B B;  3N2K B;  3LWQ C;  3T80 A;  1XBI A;  1QAH A;  3S0Y A;  3V4D A;  3JCM M;  3PLA C;  4U3J A;  4DRX B;  1XRG A;  2JNB A;  2HS3 A;  1YJN F;  1SA0 A;  2UYJ A;  3HKD B;  3VOA A;  4TV9 A;  3LYB A;  5C8Y A;  3CCS F;  5BMV A;  1YI2 F;  5GAP K;  3CG6 A;  3N2G B;  2OHW A;  2LBX A;  3CCQ F;  4EB6 B;  1NQ3 A;  4IIJ B;  4O2A A;  2QA4 F;  1VQ9 F;  5IYZ B;  3EOR A;  5JH7 A;  3RYI A;  4TV8 A;  5LP6 C;  4IHJ A;  1ZWZ A;  3CCJ F;  2UYK A;  1TVK A;  1H7M A;  1NMU B;  5EB1 B;  5B8F A;  3I56 F;  1W58 1;  3LDT A;  3KHN A;  3PAF A;  3TD3 A;  5KMG B;  3P4E A;  1CLI A;  5HY2 A;  5DCV A;  4ZHV A;  2KTV A;  3WJQ A;  3RYH B;  4X1Y B;  3JAS A;  2UYN B;  4X20 B;  3V7Q A;  5IT9 M;  5EYP A;  4WBN B;  3R0P A;  3CXC F;  3LWV C;  3P10 A;  2YYE A;  5J2T B;  2CZW A;  3V3T A;  2QEX F;  1VHA A;  2GLZ A;  1YIJ F;  2ALE A;  1K8A H;  4X1I A;  5LXT A;  1VH8 A;  3TD4 A;  2AIF A;  4U3J B;  4C8G A;  2V9Y A;  1SA0 B;  1W42 A;  1Z5V A;  3CCE F;  2GZL A;  4TV9 B;  5C8Y B;  1E7K A;  2AIZ P;  5BMV B;  4YJ2 A;  3NMU C;  3NVK E;  4G4W A;  2CSL A;  3RA5 A;  4B45 A;  2OTM A;  2Z01 A;  3KE1 A;  1JJ2 F;  4O2A B;  3FPI A;  5JH7 B;  1W5E A;  1UI9 A;  3RYI B;  4TV8 B;  4IHJ B;  1UFY A;  1VQ5 F;  2Z1E A;  4C8E A;  1TVK B;  1OAP A;  2HP0 A;  5CB4 A;  5JCO C;  3B6N A;  5EIB C;  3DC2 A;  2BTQ B;  4BVQ A;  3N4Y A;  1JY8 A;  1YQN A;  4O4J A;  4BT2 A;  2IG8 A;  1PF5 A;  3JAS B;  3JAM M;  2LCA A;  3JAK A;  4LCK A;  2K1S A;  5EYP B;  1W40 A;  1W2B F;  1QVF F;  4G4Z A;  1CK2 A;  3D00 A;  3ZP4 A;  2VAM A;  1GO0 A;  5IJ0 A;  4I50 A;  3E1Y A;  4X1I B;  5LXT B;  3MCA B;  2FGY A;  3CME F;  2F9Z C;  2Q1X A;  5EAZ A;  2CHS A;  5HY0 A;  1Q7Y H;  4O4H A;  3LFO A;  1X52 A;  4G4X A;  1GO1 A;  5GIP C;  3MBM A;  5JVD A;  2UYP A;  1K73 H;  1H48 A;  4YJ2 B;  1VQO F;  3HWU A;  3VO8 A;  3WJR A;  2VXY A;  2Z1T A;  3WGJ A;  3QTY A;  3HAX D;  3ERN A;  2BO1 A;  2G9I A;  1Q81 H;  5G4U C;  3UT5 A;  3VYS C;  5MN6 A;  3GHZ A;  4E6E A;  4F6R A;  4I4T A;  1ONI A;  1KNJ A;  4EI9 A;  2HVY D;  3C9T A;  4G88 A;  3CC2 F;  1RLG A;  4ZOL A;  1YJW F;  2HP0 B;  5CB4 B;  5EWR A;  4ZI7 A;  3MDO A;  5HXZ A;  3HKB A;  3JAL A;  1U43 A;  4BT3 A;  1KQS F;  1IPA A;  3WGM A;  3WGK A;  2W8B C;  3S02 A;  1RA4 A;  2PHN A;  5AVM A;  2B33 A;  3NK7 A;  3ZO8 A;  4O4J B;  1N8R H;  1SZQ A;  2VGM A;  3QHD A;  3MQW A;  3NVI B;  3JAK B;  1QD9 A;  5EO3 A;  3V7E A;  5HP7 A;  2Z1F A;  2RB9 A;  3BYQ A;  3CYQ A;  3IEQ A;  1U3P A;  5EB0 A;  3OW2 F;  3RE3 A;  3F0D A;  2ZVZ A;  4ZHQ A;  1Q8R A;  2L26 A;  5FJ4 C;  3NK6 A;  5IJ0 B;  3LWR C;  3J7A R;  1W5F A;  5ITZ A;  5G4V C;  4I50 B;  1X7P A;  4C81 A;  5KX5 A;  3FD5 A;  3GYQ A;  2PMP A;  1DT9 A;  3OBY A;  2RHJ A;  4O4H B;  4TZZ A;  2H8E A;  2I6D A;  3HKE A;  5HY4 A;  5JVD B;  3L7Q A;  4RQO A;  1GZ0 A;  5A2Q M;  3F0F A;  3DDN A;  3F0E A;  4BT4 A;  1M90 H;  3MCQ A;  3VTI C;  3UT5 B;  3S0H A;  1SDS A;  3JAT A;  3G71 F;  3I7T A;  5JQG A;  4F6R B;  1QVG F;  3FD6 A;  4I4T B;  5GIN C;  4B5C A;  4ZOL B;  1IV4 A;  4NWO B;  2EWC A;  4ZI7 B;  5HWE A;  2IAF A;  4B46 A;  1W59 A;  4TUY A;  2AMT A;  3HKB B;  3WPW A;  4X3M A;  1KD1 H;  3JAL B;  3K0T A;  4NQ3 A;  2CHT A;  3FBA A;  3VIU A;  1VQV A;  4BW0 B;  1J7H A;  5HY1 A;  3C9U A;  5LA6 A;  4EI7 A;  1IV3 A;  3WJP A;  1VQP F;  3IKE A;  3C8L A;  2VGN A;  4HNA A;  1W55 A;  2CWJ A;  1TUB A;  5CA0 A;  3CCV F;  3C9R A;  4ZHQ B;  4PWT A;  1YIT F;  2RHL A;  5ITZ B;  1VQM F;  3F6M A;  4BVR A;  3QUW A;  3WXM B;  5KX5 B;  5EZY A;  3O85 A;  3M4S A;  1Q86 H;  1VQ4 F;  3J81 M;  2R6R 1;  1W5B A;  2OTJ F;  3HKE B;  1XHO A;  3J80 M;  3CMA F;  3S03 A;  2P6Y A;  3RA6 A;  3KJK A;  2ZOV A;  3RYF A;  3JAT B;  3IMP A;  2ZVY A;  1JD1 A;  5JQG B;  3U0O A;  3N4Z A;  3OBW A;  2CW4 A;  4I55 A;  5LYJ A;  5CA1 A;  2DYY A;  2LBT A;  4BT6 A;  1IV2 A;  1VQK F;  3SIU A;  1R1M A;  1H47 A;  4LNU A;  4TUY B;  5GIO C;  5IJ9 A;  3HTN A;  4DXD A;  4X1K A;  2KGW A;  2ZOD A;  3CC7 F;  5LA6 B;  1M1K H;  4BT7 A;  3VMF B;  1IV1 A;  3G6E F;  1PXW A;  4C8I A;  3VCZ A;  1GX1 A;  4HNA B;  3VOB A;  3WPX A;  1VQ7 F;  5HP8 A;  1TUB B;  1VQL F;  5CA0 B;  2BTO A;  3IEW A;  3CPW F;  3WGL A;  1FNK A;  3JAR A;  2HRY A;  3ESJ A;  5EZY B;  4O4I A;  4ZHY B;  1FNJ A;  3WGN A;  1U40 A;  3HKC A;  5FNV A;  1YJ9 F;  3FFM A;  3RYC A;  2RHH A;  4M8I A;  3LWO C;  3I55 F;  2HS0 A;  3VYU C;  3E22 A;  4U39 A;  3G4S F;  1YHQ F;  4C4W C;  1NJI H;  5GAN K;  4G4V A;  3RYF B;  3M1X A;  3CC4 F;  1VK3 A;  2Z1U A;  2KTU A;  3ELC A;  4BY9 D;  1FFX A;  1Q82 H;  1VQ8 F;  5J2U A;  4O4L A;  3JAW A;  5LYJ B;  4I55 B;  3JVH A;  5CA1 B;  3AGK A;  5MN5 A;  1W41 A;  2MQE A;  3D54 A;  3F0G A;  3CCR F;  1JN1 A;  3KIZ A;  5LP6 A;  3VYT C;  2HX0 A;  3CCU F;  3D01 A;  4LNU B;  2RHO A;  1JFF A;  4FFB A;  1RLU A;  5IJ9 B;  5GON A;  4X1K B;  1COM A;  1X25 A;  3ON1 A;  4YJ3 A;  4B62 A;  1T0K B;  2VAP A;  1KC8 H;  1ODE A;  2YXZ A;  2DT4 A;  2LBW A;  3CCM F;  5LOV A; 
#chains in the Genus database with same CATH homology
 3VI6 A;  1Q86 H;  5HY2 A;  5DCV A;  1VQ4 F;  3CD6 F;  2KTV A;  3J81 M;  4EI9 A;  2HVY D;  3CC2 F;  1RLG A;  1YJW F;  2OTJ F;  3V7Q A;  1K9M H;  3HJW C;  3J80 M;  3CMA F;  5IT9 M;  5EWR A;  3CXC F;  5HXZ A;  1X7O A;  3LWV C;  3RA6 A;  1VQ6 F;  2CZW A;  3V3T A;  2QEX F;  1KQS F;  2GLZ A;  4XCQ A;  4BVS A;  1YIJ F;  2ALE A;  1IPA A;  4X3L A;  1RA4 A;  2WAL A;  1K8A H;  3NK7 A;  3N4Z A;  3OBW A;  3E20 B;  1N8R H;  2VGM A;  2AIF A;  4NUT A;  3NVI B;  1VQK F;  3SIU A;  1W42 A;  5EO3 A;  3LWP C;  3V7E A;  3CCE F;  5GIO C;  1E7K A;  3OW2 F;  5FLX M;  5FJ4 C;  3NMU C;  3NK6 A;  3NVK E;  3LWR C;  1W3E X;  3CC7 F;  3J7A R;  4BVT A;  5G4V C;  1X7P A;  2FC3 A;  3RA5 A;  4EI8 A;  1M1K H;  1JJ2 F;  3VMF B;  1VQN F;  3GYQ A;  1DT9 A;  5HXU A;  3G6E F;  1PXW A;  3OBY A;  2QI2 A;  1CN7 A;  1VQ5 F;  4TZZ A;  3SIV A;  2I6D A;  5HY4 A;  2KG4 A;  1VQ7 F;  1VQL F;  2OTL F;  1GZ0 A;  3IR9 A;  5A2Q M;  3CPW F;  1M90 H;  2OZB A;  3CCL F;  1S72 F;  1SDS A;  3CPQ A;  3G71 F;  1QVG F;  3LWQ C;  4BVQ A;  5GIN C;  3N4Y A;  1XBI A;  1YJ9 F;  3JAM M;  3FFM A;  3JCM M;  3PLA C;  2JNB A;  1YJN F;  4LCK A;  1W40 A;  1W2B F;  5HWE A;  1QVF F;  3LWO C;  3I55 F;  4X3M A;  1KD1 H;  3CCS F;  3G4S F;  4NQ3 A;  3D00 A;  1CK2 A;  1YHQ F;  1YI2 F;  1NJI H;  5GAN K;  5GAP K;  3CG6 A;  4C4W C;  1GO0 A;  3CC4 F;  2OHW A;  4BW0 B;  2KTU A;  2LBX A;  5HY1 A;  3CCQ F;  4BY9 D;  4EI7 A;  3E1Y A;  1Q82 H;  1VQ8 F;  5G4U C;  3MCA B;  3AGK A;  2QA4 F;  1W41 A;  2FGY A;  3CME F;  2F9Z C;  1VQ9 F;  3CCR F;  5HY0 A;  1VQP F;  1Q7Y H;  3LFO A;  3CCU F;  2VGN A;  1X52 A;  1GO1 A;  1ZWZ A;  3CCJ F;  1H7M A;  1NMU B;  5GIP C;  1K73 H;  1VQO F;  3CCV F;  1YIT F;  3ON1 A;  3I56 F;  1T0K B;  1KC8 H;  1VQM F;  3HAX D;  4BVR A;  3PAF A;  2LBW A;  3CCM F;  3WXM B;  2BO1 A;  1Q81 H;  3O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...