1NJIH

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1njiH00
3I55F 3J80M 2ALEA 1VQ4F 1NMUB 3CC7F 3VI6A 1RA4A 1K73H 2OTJF 3AGKA 3CG6A 3LWPC 1CK2A 3NVKE 1X52A 3CCUF 2VGMA 3LWVC 3CXCF 3CCJF 2OHWA 3V7QA 1Q82H 1VQ7F 3HAXD 3CCEF 1S72F 2KTVA 1PXWA 5GIOC 3CCSF 1N8RH 3SIUA 3CCQF 4BW0B 1W2BF 3PLAC 4TZZA 3NK7A 3JCMM 2LBXA 1VQLF 1SDSA 5GAPK 1VQ9F 1CN7A 5GIPC 1GO0A 3LWRC 1X7OA 1RLGA 1YJNF 1DT9A 1YJ9F 3CD6F 5EWRA 1GZ0A 1W3EX 5FJ4C 3GYQA 1VQNF 3LWQC 3E20B 3MCAB 1NJIH 1E7KA 1Q7YH 1YJWF 1YHQF 5FLXM 1ZWZA 5GANK 1VQ5F 3NVIB 3N4YA 3CMEF 2LBWA 3OBWA 5G4UC 1YITF 3CCLF 3CCMF 3N4ZA 1W41A 2BO1A 2FC3A 4X3MA 3RA6A 3IR9A 1YI2F 1Q86H 3G4SF 3HJWC 3E1YA 1KC8H 3JAMM 3RA5A 1T0KB 3V7EA 1VQ6F 2HVYD 2VGNA 5EO3A 2KTUA 3ON1A 4BY9D 3OBYA 2QEXF 3G71F 1W42A 3NK6A 5A2QM 3VMFB 2AIFA 1W40A 1JJ2F 5IT9M 5GINC 1M1KH 3CMAF 4C4WC 1Q81H 1X7PA 3CC4F 4LCKA 1IPAA 3PAFA 1KD1H 2OTLF 3O85A 3CPQA 3CPWF 3FFMA 4X3LA 1VQPF 3J7AR 3LWOC 1VQ8F 1H7MA 2WALA 2CZWA 3WXMB 2OZBA 1QVFF 1QVGF 4NUTA 3I56F 1M90H 3OW2F 1K9MH 3SIVA 2JNBA 3J81M 5G4VC 1XBIA 1GO1A 3CCVF 2QA4F 3NMUC 3CC2F 3CCRF 1YIJF 1KQSF 1VQOF 5DCVA 2KG4A 2I6DA 2QI2A 3LFOA 3G6EF 1VQKF 1K8AH 1VQMF
chains in the Genus database with same CATH superfamily
4DRXA 3J80M 3VOBA 4X1YB 1NMUB 3VYSC 3CC7F 3I7TA 1RA4A 1YQNA 5AVMA 3WJPA 3N2KA 5J2TA 3CG6A 3LWPC 3NVKE 4X1KB 3JARA 1PF5A 5JVDB 4BVRA 3CB2A 2YXZA 3V7QA 1VQ7F 3HAXD 3IMPA 3CCEF 1S72F 4FFBA 4KWEA 5J2UB 2KTVA 1PXWA 3JATB 3ZP7A 2RB9A 3MBMA 3D01A 3NK7A 4G4VA 4G4WA 2LBXA 5JQGA 4ZHYB 5GONA 1VQ9F 5JCOC 2R751 1RLGA 3D00A 3JALA 3KIZA 5LYJB 1IV2A 5EWRA 2UYPA 1VQNF 3E20B 4TV8A 3JAKB 4C81A 1Q7YH 1YJWF 1ODEA 3JAWA 3QUWA 4LNUA 3MQWA 1FSZA 3NVIB 3N4YA 3HKBB 3RYCB 3CMEF 2LBWA 3HKEB 5EZYB 3FPIA 3CCLF 5C8YA 2PMPA 3HKCA 3KHNA 2HP0B 3RA6A 4ERHA 3HJWC 3WGLA 2YYEA 1VHAA 1T0KB 2VGNA 1U40A 3ON1A 2ZVZA 4C8IA 2LBTA 5A2QM 3RYFB 4BT3A 1XV2A 3S0HA 1FNKA 1JN1A 1JFFB 5BMVB 5IT9M 5LOVB 3UT5B 4C4WC 4I55B 1X7PA 2LCAA 1R1MA 2IQQA 2HRUA 4IIJB 3DDNA 3F0FA 1IPAA 2OTLF 1KD1H 2BTUA 3HKDB 1VQPF 3FFMA 4X3LA 3JAKA 1QVFF 1QVGF 3I56F 1M90H 5B8FA 1J7HA 5EB1B 5HWEA 3RYCA 3CYPB 3HKEA 5LP6A 1SA0B 3J81M 5FNVB 3WGNA 5HP7A 5EZYA 5MN4A 2UZHA 3S0YA 1SZQA 3CCVF 4TV9B 5IJ9B 2GVIA 3NMUC 3MCQA 3ELCA 5IYZB 1OFUA 5HXUA 1VQOF 5DCVA 3C8LA 4NQ3A 1VQKF 1RQ7A 3QTYA 2ALEA 1TUBB 4IHJB 3VI6A 4EI8A 2OTJF 3RYHB 3AGKA 3WPXA 3RYFA 4B46A 3CCUF 2OHWA 3K12A 1Q82H 5LOVA 3UT5A 2UYNB 2ZVYA 5LA6B 4I55A 1U43A 1IV3A 1IV1A 3LMEA 3SIUA 3CCQF 4BW0B 3WGMA 2AIZP 1RLUA 4IIJA 1KNJA 4BT2A 1OAPA 4F6RB 3LWRC 1X7OA 3QHDA 5HY1A 5ITZA 1SA0A 5FJ4C 1W3EX 3FD5A 4TV9A 1T0AA 5IJ9A 3MCAB 1VK3A 1W581 5IYZA 3WGKA 4U3JB 4I4TA 1YHQF 1VQ5F 3K14A 3OBWA 2CSLA 3Q8HA 4G4ZA 1W55A 3N4ZA 4ZI7B 4EI9A 3IKFA 2FC3A 4X3MA 3IR9A 3F0EA 2H8CA 4PWTA 3F6MA 1Z5VA 5KMGB 5EIBD 4DXDA 3JAMM 5LA6A 4BT6A 2RHLA 2HVYD 3C9UA 3ZOPA 2H6LA 2W8BC 4I50B 2QEXF 2L26A 1TVKB 3C9SA 4M8IA 4EB6B 3G71F 2Q1YA 2AIFA 1W40A 4O4HB 4G88A 3P4EA 4HNAA 2VAWA 2HS4A 5GINC 1M1KH 3C9TA 1Q81H 1NQ3A 3K0TA 4O2BB 4X1YA 5LXTB 2HP3A 1X25A 3P0ZA 5HY4A 5IJ0B 4O2AB 4X1KA 1U3PA 3S02A 3KE1A 5JVDA 3ESJA 1VQ8F 1JD1A 2WALA 3GHZA 4G4XA 1QD9A 5J2UA 3U0OA 1Q8RA 2CW4A 3JATA 1K9MH 3L7QA 2BTOA 3TD5A 5G4VC 1XBIA 1GO1A 3JASB 3N2GB 2QA4F 1U3LA 4ZI7A 4YJ3B 2VXYA 3CC2F 3ZP4A 4R40B 2KG4A 1COMA 2HS3A 3S06A 5KMGA 5LYJA 2GLZA 2RHJA 4I50A 5HY0A 1K73H 5CB4B 1X52A 3LWVC 2DT4A 3HKBA 1KNKA 3FBAA 2AMTA 3IEWA 2Z1FA 1UFYA 3GTZA 4O2BA 4ZHVA 4O4IB 5GIOC 5LXTA 3CCSF 4X1IB 1W2BF 3PLAC 4TZZA 4O2AA 2HP0A 3JCMM 5CA0B 5HY2A 4E6EA 3D54A 3JVHA 1XHOA 1DBFA 4YJ2B 1DT9A 4TUYB 4DRXB 1GZ0A 4X20B 5CA1B 3N2GA 1W5AA 3LWQC 4U39A 4YJ3A 1W5BA 3B6NA 3P10A 1E7KA 3N2KB 2G9IA 1JFFA 5BMVA 4ZK7A 2FGYA 3KJJA 3JARB 4O4JB 4XCQA 4B5CA 5GANK 4O4LB 5JH7B 2F9ZC 1K8AH 3K2XA 3HKDA 2Q1XA 3CCMF 1W41A 1FFXB 4ZOLB 1Q86H 1JY8A 3ZO8A 5HXZA 5JQGB 4B45A 5JCOA 3E1YA 1KC8H 2KGWA 5GONB 3RA5A 3V7EA 5FNVA 1XRGA 5EO3A 3F0GA 2KTUA 3JALB 5LP6C 4O4IA 4X1IA 1W42A 2IAFA 3IEQA 3VMFB 2HS0A 4WBNB 3V3TA 5EYPB 1CLIA 3CMAF 2K1SA 1TUBA 4IHJA 4TUYA 4LCKA 4X20A 3BYQA 3RYHA 5CA1A 1W5EA 3S03A 5C8YB 3O85A 3CPQA 3V4DA 3VIUA 3HKCB 3LWOC 2R6R1 1H7MA 3ERNA 2UYNA 5HP8A 3RYIB 4O4JA 3VO8A 3VTIC 5KX5B 4O4LA 2H8EA 4C82A 5JH7A 2JNBA 1RQ2A 3M84A 2Z01A 5EAZA 3S0WA 3CCRF 1YIJF 1FFXA 2RHOA 3TD4A 4ZOLA 4F6RA 5MN5A 2QI2A 2RHHA 3M4SA 3I55F 1W59A 1IV4A 1W5FA 1VQ4F 3VCZA 3VYTC 3OONA 4U3JA 1CK2A 2BTQB 2GZLA 2VGMA 2ZF8A 3MDOA 2Z1TA 3WJQA 3EORA 3CXCF 4WBNA 3WGJA 3CCJF 5EYPA 5MN6A 1N8RH 2Z1EA 5LP6B 4BT7A 2HQSC 4C8GA 1W57A 1YGYA 3CYQA 1VQLF 3HWUA 3WJRA 3KJKA 1SDSA 5GAPK 3DC2A 3RYIA 1CN7A 5GIPC 1GO0A 5KX5A 1YJNF 3HTNA 4G4YA 1YJ9F 3CD6F 1TVKA 2MQEA 2UYJA 4EB6A 3FD6A 3GYQA 3I3FA 1H48A 2VAMA 4O4HA 1NJIH 1H47A 4ZHQB 2I6RA 2CWJA 2ZOVA 4BVTA 5FLXM 1ZWZA 3E22B 2ZODA 3RE3A 5EIBC 2IG8A 3TD3A 5G4UC 1VQVA 5IJ0A 1YITF 4NWOB 4BVSA 2CVLA 2BO1A 1YI2F 4C8EA 3G4SF 3G6EF 1QAHA 3M1XA 2EWCA 1VQ6F 2NMUA 3JASA 3OBYA 5ITZB 4BY9D 3C9RA 3R0PA 2CHSA 2B33A 3NK6A 5J2TB 2HX0A 3LDTA 2DYYA 1Z5WA 4BT5A 1JJ2F 4I4TB 2V9YA 1VH8A 4BT4A 1UI9A 3LYBA 4FFBB 1ONIA 2ZAUA 3VYUC 3CC4F 3F0DA 1FNJA 4B62A 5CB4A 3PAFA 3CPWF 3T80A 3J7AR 4ZHQA 2OTMA 4BVQA 2CZWA 3WXMB 2OZBA 4NUTA 2P6YA 3OW2F 1GX1A 3E22A 2PHNA 1QU9A 3SIVA 2HRYA 3IKEA 4EI7A 3VOAA 5CA0A 2QTPA 2UYKA 4TV8B 3WPWA 1KQSF 4RHAA 2N48A 2VAPA 2CHTA 2I6DA 3JAWB 3LFOA 4LNUB 5EB0A 4HNAB 4YJ2A 2Z1UA 4RQOA 4ZHWA 1VQMF
chains in the Genus database with same CATH topology
3I55F 3J80M 2GLZA 2ALEA 1VQ4F 1NMUB 5HY0A 3CC7F 3VI6A 1RA4A 4EI8A 1K73H 2OTJF 3AGKA 3CG6A 3LWPC 1CK2A 3NVKE 1X52A 3CCUF 2VGMA 3LWVC 4BVRA 3CXCF 3CCJF 2OHWA 3V7QA 1Q82H 1VQ7F 3HAXD 3CCEF 1S72F 2KTVA 1PXWA 5GIOC 3CCSF 1N8RH 3SIUA 3CCQF 4BW0B 1W2BF 3PLAC 4TZZA 3NK7A 3JCMM 2LBXA 1VQLF 5HY2A 1SDSA 5GAPK 1VQ9F 1CN7A 5GIPC 1GO0A 3LWRC 1X7OA 1RLGA 5HY1A 1DT9A 3D00A 1YJNF 1YJ9F 3CD6F 5EWRA 1GZ0A 1W3EX 5FJ4C 3GYQA 1VQNF 3LWQC 3E20B 3MCAB 1NJIH 1E7KA 1Q7YH 2FGYA 1YJWF 1YHQF 5FLXM 4BVTA 4XCQA 1ZWZA 5GANK 1VQ5F 3NVIB 3N4YA 3CMEF 2LBWA 2F9ZC 3OBWA 5G4UC 1YITF 3CCLF 4BVSA 3CCMF 3N4ZA 4EI9A 1W41A 2BO1A 2FC3A 4X3MA 3RA6A 3IR9A 1YI2F 1Q86H 5HXZA 3G4SF 3HJWC 3E1YA 1KC8H 3JAMM 3RA5A 1T0KB 3V7EA 1VQ6F 2HVYD 2VGNA 5EO3A 2KTUA 3ON1A 4BY9D 3OBYA 2QEXF 3G71F 1W42A 3NK6A 5A2QM 3VMFB 2AIFA 1W40A 1JJ2F 5IT9M 3V3TA 5GINC 1M1KH 3CMAF 4C4WC 1Q81H 1X7PA 3CC4F 4LCKA 5HY4A 1IPAA 3PAFA 1KD1H 2OTLF 3O85A 3CPQA 3CPWF 3FFMA 4X3LA 1VQPF 3J7AR 3LWOC 1VQ8F 1H7MA 2WALA 2CZWA 4BVQA 3WXMB 2OZBA 1QVGF 1QVFF 4NUTA 3I56F 1M90H 3OW2F 1K9MH 5HWEA 3SIVA 2JNBA 3J81M 4EI7A 5G4VC 1XBIA 1GO1A 3CCVF 2QA4F 3NMUC 3CC2F 3CCRF 1YIJF 5HXUA 1KQSF 1VQOF 5DCVA 2KG4A 2I6DA 2QI2A 3LFOA 4NQ3A 3G6EF 1VQKF 1K8AH 1VQMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 F;  3J80 M;  2ALE A;  1VQ4 F;  1NMU B;  3CC7 F;  3VI6 A;  1RA4 A;  1K73 H;  2OTJ F;  3AGK A;  3CG6 A;  3LWP C;  1CK2 A;  3NVK E;  1X52 A;  3CCU F;  2VGM A;  3LWV C;  3CXC F;  3CCJ F;  2OHW A;  3V7Q A;  1Q82 H;  1VQ7 F;  3HAX D;  3CCE F;  1S72 F;  2KTV A;  1PXW A;  5GIO C;  3CCS F;  1N8R H;  3SIU A;  3CCQ F;  4BW0 B;  1W2B F;  3PLA C;  4TZZ A;  3NK7 A;  3JCM M;  2LBX A;  1VQL F;  1SDS A;  5GAP K;  1VQ9 F;  1CN7 A;  5GIP C;  1GO0 A;  3LWR C;  1X7O A;  1RLG A;  1YJN F;  1DT9 A;  1YJ9 F;  3CD6 F;  5EWR A;  1GZ0 A;  1W3E X;  5FJ4 C;  3GYQ A;  1VQN F;  3LWQ C;  3E20 B;  3MCA B;  1NJI H;  1E7K A;  1Q7Y H;  1YJW F;  1YHQ F;  5FLX M;  1ZWZ A;  5GAN K;  1VQ5 F;  3NVI B;  3N4Y A;  3CME F;  2LBW A;  3OBW A;  5G4U C;  1YIT F;  3CCL F;  3CCM F;  3N4Z A;  1W41 A;  2BO1 A;  2FC3 A;  4X3M A;  3RA6 A;  3IR9 A;  1YI2 F;  1Q86 H;  3G4S F;  3HJW C;  3E1Y A;  1KC8 H;  3JAM M;  3RA5 A;  1T0K B;  3V7E A;  1VQ6 F;  2HVY D;  2VGN A;  5EO3 A;  2KTU A;  3ON1 A;  4BY9 D;  3OBY A;  2QEX F;  3G71 F;  1W42 A;  3NK6 A;  5A2Q M;  3VMF B;  2AIF A;  1W40 A;  1JJ2 F;  5IT9 M;  5GIN C;  1M1K H;  3CMA F;  4C4W C;  1Q81 H;  1X7P A;  3CC4 F;  4LCK A;  1IPA A;  3PAF A;  1KD1 H;  2OTL F;  3O85 A;  3CPQ A;  3CPW F;  3FFM A;  4X3L A;  1VQP F;  3J7A R;  3LWO C;  1VQ8 F;  1H7M A;  2WAL A;  2CZW A;  3WXM B;  2OZB A;  1QVF F;  1QVG F;  4NUT A;  3I56 F;  1M90 H;  3OW2 F;  1K9M H;  3SIV A;  2JNB A;  3J81 M;  5G4V C;  1XBI A;  1GO1 A;  3CCV F;  2QA4 F;  3NMU C;  3CC2 F;  3CCR F;  1YIJ F;  1KQS F;  1VQO F;  5DCV A;  2KG4 A;  2I6D A;  2QI2 A;  3LFO A;  3G6E F;  1VQK F;  1K8A H;  1VQM F; 
#chains in the Genus database with same CATH topology
 4DRX A;  3J80 M;  3VOB A;  4X1Y B;  1NMU B;  3VYS C;  3CC7 F;  3I7T A;  1RA4 A;  1YQN A;  5AVM A;  3WJP A;  3N2K A;  5J2T A;  3CG6 A;  3LWP C;  3NVK E;  4X1K B;  3JAR A;  1PF5 A;  5JVD B;  4BVR A;  3CB2 A;  2YXZ A;  3V7Q A;  1VQ7 F;  3HAX D;  3IMP A;  3CCE F;  1S72 F;  4FFB A;  4KWE A;  5J2U B;  2KTV A;  1PXW A;  3JAT B;  3ZP7 A;  2RB9 A;  3MBM A;  3D01 A;  3NK7 A;  4G4V A;  4G4W A;  2LBX A;  5JQG A;  4ZHY B;  5GON A;  1VQ9 F;  5JCO C;  2R75 1;  1RLG A;  3D00 A;  3JAL A;  3KIZ A;  5LYJ B;  1IV2 A;  5EWR A;  2UYP A;  1VQN F;  3E20 B;  4TV8 A;  3JAK B;  4C81 A;  1Q7Y H;  1YJW F;  1ODE A;  3JAW A;  3QUW A;  4LNU A;  3MQW A;  1FSZ A;  3NVI B;  3N4Y A;  3HKB B;  3RYC B;  3CME F;  2LBW A;  3HKE B;  5EZY B;  3FPI A;  3CCL F;  5C8Y A;  2PMP A;  3HKC A;  3KHN A;  2HP0 B;  3RA6 A;  4ERH A;  3HJW C;  3WGL A;  2YYE A;  1VHA A;  1T0K B;  2VGN A;  1U40 A;  3ON1 A;  2ZVZ A;  4C8I A;  2LBT A;  5A2Q M;  3RYF B;  4BT3 A;  1XV2 A;  3S0H A;  1FNK A;  1JN1 A;  1JFF B;  5BMV B;  5IT9 M;  5LOV B;  3UT5 B;  4C4W C;  4I55 B;  1X7P A;  2LCA A;  1R1M A;  2IQQ A;  2HRU A;  4IIJ B;  3DDN A;  3F0F A;  1IPA A;  2OTL F;  1KD1 H;  2BTU A;  3HKD B;  1VQP F;  3FFM A;  4X3L A;  3JAK A;  1QVF F;  1QVG F;  3I56 F;  1M90 H;  5B8F A;  1J7H A;  5EB1 B;  5HWE A;  3RYC A;  3CYP B;  3HKE A;  5LP6 A;  1SA0 B;  3J81 M;  5FNV B;  3WGN A;  5HP7 A;  5EZY A;  5MN4 A;  2UZH A;  3S0Y A;  1SZQ A;  3CCV F;  4TV9 B;  5IJ9 B;  2GVI A;  3NMU C;  3MCQ A;  3ELC A;  5IYZ B;  1OFU A;  5HXU A;  1VQO F;  5DCV A;  3C8L A;  4NQ3 A;  1VQK F;  1RQ7 A;  3QTY A;  2ALE A;  1TUB B;  4IHJ B;  3VI6 A;  4EI8 A;  2OTJ F;  3RYH B;  3AGK A;  3WPX A;  3RYF A;  4B46 A;  3CCU F;  2OHW A;  3K12 A;  1Q82 H;  5LOV A;  3UT5 A;  2UYN B;  2ZVY A;  5LA6 B;  4I55 A;  1U43 A;  1IV3 A;  1IV1 A;  3LME A;  3SIU A;  3CCQ F;  4BW0 B;  3WGM A;  2AIZ P;  1RLU A;  4IIJ A;  1KNJ A;  4BT2 A;  1OAP A;  4F6R B;  3LWR C;  1X7O A;  3QHD A;  5HY1 A;  5ITZ A;  1SA0 A;  5FJ4 C;  1W3E X;  3FD5 A;  4TV9 A;  1T0A A;  5IJ9 A;  3MCA B;  1VK3 A;  1W58 1;  5IYZ A;  3WGK A;  4U3J B;  4I4T A;  1YHQ F;  1VQ5 F;  3K14 A;  3OBW A;  2CSL A;  3Q8H A;  4G4Z A;  1W55 A;  3N4Z A;  4ZI7 B;  4EI9 A;  3IKF A;  2FC3 A;  4X3M A;  3IR9 A;  3F0E A;  2H8C A;  4PWT A;  3F6M A;  1Z5V A;  5KMG B;  5EIB D;  4DXD A;  3JAM M;  5LA6 A;  4BT6 A;  2RHL A;  2HVY D;  3C9U A;  3ZOP A;  2H6L A;  2W8B C;  4I50 B;  2QEX F;  2L26 A;  1TVK B;  3C9S A;  4M8I A;  4EB6 B;  3G71 F;  2Q1Y A;  2AIF A;  1W40 A;  4O4H B;  4G88 A;  3P4E A;  4HNA A;  2VAW A;  2HS4 A;  5GIN C;  1M1K H;  3C9T A;  1Q81 H;  1NQ3 A;  3K0T A;  4O2B B;  4X1Y A;  5LXT B;  2HP3 A;  1X25 A;  3P0Z A;  5HY4 A;  5IJ0 B;  4O2A B;  4X1K A;  1U3P A;  3S02 A;  3KE1 A;  5JVD A;  3ESJ A;  1VQ8 F;  1JD1 A;  2WAL A;  3GHZ A;  4G4X A;  1QD9 A;  5J2U A;  3U0O A;  1Q8R A;  2CW4 A;  3JAT A;  1K9M H;  3L7Q A;  2BTO A;  3TD5 A;  5G4V C;  1XBI A;  1GO1 A;  3JAS B;  3N2G B;  2QA4 F;  1U3L A;  4ZI7 A;  4YJ3 B;  2VXY A;  3CC2 F;  3ZP4 A;  4R40 B;  2KG4 A;  1COM A;  2HS3 A;  3S06 A;  5KMG A;  5LYJ A;  2GLZ A;  2RHJ A;  4I50 A;  5HY0 A;  1K73 H;  5CB4 B;  1X52 A;  3LWV C;  2DT4 A;  3HKB A;  1KNK A;  3FBA A;  2AMT A;  3IEW A;  2Z1F A;  1UFY A;  3GTZ A;  4O2B A;  4ZHV A;  4O4I B;  5GIO C;  5LXT A;  3CCS F;  4X1I B;  1W2B F;  3PLA C;  4TZZ A;  4O2A A;  2HP0 A;  3JCM M;  5CA0 B;  5HY2 A;  4E6E A;  3D54 A;  3JVH A;  1XHO A;  1DBF A;  4YJ2 B;  1DT9 A;  4TUY B;  4DRX B;  1GZ0 A;  4X20 B;  5CA1 B;  3N2G A;  1W5A A;  3LWQ C;  4U39 A;  4YJ3 A;  1W5B A;  3B6N A;  3P10 A;  1E7K A;  3N2K B;  2G9I A;  1JFF A;  5BMV A;  4ZK7 A;  2FGY A;  3KJJ A;  3JAR B;  4O4J B;  4XCQ A;  4B5C A;  5GAN K;  4O4L B;  5JH7 B;  2F9Z C;  1K8A H;  3K2X A;  3HKD A;  2Q1X A;  3CCM F;  1W41 A;  1FFX B;  4ZOL B;  1Q86 H;  1JY8 A;  3ZO8 A;  5HXZ A;  5JQG B;  4B45 A;  5JCO A;  3E1Y A;  1KC8 H;  2KGW A;  5GON B;  3RA5 A;  3V7E A;  5FNV A;  1XRG A;  5EO3 A;  3F0G A;  2KTU A;  3JAL B;  5LP6 C;  4O4I A;  4X1I A;  1W42 A;  2IAF A;  3IEQ A;  3VMF B;  2HS0 A;  4WBN B;  3V3T A;  5EYP B;  1CLI A;  3CMA F;  2K1S A;  1TUB A;  4IHJ A;  4TUY A;  4LCK A;  4X20 A;  3BYQ A;  3RYH A;  5CA1 A;  1W5E A;  3S03 A;  5C8Y B;  3O85 A;  3CPQ A;  3V4D A;  3VIU A;  3HKC B;  3LWO C;  2R6R 1;  1H7M A;  3ERN A;  2UYN A;  5HP8 A;  3RYI B;  4O4J A;  3VO8 A;  3VTI C;  5KX5 B;  4O4L A;  2H8E A;  4C82 A;  5JH7 A;  2JNB A;  1RQ2 A;  3M84 A;  2Z01 A;  5EAZ A;  3S0W A;  3CCR F;  1YIJ F;  1FFX A;  2RHO A;  3TD4 A;  4ZOL A;  4F6R A;  5MN5 A;  2QI2 A;  2RHH A;  3M4S A;  3I55 F;  1W59 A;  1IV4 A;  1W5F A;  1VQ4 F;  3VCZ A;  3VYT C;  3OON A;  4U3J A;  1CK2 A;  2BTQ B;  2GZL A;  2VGM A;  2ZF8 A;  3MDO A;  2Z1T A;  3WJQ A;  3EOR A;  3CXC F;  4WBN A;  3WGJ A;  3CCJ F;  5EYP A;  5MN6 A;  1N8R H;  2Z1E A;  5LP6 B;  4BT7 A;  2HQS C;  4C8G A;  1W57 A;  1YGY A;  3CYQ A;  1VQL F;  3HWU A;  3WJR A;  3KJK A;  1SDS A;  5GAP K;  3DC2 A;  3RYI A;  1CN7 A;  5GIP C;  1GO0 A;  5KX5 A;  1YJN F;  3HTN A;  4G4Y A;  1YJ9 F;  3CD6 F;  1TVK A;  2MQE A;  2UYJ A;  4EB6 A;  3FD6 A;  3GYQ A;  3I3F A;  1H48 A;  2VAM A;  4O4H A;  1NJI H;  1H47 A;  4ZHQ B;  2I6R A;  2CWJ A;  2ZOV A;  4BVT A;  5FLX M;  1ZWZ A;  3E22 B;  2ZOD A;  3RE3 A;  5EIB C;  2IG8 A;  3TD3 A;  5G4U C;  1VQV A;  5IJ0 A;  1YIT F;  4NWO B;  4BVS A;  2CVL A;  2BO1 A;  1YI2 F;  4C8E A;  3G4S F;  3G6E F;  1QAH A;  3M1X A;  2EWC A;  1VQ6 F;  2NMU A;  3JAS A;  3OBY A;  5ITZ B;  4BY9 D;  3C9R A;  3R0P A;  2CHS A;  2B33 A;  3NK6 A;  5J2T B;  2HX0 A;  3LDT A;  2DYY A;  1Z5W A;  4BT5 A;  1JJ2 F;  4I4T B;  2V9Y A;  1VH8 A;  4BT4 A;  1UI9 A;  3LYB A;  4FFB B;  1ONI A;  2ZAU A;  3VYU C;  3CC4 F;  3F0D A;  1FNJ A;  4B62 A;  5CB4 A;  3PAF A;  3CPW F;  3T80 A;  3J7A R;  4ZHQ A;  2OTM A;  4BVQ A;  2CZW A;  3WXM B;  2OZB A;  4NUT A;  2P6Y A;  3OW2 F;  1GX1 A;  3E22 A;  2PHN A;  1QU9 A;  3SIV A;  2HRY A;  3IKE A;  4EI7 A;  3VOA A;  5CA0 A;  2QTP A;  2UYK A;  4TV8 B;  3WPW A;  1KQS F;  4RHA A;  2N48 A;  2VAP A;  2CHT A;  2I6D A;  3JAW B;  3LFO A;  4LNU B;  5EB0 A;  4HNA B;  4YJ2 A;  2Z1U A;  4RQO A;  4ZHW A;  1VQM F; 
#chains in the Genus database with same CATH homology
 3I55 F;  3J80 M;  2GLZ A;  2ALE A;  1VQ4 F;  1NMU B;  5HY0 A;  3CC7 F;  3VI6 A;  1RA4 A;  4EI8 A;  1K73 H;  2OTJ F;  3AGK A;  3CG6 A;  3LWP C;  1CK2 A;  3NVK E;  1X52 A;  3CCU F;  2VGM A;  3LWV C;  4BVR A;  3CXC F;  3CCJ F;  2OHW A;  3V7Q A;  1Q82 H;  1VQ7 F;  3HAX D;  3CCE F;  1S72 F;  2KTV A;  1PXW A;  5GIO C;  3CCS F;  1N8R H;  3SIU A;  3CCQ F;  4BW0 B;  1W2B F;  3PLA C;  4TZZ A;  3NK7 A;  3JCM M;  2LBX A;  1VQL F;  5HY2 A;  1SDS A;  5GAP K;  1VQ9 F;  1CN7 A;  5GIP C;  1GO0 A;  3LWR C;  1X7O A;  1RLG A;  5HY1 A;  1DT9 A;  3D00 A;  1YJN F;  1YJ9 F;  3CD6 F;  5EWR A;  1GZ0 A;  1W3E X;  5FJ4 C;  3GYQ A;  1VQN F;  3LWQ C;  3E20 B;  3MCA B;  1NJI H;  1E7K A;  1Q7Y H;  2FGY A;  1YJW F;  1YHQ F;  5FLX M;  4BVT A;  4XCQ A;  1ZWZ A;  5GAN K;  1VQ5 F;  3NVI B;  3N4Y A;  3CME F;  2LBW A;  2F9Z C;  3OBW A;  5G4U C;  1YIT F;  3CCL F;  4BVS A;  3CCM F;  3N4Z A;  4EI9 A;  1W41 A;  2BO1 A;  2FC3 A;  4X3M A;  3RA6 A;  3IR9 A;  1YI2 F;  1Q86 H;  5HXZ A;  3G4S F;  3HJW C;  3E1Y A;  1KC8 H;  3JAM M;  3RA5 A;  1T0K B;  3V7E A;  1VQ6 F;  2HVY D;  2VGN A;  5EO3 A;  2KTU A;  3ON1 A;  4BY9 D;  3OBY A;  2QEX F;  3G71 F;  1W42 A;  3NK6 A;  5A2Q M;  3VMF B;  2AIF A;  1W40 A;  1JJ2 F;  5IT9 M;  3V3T A;  5GIN C;  1M1K H;  3CMA F;  4C4W C;  1Q81 H;  1X7P A;  3CC4 F;  4LCK A;  5HY4 A;  1IPA A;  3PAF A;  1KD1 H;  2OTL F;  3O85 A;  3CPQ A;  3CPW F;  3FFM A;  4X3L A;  1VQP F;  3J7A R;  3LWO C;  1VQ8 F;  1H7M A;  2WAL A;  2CZW A;  4BVQ A;  3WXM B;  2OZB A;  1QVG F;  1QVF F;  4NUT A;  3I56 F;  1M90 H;  3OW2 F;  1K9M H;  5HWE A;  3SIV A;  2JNB A;  3J81 M;  4EI7 A;  5G4V C;  1XBI A;  1GO1 A;  3CCV F;  2QA4 F;  3NMU C;  3CC2 F;  3CCR F;  1YIJ F;  5HXU A;  1KQS F;  1VQO F;  5DCV A;  2KG4 A;  2I6D A;  2QI2 A;  3LFO A;  4NQ3 A;  3G6E F;  1VQK F;  1K8A H;  1VQM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...