3MQWA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
132
Chain Sequence
QTQGPMSKLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 35
structure length 132
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3mqwA00
2CWJA 2CHSA 2CVLA 1UFYA 4NWOB 1JD1A 3L7QA 2DYYA 1XRGA 2UYNA 3ZO8A 3M1XA 3M4SA 1NQ3A 5HP8A 3VCZA 4ZK7A 3D01A 1QAHA 2UYPA 2CSLA 3ZOPA 3LYBA 2B33A 3KJKA 1J7HA 2EWCA 3K12A 1DBFA 5HP7A 3ZP4A 2UYNB 1QU9A 2CW4A 3LMEA 1X25A 3MQWA 1XHOA 2UYKA 1COMA 3GTZA 1PF5A 3V4DA 3R0PA 2CHTA 2UYJA 2OTMA 1UI9A 3ZP7A 3KJJA 1FNJA 1FNKA 1ODEA 3I7TA 1QD9A 2IG8A 1ONIA 3QUWA 3I3FA 3K0TA
chains in the Genus database with same CATH superfamily
3BYQA 5LYJB 4I55B 5BMVB 1T0KB 3L7QA 1XRGA 1X7OA 4O4LA 3KE1A 3LWOC 4C81A 3EORA 5MN4A 4F6RB 3LWVC 3CYPB 5HY1A 2LBWA 3KJKA 2AMTA 5JQGB 4ZHYB 1W2BF 5IT9M 1VQNF 5GONB 5KX5B 5EAZA 4KWEA 3I55F 1W40A 4R40B 1U3LA 1OAPA 3IEQA 3V7QA 2OTMA 1UI9A 4C82A 4BVSA 3RYIB 3VMFB 3PAFA 4G4WA 4U3JB 5GIOC 3VCZA 1JJ2F 1IV2A 1XV2A 3D00A 3UT5B 3WJRA 4X3MA 3V3TA 1K8AH 1YJWF 3HKCA 5LP6B 5HP8A 1DT9A 3P0ZA 1Q81H 5EZYA 2RHJA 2H8EA 5LXTA 5G4UC 3KIZA 5KMGA 1YI2F 4TUYB 3S0HA 5C8YB 2AIFA 4G4YA 4ZHWA 1W5FA 2FGYA 3HKDB 1XBIA 3N2KA 3JARB 4HNAA 3NVKE 1VHAA 3G6EF 4YJ3A 2HS0A 4FFBA 3E20B 3CPWF 5IJ0A 4X1YA 4ZOLB 2HRUA 2JNBA 2N48A 1QVFF 2IG8A 3VOBA 1IV3A 3FPIA 1W41A 5JVDA 1W3EX 2WALA 5JCOC 4C8IA 3M4SA 3NK7A 5EO3A 1TVKB 2BO1A 4ERHA 2HRYA 4G4XA 4X20B 3RA5A 4O4IB 3RE3A 2Z1FA 4O2AB 5DCVA 4B46A 5CA1B 1GZ0A 1JY8A 5LOVB 5GINC 3NVIB 4O2BA 5IJ9B 2KTUA 2CZWA 3VI6A 1U43A 1KQSF 1VQLF 1YHQF 1KC8H 3JAWA 3JATA 1ZWZA 2K1SA 4NQ3A 1FSZA 3WJQA 4EB6B 4C4WC 2YXZA 1IV4A 4BVRA 3F0GA 3S06A 3JALB 2GLZA 3O85A 5A2QM 4X1IB 3N2GA 4TZZA 4BVTA 3CC2F 4LNUB 1Z5VA 2QI2A 5EZYB 1PF5A 5J2UA 1VQVA 3IKEA 3FFMA 2Q1XA 3WGNA 3CYQA 4HNAB 1PXWA 4IHJB 1VQPF 5LP6C 3HKEA 5FJ4C 3RYCA 5J2TA 4ZI7A 3WJPA 1VQ9F 4DXDA 2W8BC 4EI7A 5FLXM 3ON1A 5LA6A 5FNVB 4RHAA 2UYNB 2P6YA 4IIJA 4TV8A 2OZBA 5EYPB 2LBXA 4TV9A 1ODEA 1YJ9F 1R1MA 1Q86H 3QUWA 3GHZA 2HS4A 1Q8RA 1UFYA 4I50A 3J7AR 3S0YA 4X1KA 4I4TA 5IYZB 3SIUA 3MBMA 5JH7B 1SA0A 3F0EA 4C8EA 2FC3A 3WGJA 2ALEA 3C9UA 2HP0A 5CB4A 4B62A 4M8IA 3TD4A 4YJ2A 2UYJA 2AIZP 4G4VA 5G4VC 3I7TA 3PLAC 1U3PA 2BTQB 3C9RA 5EB0A 2YYEA 2CHSA 3IEWA 2MQEA 3CCUF 3IR9A 1VQ5F 1W5AA 3E22B 1VQ8F 3CC7F 4EI9A 1W581 2HS3A 3LWQC 1YGYA 3HKBA 1JFFA 3CCSF 2UYKA 3JAMM 3CB2A 1GX1A 4O4JB 4EI8A 3MCAB 4DRXA 3KJJA 3NK6A 3HAXD 1VH8A 1QD9A 1CN7A 1ONIA 3RYFB 2R751 3S03A 1M90H 4IIJB 3CG6A 3VO8A 3HJWC 3J81M 2BTOA 2Z1TA 3TD3A 3LYBA 3JVHA 4BT6A 2VXYA 2ZOVA 3JASA 3VYSC 4O4LB 3G4SF 3MQWA 1COMA 2UZHA 2VAPA 3OBWA 1RQ2A 1VK3A 3CMAF 5JCOA 3CCVF 2KGWA 2QEXF 3HTNA 1CK2A 3I3FA 1X7PA 5HXUA 3WGKA 4WBNA 2VAMA 3M1XA 3KHNA 1FFXA 4O4HA 2Z1EA 2GVIA 1W55A 2RB9A 1OFUA 1DBFA 1Z5WA 3ZP4A 4B45A 5HP7A 5GAPK 2HX0A 3D54A 3JAKA 2LBTA 5LYJA 3ERNA 3GYQA 3I56F 3HKCB 4I55A 1W42A 5BMVA 1XHOA 3MCQA 1TUBA 4BW0B 4PWTA 2GZLA 3CCMF 3CMEF 4BT2A 4BT7A 5LXTB 3N4ZA 4F6RA 3DDNA 3K14A 5KMGB 1RLGA 4ZHQA 3IMPA 3N2KB 5GONA 3VIUA 5KX5A 2F9ZC 4YJ3B 3WPWA 4FFBB 2ZODA 5IJ0B 2G9IA 1NQ3A 5HXZA 1QVGF 4X1YB 3C9TA 2VGNA 4C8GA 3RYIA 3TD5A 5JVDB 5GIPC 4U3JA 5MN6A 3QTYA 5GANK 1IPAA 3ESJA 3UT5A 1M1KH 3GTZA 4BT3A 3V4DA 3S0WA 2RHHA 3P4EA 5LP6A 3ZP7A 3LDTA 3U0OA 1RQ7A 3JCMM 3CCEF 3M84A 5HY4A 2QA4F 2L26A 1GO0A 5C8YA 2KG4A 3S02A 3F0DA 4O2BB 3JARA 5EIBC 1YIJF 4ZK7A 3MDOA 4LCKA 4G4ZA 2B33A 5EIBD 3JAWB 3JATB 4ZOLA 3K12A 2OTLF 3NMUC 1H7MA 3G71F 4U39A 1RLUA 1VQMF 3CC4F 2HP3A 3R0PA 2CHTA 1TVKA 3WPXA 1VQ6F 3JAKB 4O4IA 3K0TA 3N2GB 4O2AA 5ITZA 1TUBB 4NWOB 2OTJF 2ZVYA 3ZO8A 5CA1A 2IQQA 5LOVA 3WGLA 5J2UB 2Q1YA 2UYPA 2QTPA 3FBAA 4ZHQB 5IJ9A 3FD6A 2KTVA 3OBYA 2Z01A 1X52A 5AVMA 5B8FA 3HKEB 3RYCB 5J2TB 4ZI7B 5HWEA 3SIVA 2PHNA 3HWUA 4EB6A 1Q7YH 5LA6B 1H47A 3CD6F 3JALA 3VYUC 1VQ4F 1KD1H 4XCQA 5CA0A 2HVYD 4X1IA 4TV8B 3DC2A 3V7EA 3QHDA 4LNUA 4TV9B 1QAHA 2Z1UA 1YQNA 4BY9D 3IKFA 2H8CA 2I6DA 4BVQA 4ZHVA 2OHWA 4I50B 1CLIA 3B6NA 2CW4A 4E6EA 3FD5A 3RA6A 4IHJA 3P10A 1KNKA 4X1KB 4I4TB 3CCRF 1SA0B 1H48A 3CCQF 3F6MA 2HP0B 3T80A 4G88A 2VGMA 5FNVA 5CB4B 3LWRC 3RYHA 2UYNA 2BTUA 4YJ2B 3LWPC 3CCJF 1YITF 1YJNF 2V9YA 3OONA 3D01A 5HY2A 1T0AA 2CSLA 5EYPA 3ZOPA 1SZQA 3E1YA 3C8LA 5ITZB 3LFOA 1W5BA 1K73H 3LMEA 3F0FA 3CPQA 1W59A 3VYTC 2ZAUA 4X3LA 5IYZA 5EWRA 5JH7A 1GO1A 2CWJA 3HKBB 1JFFB 1NMUB 2ZF8A 5JQGA 1KNJA 3WXMB 2I6RA 3C9SA 4DRXB 1W5EA 1S72F 1RA4A 2NMUA 1N8RH 3AGKA 5CA0B 1NJIH 3J80M 3OW2F 1Q82H 1JN1A 5EB1B 4B5CA 4RQOA 5MN5A 1FNJA 1FNKA 1E7KA 2LCAA 3E22A 1K9MH 3JASB 2CVLA 1JD1A 3K2XA 1SDSA 2DYYA 2RHLA 4NUTA 1U40A 4TUYA 1IV1A 4BT5A 3CCLF 1VQKF 3HKDA 3N4YA 2H6LA 1W57A 4O4JA 2PMPA 3Q8HA 1VQOF 3VOAA 4BT4A 5HY0A 1J7HA 1VQ7F 2EWCA 3VTIC 3RYHB 2ZVZA 4WBNB 3RYFA 1QU9A 3ELCA 2RHOA 2IAFA 1X25A 1FFXB 2HQSC 3WGMA 4O4HB 2VAWA 2DT4A 3CXCF 4X20A 2R6R1
chains in the Genus database with same CATH topology
2CWJA 2CHSA 2CVLA 1UFYA 4NWOB 1JD1A 3L7QA 2DYYA 1XRGA 2UYNA 3ZO8A 3M1XA 3M4SA 1NQ3A 5HP8A 3VCZA 4ZK7A 3D01A 1QAHA 2UYPA 2CSLA 3ZOPA 3LYBA 2B33A 3KJKA 1J7HA 2EWCA 3K12A 1DBFA 5HP7A 3ZP4A 2UYNB 1QU9A 2CW4A 3LMEA 1X25A 3MQWA 1XHOA 2UYKA 1COMA 3GTZA 1PF5A 3V4DA 3R0PA 2CHTA 2UYJA 2OTMA 1UI9A 3ZP7A 3KJJA 1FNJA 1FNKA 1ODEA 3I7TA 1QD9A 2IG8A 1ONIA 3QUWA 3I3FA 3K0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWJ A;  2CHS A;  2CVL A;  1UFY A;  4NWO B;  1JD1 A;  3L7Q A;  2DYY A;  1XRG A;  2UYN A;  3ZO8 A;  3M1X A;  3M4S A;  1NQ3 A;  5HP8 A;  3VCZ A;  4ZK7 A;  3D01 A;  1QAH A;  2UYP A;  2CSL A;  3ZOP A;  3LYB A;  2B33 A;  3KJK A;  1J7H A;  2EWC A;  3K12 A;  1DBF A;  5HP7 A;  3ZP4 A;  2UYN B;  1QU9 A;  2CW4 A;  3LME A;  1X25 A;  3MQW A;  1XHO A;  2UYK A;  1COM A;  3GTZ A;  1PF5 A;  3V4D A;  3R0P A;  2CHT A;  2UYJ A;  2OTM A;  1UI9 A;  3ZP7 A;  3KJJ A;  1FNJ A;  1FNK A;  1ODE A;  3I7T A;  1QD9 A;  2IG8 A;  1ONI A;  3QUW A;  3I3F A;  3K0T A; 
#chains in the Genus database with same CATH topology
 3BYQ A;  5LYJ B;  4I55 B;  5BMV B;  1T0K B;  3L7Q A;  1XRG A;  1X7O A;  4O4L A;  3KE1 A;  3LWO C;  4C81 A;  3EOR A;  5MN4 A;  4F6R B;  3LWV C;  3CYP B;  5HY1 A;  2LBW A;  3KJK A;  2AMT A;  5JQG B;  4ZHY B;  1W2B F;  5IT9 M;  1VQN F;  5GON B;  5KX5 B;  5EAZ A;  4KWE A;  3I55 F;  1W40 A;  4R40 B;  1U3L A;  1OAP A;  3IEQ A;  3V7Q A;  2OTM A;  1UI9 A;  4C82 A;  4BVS A;  3RYI B;  3VMF B;  3PAF A;  4G4W A;  4U3J B;  5GIO C;  3VCZ A;  1JJ2 F;  1IV2 A;  1XV2 A;  3D00 A;  3UT5 B;  3WJR A;  4X3M A;  3V3T A;  1K8A H;  1YJW F;  3HKC A;  5LP6 B;  5HP8 A;  1DT9 A;  3P0Z A;  1Q81 H;  5EZY A;  2RHJ A;  2H8E A;  5LXT A;  5G4U C;  3KIZ A;  5KMG A;  1YI2 F;  4TUY B;  3S0H A;  5C8Y B;  2AIF A;  4G4Y A;  4ZHW A;  1W5F A;  2FGY A;  3HKD B;  1XBI A;  3N2K A;  3JAR B;  4HNA A;  3NVK E;  1VHA A;  3G6E F;  4YJ3 A;  2HS0 A;  4FFB A;  3E20 B;  3CPW F;  5IJ0 A;  4X1Y A;  4ZOL B;  2HRU A;  2JNB A;  2N48 A;  1QVF F;  2IG8 A;  3VOB A;  1IV3 A;  3FPI A;  1W41 A;  5JVD A;  1W3E X;  2WAL A;  5JCO C;  4C8I A;  3M4S A;  3NK7 A;  5EO3 A;  1TVK B;  2BO1 A;  4ERH A;  2HRY A;  4G4X A;  4X20 B;  3RA5 A;  4O4I B;  3RE3 A;  2Z1F A;  4O2A B;  5DCV A;  4B46 A;  5CA1 B;  1GZ0 A;  1JY8 A;  5LOV B;  5GIN C;  3NVI B;  4O2B A;  5IJ9 B;  2KTU A;  2CZW A;  3VI6 A;  1U43 A;  1KQS F;  1VQL F;  1YHQ F;  1KC8 H;  3JAW A;  3JAT A;  1ZWZ A;  2K1S A;  4NQ3 A;  1FSZ A;  3WJQ A;  4EB6 B;  4C4W C;  2YXZ A;  1IV4 A;  4BVR A;  3F0G A;  3S06 A;  3JAL B;  2GLZ A;  3O85 A;  5A2Q M;  4X1I B;  3N2G A;  4TZZ A;  4BVT A;  3CC2 F;  4LNU B;  1Z5V A;  2QI2 A;  5EZY B;  1PF5 A;  5J2U A;  1VQV A;  3IKE A;  3FFM A;  2Q1X A;  3WGN A;  3CYQ A;  4HNA B;  1PXW A;  4IHJ B;  1VQP F;  5LP6 C;  3HKE A;  5FJ4 C;  3RYC A;  5J2T A;  4ZI7 A;  3WJP A;  1VQ9 F;  4DXD A;  2W8B C;  4EI7 A;  5FLX M;  3ON1 A;  5LA6 A;  5FNV B;  4RHA A;  2UYN B;  2P6Y A;  4IIJ A;  4TV8 A;  2OZB A;  5EYP B;  2LBX A;  4TV9 A;  1ODE A;  1YJ9 F;  1R1M A;  1Q86 H;  3QUW A;  3GHZ A;  2HS4 A;  1Q8R A;  1UFY A;  4I50 A;  3J7A R;  3S0Y A;  4X1K A;  4I4T A;  5IYZ B;  3SIU A;  3MBM A;  5JH7 B;  1SA0 A;  3F0E A;  4C8E A;  2FC3 A;  3WGJ A;  2ALE A;  3C9U A;  2HP0 A;  5CB4 A;  4B62 A;  4M8I A;  3TD4 A;  4YJ2 A;  2UYJ A;  2AIZ P;  4G4V A;  5G4V C;  3I7T A;  3PLA C;  1U3P A;  2BTQ B;  3C9R A;  5EB0 A;  2YYE A;  2CHS A;  3IEW A;  2MQE A;  3CCU F;  3IR9 A;  1VQ5 F;  1W5A A;  3E22 B;  1VQ8 F;  3CC7 F;  4EI9 A;  1W58 1;  2HS3 A;  3LWQ C;  1YGY A;  3HKB A;  1JFF A;  3CCS F;  2UYK A;  3JAM M;  3CB2 A;  1GX1 A;  4O4J B;  4EI8 A;  3MCA B;  4DRX A;  3KJJ A;  3NK6 A;  3HAX D;  1VH8 A;  1QD9 A;  1CN7 A;  1ONI A;  3RYF B;  2R75 1;  3S03 A;  1M90 H;  4IIJ B;  3CG6 A;  3VO8 A;  3HJW C;  3J81 M;  2BTO A;  2Z1T A;  3TD3 A;  3LYB A;  3JVH A;  4BT6 A;  2VXY A;  2ZOV A;  3JAS A;  3VYS C;  4O4L B;  3G4S F;  3MQW A;  1COM A;  2UZH A;  2VAP A;  3OBW A;  1RQ2 A;  1VK3 A;  3CMA F;  5JCO A;  3CCV F;  2KGW A;  2QEX F;  3HTN A;  1CK2 A;  3I3F A;  1X7P A;  5HXU A;  3WGK A;  4WBN A;  2VAM A;  3M1X A;  3KHN A;  1FFX A;  4O4H A;  2Z1E A;  2GVI A;  1W55 A;  2RB9 A;  1OFU A;  1DBF A;  1Z5W A;  3ZP4 A;  4B45 A;  5HP7 A;  5GAP K;  2HX0 A;  3D54 A;  3JAK A;  2LBT A;  5LYJ A;  3ERN A;  3GYQ A;  3I56 F;  3HKC B;  4I55 A;  1W42 A;  5BMV A;  1XHO A;  3MCQ A;  1TUB A;  4BW0 B;  4PWT A;  2GZL A;  3CCM F;  3CME F;  4BT2 A;  4BT7 A;  5LXT B;  3N4Z A;  4F6R A;  3DDN A;  3K14 A;  5KMG B;  1RLG A;  4ZHQ A;  3IMP A;  3N2K B;  5GON A;  3VIU A;  5KX5 A;  2F9Z C;  4YJ3 B;  3WPW A;  4FFB B;  2ZOD A;  5IJ0 B;  2G9I A;  1NQ3 A;  5HXZ A;  1QVG F;  4X1Y B;  3C9T A;  2VGN A;  4C8G A;  3RYI A;  3TD5 A;  5JVD B;  5GIP C;  4U3J A;  5MN6 A;  3QTY A;  5GAN K;  1IPA A;  3ESJ A;  3UT5 A;  1M1K H;  3GTZ A;  4BT3 A;  3V4D A;  3S0W A;  2RHH A;  3P4E A;  5LP6 A;  3ZP7 A;  3LDT A;  3U0O A;  1RQ7 A;  3JCM M;  3CCE F;  3M84 A;  5HY4 A;  2QA4 F;  2L26 A;  1GO0 A;  5C8Y A;  2KG4 A;  3S02 A;  3F0D A;  4O2B B;  3JAR A;  5EIB C;  1YIJ F;  4ZK7 A;  3MDO A;  4LCK A;  4G4Z A;  2B33 A;  5EIB D;  3JAW B;  3JAT B;  4ZOL A;  3K12 A;  2OTL F;  3NMU C;  1H7M A;  3G71 F;  4U39 A;  1RLU A;  1VQM F;  3CC4 F;  2HP3 A;  3R0P A;  2CHT A;  1TVK A;  3WPX A;  1VQ6 F;  3JAK B;  4O4I A;  3K0T A;  3N2G B;  4O2A A;  5ITZ A;  1TUB B;  4NWO B;  2OTJ F;  2ZVY A;  3ZO8 A;  5CA1 A;  2IQQ A;  5LOV A;  3WGL A;  5J2U B;  2Q1Y A;  2UYP A;  2QTP A;  3FBA A;  4ZHQ B;  5IJ9 A;  3FD6 A;  2KTV A;  3OBY A;  2Z01 A;  1X52 A;  5AVM A;  5B8F A;  3HKE B;  3RYC B;  5J2T B;  4ZI7 B;  5HWE A;  3SIV A;  2PHN A;  3HWU A;  4EB6 A;  1Q7Y H;  5LA6 B;  1H47 A;  3CD6 F;  3JAL A;  3VYU C;  1VQ4 F;  1KD1 H;  4XCQ A;  5CA0 A;  2HVY D;  4X1I A;  4TV8 B;  3DC2 A;  3V7E A;  3QHD A;  4LNU A;  4TV9 B;  1QAH A;  2Z1U A;  1YQN A;  4BY9 D;  3IKF A;  2H8C A;  2I6D A;  4BVQ A;  4ZHV A;  2OHW A;  4I50 B;  1CLI A;  3B6N A;  2CW4 A;  4E6E A;  3FD5 A;  3RA6 A;  4IHJ A;  3P10 A;  1KNK A;  4X1K B;  4I4T B;  3CCR F;  1SA0 B;  1H48 A;  3CCQ F;  3F6M A;  2HP0 B;  3T80 A;  4G88 A;  2VGM A;  5FNV A;  5CB4 B;  3LWR C;  3RYH A;  2UYN A;  2BTU A;  4YJ2 B;  3LWP C;  3CCJ F;  1YIT F;  1YJN F;  2V9Y A;  3OON A;  3D01 A;  5HY2 A;  1T0A A;  2CSL A;  5EYP A;  3ZOP A;  1SZQ A;  3E1Y A;  3C8L A;  5ITZ B;  3LFO A;  1W5B A;  1K73 H;  3LME A;  3F0F A;  3CPQ A;  1W59 A;  3VYT C;  2ZAU A;  4X3L A;  5IYZ A;  5EWR A;  5JH7 A;  1GO1 A;  2CWJ A;  3HKB B;  1JFF B;  1NMU B;  2ZF8 A;  5JQG A;  1KNJ A;  3WXM B;  2I6R A;  3C9S A;  4DRX B;  1W5E A;  1S72 F;  1RA4 A;  2NMU A;  1N8R H;  3AGK A;  5CA0 B;  1NJI H;  3J80 M;  3OW2 F;  1Q82 H;  1JN1 A;  5EB1 B;  4B5C A;  4RQO A;  5MN5 A;  1FNJ A;  1FNK A;  1E7K A;  2LCA A;  3E22 A;  1K9M H;  3JAS B;  2CVL A;  1JD1 A;  3K2X A;  1SDS A;  2DYY A;  2RHL A;  4NUT A;  1U40 A;  4TUY A;  1IV1 A;  4BT5 A;  3CCL F;  1VQK F;  3HKD A;  3N4Y A;  2H6L A;  1W57 A;  4O4J A;  2PMP A;  3Q8H A;  1VQO F;  3VOA A;  4BT4 A;  5HY0 A;  1J7H A;  1VQ7 F;  2EWC A;  3VTI C;  3RYH B;  2ZVZ A;  4WBN B;  3RYF A;  1QU9 A;  3ELC A;  2RHO A;  2IAF A;  1X25 A;  1FFX B;  2HQS C;  3WGM A;  4O4H B;  2VAW A;  2DT4 A;  3CXC F;  4X20 A;  2R6R 1; 
#chains in the Genus database with same CATH homology
 2CWJ A;  2CHS A;  2CVL A;  1UFY A;  4NWO B;  1JD1 A;  3L7Q A;  2DYY A;  1XRG A;  2UYN A;  3ZO8 A;  3M1X A;  3M4S A;  1NQ3 A;  5HP8 A;  3VCZ A;  4ZK7 A;  3D01 A;  1QAH A;  2UYP A;  2CSL A;  3ZOP A;  3LYB A;  2B33 A;  3KJK A;  1J7H A;  2EWC A;  3K12 A;  1DBF A;  5HP7 A;  3ZP4 A;  2UYN B;  1QU9 A;  2CW4 A;  3LME A;  1X25 A;  3MQW A;  1XHO A;  2UYK A;  1COM A;  3GTZ A;  1PF5 A;  3V4D A;  3R0P A;  2CHT A;  2UYJ A;  2OTM A;  1UI9 A;  3ZP7 A;  3KJJ A;  1FNJ A;  1FNK A;  1ODE A;  3I7T A;  1QD9 A;  2IG8 A;  1ONI A;  3QUW A;  3I3F A;  3K0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...