1NJIH

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1njiH00
5G4UC 5GANK 1VQ6F 1YIJF 5EO3A 2WALA 3VI6A 1KD1H 1XBIA 1GZ0A 3NK7A 3NVKE 3CD6F 3OBWA 3LWVC 3V7EA 3CG6A 5DCVA 3WXMB 1VQPF 1QVFF 4X3MA 1RLGA 2I6DA 1YHQF 1DT9A 2AIFA 3CCQF 3J81M 1VQMF 1Q81H 3O85A 1W2BF 3PLAC 3CCEF 3MCAB 4BW0B 3HAXD 1T0KB 2KG4A 4BY9D 1Q86H 3I55F 1S72F 1X7OA 1QVGF 1KQSF 3G4SF 3FFMA 3RA5A 3LWPC 3NVIB 3NK6A 3RA6A 3LWQC 1VQ7F 3LWRC 1Q82H 5A2QM 2LBXA 3CC2F 5GINC 3ON1A 3CCSF 5GIPC 1K73H 1CK2A 2CZWA 2JNBA 1NMUB 1VQOF 5G4VC 2VGMA 1VQKF 3LFOA 2ALEA 3LWOC 3CXCF 1YJWF 1GO1A 2OZBA 2KTUA 1VQ9F 2KTVA 5GAPK 2QI2A 3CMEF 3OW2F 3SIVA 3JCMM 1Q7YH 1SDSA 1GO0A 5GIOC 3AGKA 3CPWF 3E20B 2QEXF 3J7AR 1W42A 1M90H 1VQ4F 3CCUF 3CCVF 2VGNA 1YITF 3CMAF 1K9MH 2BO1A 2QA4F 3E1YA 5FJ4C 1W3EX 4X3LA 3HJWC 4NUTA 1W40A 3CPQA 3IR9A 3N4YA 1NJIH 1VQLF 3V7QA 1IPAA 3SIUA 3JAMM 2OHWA 1H7MA 3CC4F 1RA4A 1W41A 3N4ZA 3GYQA 3G6EF 1CN7A 3I56F 3PAFA 3CCMF 2LBWA 2OTJF 1JJ2F 5FLXM 3CCJF 2HVYD 3CCRF 1X52A 3CC7F 1YI2F 1ZWZA 1M1KH 3OBYA 1VQ8F 1PXWA 1VQ5F 2FC3A 3J80M 3VMFB 1YJNF 1YJ9F 3CCLF 1VQNF 5IT9M 1X7PA 2OTLF 4LCKA 4C4WC 4TZZA 1K8AH 1E7KA 3G71F 1N8RH 3NMUC 5EWRA 1KC8H
chains in the Genus database with same CATH superfamily
5JCOC 1VQ6F 4BT3A 4TV9B 5EO3A 5FNVA 4BT2A 5EZYA 2KGWA 3RYHB 3NVKE 3OBWA 5JVDB 3WGKA 4U3JA 4I55B 3WXMB 4TV8A 3KJJA 3GTZA 5LP6A 4M8IA 1NQ3A 4ZOLB 1VQMF 3S06A 3CCEF 5LXTA 3MCAB 3CB2A 1T0KB 1H47A 3MDOA 1Q86H 2NMUA 3JALA 4G4ZA 1FSZA 3KIZA 3WJRA 4IHJB 3U0OA 3S03A 3WJPA 1KQSF 5LA6A 3G4SF 1PF5A 2F9ZC 3JARB 4EB6A 3RA6A 1YQNA 1Q82H 3C9TA 1IV4A 3M4SA 3UT5A 2W8BC 4BT4A 5GIPC 3ZOPA 4BT7A 3ZP4A 5IJ0A 1VQOF 5G4VC 2HX0A 3LFOA 5GONB 1OFUA 3CXCF 2Q1XA 1YJWF 5CA1B 5KMGA 3IEWA 2KTVA 3ZP7A 1ONIA 2Z1TA 3IKEA 5GAPK 3FBAA 2H8CA 2L26A 3RYFA 3GHZA 3JCMM 5CA0B 3CYPB 2CHSA 1GO0A 1RQ7A 3CPWF 3E20B 3M84A 1DBFA 3HKEB 4G4WA 1M90H 4NQ3A 1VQ4F 3JASA 3OONA 3MBMA 3RYCB 2FGYA 2LCAA 3CCVF 2VGNA 4B5CA 2QA4F 4O2BB 1JD1A 3HJWC 3KHNA 2BTUA 2B33A 3C9UA 3N4YA 4E6EA 3SIUA 3ERNA 3JAMM 2RHJA 3DDNA 4U3JB 1FFXA 4X1YA 1RQ2A 3C8LA 2GVIA 3CC4F 5ITZB 3WGNA 1RA4A 3TD5A 4ZI7B 1CN7A 2LBWA 4U39A 1JJ2F 5FLXM 3HKBB 3CCJF 2UZHA 3LDTA 1YI2F 4LNUA 1PXWA 1CLIA 3HTNA 3ELCA 3RYIA 3RE3A 4O4LB 5LA6B 3VOAA 4BT6A 3CCLF 1VH8A 1YJ9F 3FD6A 4LCKA 1X25A 4I50B 1SA0A 4BT5A 1E7KA 3JAKA 5JH7A 3G71F 3E22A 5G4UC 5IJ0B 1XV2A 3D00A 3ZO8A 2RB9A 2CHTA 2WALA 5BMVB 2HP0B 4HNAB 4X1IA 4ZHQA 3LWVC 3L7QA 1VQVA 1VQPF 1KNKA 2I6DA 1YHQF 1DT9A 3RYFB 2ZVYA 2RHOA 4X20A 3J81M 1XRGA 4FFBB 1VHAA 3V3TA 4BVTA 5KX5A 5LP6C 1UFYA 3Q8HA 5IYZA 5EAZA 1R1MA 3KE1A 3VIUA 2CW4A 3VYSC 3NK6A 3M1XA 5LYJA 3LWRC 1TVKA 5A2QM 4C8GA 5GINC 4I4TA 2LBTA 5HY2A 3WGMA 2UYNB 3CYQA 2Z1FA 1QU9A 1GO1A 1KNJA 2N48A 5HXZA 3VTIC 3ESJA 4DRXA 3N2GA 4ZK7A 5J2UA 5EIBC 5HY1A 2QI2A 3OW2F 1FNJA 2RHHA 1SDSA 1Q7YH 5EYPB 1U3LA 3JATA 3J7AR 2IQQA 1Z5VA 3HKDB 5MN6A 3JAKB 5JH7B 5C8YA 1YITF 5LOVA 2BO1A 1W55A 4BVQA 5B8FA 4X3LA 2Q1YA 1W40A 2OTMA 3CPQA 4KWEA 1NJIH 1VQLF 1IPAA 4YJ3B 1W5AA 4ZHQB 4O4JA 3B6NA 3LMEA 1W59A 3N4ZA 3GYQA 3G6EF 3PAFA 5MN4A 4X20B 3WGJA 5IJ9A 3IKFA 4X1KA 3CC7F 1TUBB 5KX5B 4RQOA 1U43A 3S0HA 4O2AA 2FC3A 4B62A 4O4HA 1YJNF 3C9RA 2IAFA 2IG8A 5FNVB 5EZYB 1T0AA 4C4WC 1JY8A 2BTOA 4ERHA 2Z01A 5GANK 4ZHYB 4TV8B 3VCZA 3FD5A 3VI6A 1XBIA 5LP6B 1GZ0A 3NK7A 3IMPA 3V7EA 5LXTB 1QVFF 3P0ZA 5J2UB 3P4EA 3JALB 2RHLA 3WGLA 4IIJA 1U40A 3CCQF 2ZAUA 2HP3A 3RYHA 2EWCA 5JVDA 1Q81H 1W2BF 2I6RA 4EB6B 4BW0B 4I55A 2UYKA 5MN5A 4BY9D 1IV1A 1S72F 3UT5B 1X7OA 4ZHVA 2H8EA 5C8YB 2ZF8A 5LOVB 3K14A 3RA5A 3NVIB 1H48A 4EI7A 5CB4A 2VAWA 1VQ7F 1W5BA 3C9SA 4F6RA 3QTYA 4DXDA 2Z1EA 5KMGB 3CC2F 4XCQA 3ON1A 3DC2A 1K73H 2CZWA 4O4JB 4IHJA 1NMUB 5HP8A 3HKCA 5JQGA 1W5FA 2VGMA 3LWOC 3KJKA 3N2KA 2OZBA 3BYQA 2HS4A 2KTUA 3FPIA 5HY4A 3CMEF 3SIVA 3JASB 5GONA 4O2AB 1Z5WA 4O4HB 3AGKA 2QEXF 3F0FA 5EB0A 4EI8A 2AMTA 3WPWA 2BTQB 1W42A 3WJQA 3CCUF 3D01A 1J7HA 4X1YB 1FFXB 5CA0A 3CMAF 1K9MH 3TD4A 5FJ4C 4TUYA 2MQEA 4NUTA 1U3PA 3K2XA 3V7QA 3VO8A 2ZOVA 3RYCA 2OHWA 3I7TA 3VYTC 1H7MA 3K0TA 4O2BA 5HXUA 4LNUB 3S0YA 2VXYA 2VAPA 4IIJB 4WBNA 3RYIB 3I56F 3MCQA 3CCMF 3T80A 2HVYD 3CCRF 1X52A 1YGYA 2Z1UA 1GX1A 5ITZA 3S02A 3OBYA 1SA0B 3JVHA 3VOBA 2CSLA 1VQ5F 2HS0A 4ZI7A 1JN1A 3J80M 2PMPA 3E22B 4C81A 4G4YA 3F6MA 1VQNF 2HRUA 2K1SA 3HKBA 1X7PA 5CB4B 2OTLF 5IT9M 5JCOA 1OAPA 4F6RB 1JFFA 2YXZA 4TZZA 4X1IB 4C82A 1Q8RA 3P10A 3NMUC 5EWRA 3I3FA 4O4LA 3HKCB 5JQGB 3S0WA 3JAWA 1YIJF 2VAMA 1UI9A 1KD1H 4I50A 5J2TA 1IV2A 3N2KB 2CVLA 2ZVZA 2G9IA 3TD3A 4R40B 3CD6F 2QTPA 3CG6A 5DCVA 4G88A 1ODEA 4G4XA 4X3MA 2HS3A 4C8IA 1RLGA 4YJ2A 2AIFA 1W5EA 5IYZB 5BMVA 4O4IA 2HP0A 2UYJA 4HNAA 3O85A 3PLAC 2P6YA 3F0EA 3EORA 3HAXD 1QAHA 5LYJB 1TVKB 5HY0A 2KG4A 4NWOB 3I55F 1QVGF 4I4TB 3FFMA 4FFBA 3V4DA 3LWPC 4TUYB 3LWQC 4B46A 1FNKA 2CWJA 2UYPA 2LBXA 3CCSF 3QHDA 1CK2A 1QD9A 2JNBA 2PHNA 3IEQA 4DRXB 3N2GB 1VQKF 4TV9A 2ALEA 4WBNB 1VQ9F 2AIZP 2DT4A 3JATB 4G4VA 2UYNA 1W57A 1COMA 4ZHWA 5AVMA 3F0GA 4ZOLA 5GIOC 2GLZA 3VYUC 4RHAA 4BVSA 4C8EA 3F0DA 1RLUA 1JFFB 2HQSC 2ZODA 3LYBA 2DYYA 5EYPA 3E1YA 3JARA 3JAWB 1W3EX 2R6R1 4BVRA 3IR9A 5J2TB 3HKDA 5IJ9B 3MQWA 4X1KB 1W41A 4YJ2B 3D54A 1XHOA 5CA1A 3K12A 4O4IB 4YJ3A 3QUWA 2OTJF 5EIBD 3HWUA 1ZWZA 1M1KH 5HP7A 1VQ8F 4PWTA 2R751 3VMFB 2YYEA 3R0PA 5HWEA 4EI9A 1IV3A 2HRYA 1TUBA 1SZQA 2V9YA 3HKEA 1VK3A 3WPXA 4B45A 1K8AH 1W581 2GZLA 1N8RH 2H6LA 1KC8H 5EB1B
chains in the Genus database with same CATH topology
5G4UC 5GANK 1VQ6F 3D00A 1YIJF 5EO3A 2WALA 3VI6A 1KD1H 1XBIA 1GZ0A 3NK7A 3NVKE 3CD6F 3OBWA 3LWVC 3V7EA 3CG6A 5DCVA 3WXMB 1VQPF 1QVFF 4X3MA 1RLGA 2I6DA 1YHQF 1DT9A 2AIFA 3CCQF 3J81M 1VQMF 3V3TA 1Q81H 3O85A 1W2BF 3PLAC 3CCEF 3MCAB 4BW0B 3HAXD 1T0KB 4BVTA 5HY0A 2KG4A 4BY9D 1Q86H 3I55F 1S72F 1X7OA 1QVGF 1KQSF 3G4SF 3FFMA 3RA5A 3LWPC 3NVIB 2F9ZC 4EI7A 3NK6A 3RA6A 3LWQC 1VQ7F 3LWRC 1Q82H 5A2QM 2LBXA 3CC2F 4XCQA 3ON1A 5GINC 3CCSF 5GIPC 1K73H 1CK2A 2CZWA 2JNBA 1NMUB 5HY2A 5G4VC 1VQOF 2VGMA 1VQKF 3LFOA 2ALEA 3LWOC 3CXCF 1YJWF 1GO1A 2OZBA 2KTUA 1VQ9F 2KTVA 5HXZA 5GAPK 5HY1A 5HY4A 2QI2A 3CMEF 3OW2F 3SIVA 3JCMM 1Q7YH 1SDSA 1GO0A 5GIOC 3AGKA 3CPWF 2GLZA 3E20B 4EI8A 2QEXF 4BVSA 3J7AR 1W42A 1M90H 4NQ3A 1VQ4F 3CCUF 2FGYA 3CCVF 2VGNA 1YITF 3CMAF 1K9MH 2BO1A 2QA4F 3E1YA 4BVQA 5FJ4C 1W3EX 4X3LA 3HJWC 4NUTA 4BVRA 1W40A 3CPQA 3IR9A 3N4YA 1NJIH 1VQLF 3V7QA 1IPAA 3SIUA 3JAMM 2OHWA 1H7MA 3CC4F 5HXUA 1RA4A 1W41A 3N4ZA 3GYQA 3G6EF 1CN7A 3I56F 3PAFA 3CCMF 2LBWA 2OTJF 1JJ2F 5FLXM 3CCJF 2HVYD 3CCRF 1X52A 3CC7F 1YI2F 1ZWZA 1M1KH 3OBYA 1VQ8F 1PXWA 1VQ5F 2FC3A 3J80M 3VMFB 5HWEA 1YJNF 1YJ9F 3CCLF 4EI9A 1VQNF 5IT9M 1X7PA 2OTLF 4LCKA 4C4WC 4TZZA 1K8AH 1E7KA 3G71F 1N8RH 3NMUC 5EWRA 1KC8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4U C;  5GAN K;  1VQ6 F;  1YIJ F;  5EO3 A;  2WAL A;  3VI6 A;  1KD1 H;  1XBI A;  1GZ0 A;  3NK7 A;  3NVK E;  3CD6 F;  3OBW A;  3LWV C;  3V7E A;  3CG6 A;  5DCV A;  3WXM B;  1VQP F;  1QVF F;  4X3M A;  1RLG A;  2I6D A;  1YHQ F;  1DT9 A;  2AIF A;  3CCQ F;  3J81 M;  1VQM F;  1Q81 H;  3O85 A;  1W2B F;  3PLA C;  3CCE F;  3MCA B;  4BW0 B;  3HAX D;  1T0K B;  2KG4 A;  4BY9 D;  1Q86 H;  3I55 F;  1S72 F;  1X7O A;  1QVG F;  1KQS F;  3G4S F;  3FFM A;  3RA5 A;  3LWP C;  3NVI B;  3NK6 A;  3RA6 A;  3LWQ C;  1VQ7 F;  3LWR C;  1Q82 H;  5A2Q M;  2LBX A;  3CC2 F;  5GIN C;  3ON1 A;  3CCS F;  5GIP C;  1K73 H;  1CK2 A;  2CZW A;  2JNB A;  1NMU B;  1VQO F;  5G4V C;  2VGM A;  1VQK F;  3LFO A;  2ALE A;  3LWO C;  3CXC F;  1YJW F;  1GO1 A;  2OZB A;  2KTU A;  1VQ9 F;  2KTV A;  5GAP K;  2QI2 A;  3CME F;  3OW2 F;  3SIV A;  3JCM M;  1Q7Y H;  1SDS A;  1GO0 A;  5GIO C;  3AGK A;  3CPW F;  3E20 B;  2QEX F;  3J7A R;  1W42 A;  1M90 H;  1VQ4 F;  3CCU F;  3CCV F;  2VGN A;  1YIT F;  3CMA F;  1K9M H;  2BO1 A;  2QA4 F;  3E1Y A;  5FJ4 C;  1W3E X;  4X3L A;  3HJW C;  4NUT A;  1W40 A;  3CPQ A;  3IR9 A;  3N4Y A;  1NJI H;  1VQL F;  3V7Q A;  1IPA A;  3SIU A;  3JAM M;  2OHW A;  1H7M A;  3CC4 F;  1RA4 A;  1W41 A;  3N4Z A;  3GYQ A;  3G6E F;  1CN7 A;  3I56 F;  3PAF A;  3CCM F;  2LBW A;  2OTJ F;  1JJ2 F;  5FLX M;  3CCJ F;  2HVY D;  3CCR F;  1X52 A;  3CC7 F;  1YI2 F;  1ZWZ A;  1M1K H;  3OBY A;  1VQ8 F;  1PXW A;  1VQ5 F;  2FC3 A;  3J80 M;  3VMF B;  1YJN F;  1YJ9 F;  3CCL F;  1VQN F;  5IT9 M;  1X7P A;  2OTL F;  4LCK A;  4C4W C;  4TZZ A;  1K8A H;  1E7K A;  3G71 F;  1N8R H;  3NMU C;  5EWR A;  1KC8 H; 
#chains in the Genus database with same CATH topology
 5JCO C;  1VQ6 F;  4BT3 A;  4TV9 B;  5EO3 A;  5FNV A;  4BT2 A;  5EZY A;  2KGW A;  3RYH B;  3NVK E;  3OBW A;  5JVD B;  3WGK A;  4U3J A;  4I55 B;  3WXM B;  4TV8 A;  3KJJ A;  3GTZ A;  5LP6 A;  4M8I A;  1NQ3 A;  4ZOL B;  1VQM F;  3S06 A;  3CCE F;  5LXT A;  3MCA B;  3CB2 A;  1T0K B;  1H47 A;  3MDO A;  1Q86 H;  2NMU A;  3JAL A;  4G4Z A;  1FSZ A;  3KIZ A;  3WJR A;  4IHJ B;  3U0O A;  3S03 A;  3WJP A;  1KQS F;  5LA6 A;  3G4S F;  1PF5 A;  2F9Z C;  3JAR B;  4EB6 A;  3RA6 A;  1YQN A;  1Q82 H;  3C9T A;  1IV4 A;  3M4S A;  3UT5 A;  2W8B C;  4BT4 A;  5GIP C;  3ZOP A;  4BT7 A;  3ZP4 A;  5IJ0 A;  1VQO F;  5G4V C;  2HX0 A;  3LFO A;  5GON B;  1OFU A;  3CXC F;  2Q1X A;  1YJW F;  5CA1 B;  5KMG A;  3IEW A;  2KTV A;  3ZP7 A;  1ONI A;  2Z1T A;  3IKE A;  5GAP K;  3FBA A;  2H8C A;  2L26 A;  3RYF A;  3GHZ A;  3JCM M;  5CA0 B;  3CYP B;  2CHS A;  1GO0 A;  1RQ7 A;  3CPW F;  3E20 B;  3M84 A;  1DBF A;  3HKE B;  4G4W A;  1M90 H;  4NQ3 A;  1VQ4 F;  3JAS A;  3OON A;  3MBM A;  3RYC B;  2FGY A;  2LCA A;  3CCV F;  2VGN A;  4B5C A;  2QA4 F;  4O2B B;  1JD1 A;  3HJW C;  3KHN A;  2BTU A;  2B33 A;  3C9U A;  3N4Y A;  4E6E A;  3SIU A;  3ERN A;  3JAM M;  2RHJ A;  3DDN A;  4U3J B;  1FFX A;  4X1Y A;  1RQ2 A;  3C8L A;  2GVI A;  3CC4 F;  5ITZ B;  3WGN A;  1RA4 A;  3TD5 A;  4ZI7 B;  1CN7 A;  2LBW A;  4U39 A;  1JJ2 F;  5FLX M;  3HKB B;  3CCJ F;  2UZH A;  3LDT A;  1YI2 F;  4LNU A;  1PXW A;  1CLI A;  3HTN A;  3ELC A;  3RYI A;  3RE3 A;  4O4L B;  5LA6 B;  3VOA A;  4BT6 A;  3CCL F;  1VH8 A;  1YJ9 F;  3FD6 A;  4LCK A;  1X25 A;  4I50 B;  1SA0 A;  4BT5 A;  1E7K A;  3JAK A;  5JH7 A;  3G71 F;  3E22 A;  5G4U C;  5IJ0 B;  1XV2 A;  3D00 A;  3ZO8 A;  2RB9 A;  2CHT A;  2WAL A;  5BMV B;  2HP0 B;  4HNA B;  4X1I A;  4ZHQ A;  3LWV C;  3L7Q A;  1VQV A;  1VQP F;  1KNK A;  2I6D A;  1YHQ F;  1DT9 A;  3RYF B;  2ZVY A;  2RHO A;  4X20 A;  3J81 M;  1XRG A;  4FFB B;  1VHA A;  3V3T A;  4BVT A;  5KX5 A;  5LP6 C;  1UFY A;  3Q8H A;  5IYZ A;  5EAZ A;  1R1M A;  3KE1 A;  3VIU A;  2CW4 A;  3VYS C;  3NK6 A;  3M1X A;  5LYJ A;  3LWR C;  1TVK A;  5A2Q M;  4C8G A;  5GIN C;  4I4T A;  2LBT A;  5HY2 A;  3WGM A;  2UYN B;  3CYQ A;  2Z1F A;  1QU9 A;  1GO1 A;  1KNJ A;  2N48 A;  5HXZ A;  3VTI C;  3ESJ A;  4DRX A;  3N2G A;  4ZK7 A;  5J2U A;  5EIB C;  5HY1 A;  2QI2 A;  3OW2 F;  1FNJ A;  2RHH A;  1SDS A;  1Q7Y H;  5EYP B;  1U3L A;  3JAT A;  3J7A R;  2IQQ A;  1Z5V A;  3HKD B;  5MN6 A;  3JAK B;  5JH7 B;  5C8Y A;  1YIT F;  5LOV A;  2BO1 A;  1W55 A;  4BVQ A;  5B8F A;  4X3L A;  2Q1Y A;  1W40 A;  2OTM A;  3CPQ A;  4KWE A;  1NJI H;  1VQL F;  1IPA A;  4YJ3 B;  1W5A A;  4ZHQ B;  4O4J A;  3B6N A;  3LME A;  1W59 A;  3N4Z A;  3GYQ A;  3G6E F;  3PAF A;  5MN4 A;  4X20 B;  3WGJ A;  5IJ9 A;  3IKF A;  4X1K A;  3CC7 F;  1TUB B;  5KX5 B;  4RQO A;  1U43 A;  3S0H A;  4O2A A;  2FC3 A;  4B62 A;  4O4H A;  1YJN F;  3C9R A;  2IAF A;  2IG8 A;  5FNV B;  5EZY B;  1T0A A;  4C4W C;  1JY8 A;  2BTO A;  4ERH A;  2Z01 A;  5GAN K;  4ZHY B;  4TV8 B;  3VCZ A;  3FD5 A;  3VI6 A;  1XBI A;  5LP6 B;  1GZ0 A;  3NK7 A;  3IMP A;  3V7E A;  5LXT B;  1QVF F;  3P0Z A;  5J2U B;  3P4E A;  3JAL B;  2RHL A;  3WGL A;  4IIJ A;  1U40 A;  3CCQ F;  2ZAU A;  2HP3 A;  3RYH A;  2EWC A;  5JVD A;  1Q81 H;  1W2B F;  2I6R A;  4EB6 B;  4BW0 B;  4I55 A;  2UYK A;  5MN5 A;  4BY9 D;  1IV1 A;  1S72 F;  3UT5 B;  1X7O A;  4ZHV A;  2H8E A;  5C8Y B;  2ZF8 A;  5LOV B;  3K14 A;  3RA5 A;  3NVI B;  1H48 A;  4EI7 A;  5CB4 A;  2VAW A;  1VQ7 F;  1W5B A;  3C9S A;  4F6R A;  3QTY A;  4DXD A;  2Z1E A;  5KMG B;  3CC2 F;  4XCQ A;  3ON1 A;  3DC2 A;  1K73 H;  2CZW A;  4O4J B;  4IHJ A;  1NMU B;  5HP8 A;  3HKC A;  5JQG A;  1W5F A;  2VGM A;  3LWO C;  3KJK A;  3N2K A;  2OZB A;  3BYQ A;  2HS4 A;  2KTU A;  3FPI A;  5HY4 A;  3CME F;  3SIV A;  3JAS B;  5GON A;  4O2A B;  1Z5W A;  4O4H B;  3AGK A;  2QEX F;  3F0F A;  5EB0 A;  4EI8 A;  2AMT A;  3WPW A;  2BTQ B;  1W42 A;  3WJQ A;  3CCU F;  3D01 A;  1J7H A;  4X1Y B;  1FFX B;  5CA0 A;  3CMA F;  1K9M H;  3TD4 A;  5FJ4 C;  4TUY A;  2MQE A;  4NUT A;  1U3P A;  3K2X A;  3V7Q A;  3VO8 A;  2ZOV A;  3RYC A;  2OHW A;  3I7T A;  3VYT C;  1H7M A;  3K0T A;  4O2B A;  5HXU A;  4LNU B;  3S0Y A;  2VXY A;  2VAP A;  4IIJ B;  4WBN A;  3RYI B;  3I56 F;  3MCQ A;  3CCM F;  3T80 A;  2HVY D;  3CCR F;  1X52 A;  1YGY A;  2Z1U A;  1GX1 A;  5ITZ A;  3S02 A;  3OBY A;  1SA0 B;  3JVH A;  3VOB A;  2CSL A;  1VQ5 F;  2HS0 A;  4ZI7 A;  1JN1 A;  3J80 M;  2PMP A;  3E22 B;  4C81 A;  4G4Y A;  3F6M A;  1VQN F;  2HRU A;  2K1S A;  3HKB A;  1X7P A;  5CB4 B;  2OTL F;  5IT9 M;  5JCO A;  1OAP A;  4F6R B;  1JFF A;  2YXZ A;  4TZZ A;  4X1I B;  4C82 A;  1Q8R A;  3P10 A;  3NMU C;  5EWR A;  3I3F A;  4O4L A;  3HKC B;  5JQG B;  3S0W A;  3JAW A;  1YIJ F;  2VAM A;  1UI9 A;  1KD1 H;  4I50 A;  5J2T A;  1IV2 A;  3N2K B;  2CVL A;  2ZVZ A;  2G9I A;  3TD3 A;  4R40 B;  3CD6 F;  2QTP A;  3CG6 A;  5DCV A;  4G88 A;  1ODE A;  4G4X A;  4X3M A;  2HS3 A;  4C8I A;  1RLG A;  4YJ2 A;  2AIF A;  1W5E A;  5IYZ B;  5BMV A;  4O4I A;  2HP0 A;  2UYJ A;  4HNA A;  3O85 A;  3PLA C;  2P6Y A;  3F0E A;  3EOR A;  3HAX D;  1QAH A;  5LYJ B;  1TVK B;  5HY0 A;  2KG4 A;  4NWO B;  3I55 F;  1QVG F;  4I4T B;  3FFM A;  4FFB A;  3V4D A;  3LWP C;  4TUY B;  3LWQ C;  4B46 A;  1FNK A;  2CWJ A;  2UYP A;  2LBX A;  3CCS F;  3QHD A;  1CK2 A;  1QD9 A;  2JNB A;  2PHN A;  3IEQ A;  4DRX B;  3N2G B;  1VQK F;  4TV9 A;  2ALE A;  4WBN B;  1VQ9 F;  2AIZ P;  2DT4 A;  3JAT B;  4G4V A;  2UYN A;  1W57 A;  1COM A;  4ZHW A;  5AVM A;  3F0G A;  4ZOL A;  5GIO C;  2GLZ A;  3VYU C;  4RHA A;  4BVS A;  4C8E A;  3F0D A;  1RLU A;  1JFF B;  2HQS C;  2ZOD A;  3LYB A;  2DYY A;  5EYP A;  3E1Y A;  3JAR A;  3JAW B;  1W3E X;  2R6R 1;  4BVR A;  3IR9 A;  5J2T B;  3HKD A;  5IJ9 B;  3MQW A;  4X1K B;  1W41 A;  4YJ2 B;  3D54 A;  1XHO A;  5CA1 A;  3K12 A;  4O4I B;  4YJ3 A;  3QUW A;  2OTJ F;  5EIB D;  3HWU A;  1ZWZ A;  1M1K H;  5HP7 A;  1VQ8 F;  4PWT A;  2R75 1;  3VMF B;  2YYE A;  3R0P A;  5HWE A;  4EI9 A;  1IV3 A;  2HRY A;  1TUB A;  1SZQ A;  2V9Y A;  3HKE A;  1VK3 A;  3WPX A;  4B45 A;  1K8A H;  1W58 1;  2GZL A;  1N8R H;  2H6L A;  1KC8 H;  5EB1 B; 
#chains in the Genus database with same CATH homology
 5G4U C;  5GAN K;  1VQ6 F;  3D00 A;  1YIJ F;  5EO3 A;  2WAL A;  3VI6 A;  1KD1 H;  1XBI A;  1GZ0 A;  3NK7 A;  3NVK E;  3CD6 F;  3OBW A;  3LWV C;  3V7E A;  3CG6 A;  5DCV A;  3WXM B;  1VQP F;  1QVF F;  4X3M A;  1RLG A;  2I6D A;  1YHQ F;  1DT9 A;  2AIF A;  3CCQ F;  3J81 M;  1VQM F;  3V3T A;  1Q81 H;  3O85 A;  1W2B F;  3PLA C;  3CCE F;  3MCA B;  4BW0 B;  3HAX D;  1T0K B;  4BVT A;  5HY0 A;  2KG4 A;  4BY9 D;  1Q86 H;  3I55 F;  1S72 F;  1X7O A;  1QVG F;  1KQS F;  3G4S F;  3FFM A;  3RA5 A;  3LWP C;  3NVI B;  2F9Z C;  4EI7 A;  3NK6 A;  3RA6 A;  3LWQ C;  1VQ7 F;  3LWR C;  1Q82 H;  5A2Q M;  2LBX A;  3CC2 F;  4XCQ A;  3ON1 A;  5GIN C;  3CCS F;  5GIP C;  1K73 H;  1CK2 A;  2CZW A;  2JNB A;  1NMU B;  5HY2 A;  5G4V C;  1VQO F;  2VGM A;  1VQK F;  3LFO A;  2ALE A;  3LWO C;  3CXC F;  1YJW F;  1GO1 A;  2OZB A;  2KTU A;  1VQ9 F;  2KTV A;  5HXZ A;  5GAP K;  5HY1 A;  5HY4 A;  2QI2 A;  3CME F;  3OW2 F;  3SIV A;  3JCM M;  1Q7Y H;  1SDS A;  1GO0 A;  5GIO C;  3AGK A;  3CPW F;  2GLZ A;  3E20 B;  4EI8 A;  2QEX F;  4BVS A;  3J7A R;  1W42 A;  1M90 H;  4NQ3 A;  1VQ4 F;  3CCU F;  2FGY A;  3CCV F;  2VGN A;  1YIT F;  3CMA F;  1K9M H;  2BO1 A;  2QA4 F;  3E1Y A;  4BVQ A;  5FJ4 C;  1W3E X;  4X3L A;  3HJW C;  4NUT A;  4BVR A;  1W40 A;  3CPQ A;  3IR9 A;  3N4Y A;  1NJI H;  1VQL F;  3V7Q A;  1IPA A;  3SIU A;  3JAM M;  2OHW A;  1H7M A;  3CC4 F;  5HXU A;  1RA4 A;  1W41 A;  3N4Z A;  3GYQ A;  3G6E F;  1CN7 A;  3I56 F;  3PAF A;  3CCM F;  2LBW A;  2OTJ F;  1JJ2 F;  5FLX M;  3CCJ F;  2HVY D;  3CCR F;  1X52 A;  3CC7 F;  1YI2 F;  1ZWZ A;  1M1K H;  3OBY A;  1VQ8 F;  1PXW A;  1VQ5 F;  2FC3 A;  3J80 M;  3VMF B;  5HWE A;  1YJN F;  1YJ9 F;  3CCL F;  4EI9 A;  1VQN F;  5IT9 M;  1X7P A;  2OTL F;  4LCK A;  4C4W C;  4TZZ A;  1K8A H;  1E7K A;  3G71 F;  1N8R H;  3NMU C;  5EWR A;  1KC8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...