3MQWA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
132
Chain Sequence
QTQGPMSKLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 35
structure length 132
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3mqwA00
1ONIA 3ZO8A 5HP7A 2IG8A 1XRGA 1QAHA 1FNKA 1UI9A 3R0PA 3LYBA 3V4DA 3KJJA 3VCZA 2CHTA 4ZK7A 1X25A 3K12A 1FNJA 1DBFA 2EWCA 2B33A 2CHSA 1PF5A 1JD1A 1COMA 3MQWA 2UYKA 2OTMA 3LMEA 3K0TA 3M1XA 1NQ3A 2UYPA 2UYJA 1XHOA 2CWJA 1J7HA 5HP8A 3L7QA 2CW4A 3ZOPA 3ZP4A 1UFYA 2CSLA 3ZP7A 3QUWA 1QU9A 1ODEA 3D01A 3GTZA 3KJKA 3M4SA 2UYNB 3I7TA 1QD9A 3I3FA 2UYNA 2DYYA 4NWOB 2CVLA
chains in the Genus database with same CATH superfamily
5HXZA 3RYFB 1RA4A 1VQKF 3CMEF 5ITZA 2HVYD 4TZZA 3K14A 1JN1A 2MQEA 4ZK7A 4O4LA 1IV3A 3MQWA 4G4ZA 2HP0A 3N4YA 5J2UA 3K0TA 1W581 3M1XA 4FFBB 4C8IA 4BVRA 2K1SA 3JARB 5C8YB 4M8IA 3RYHB 3CXCF 4X1IB 2F9ZC 2WALA 1W5FA 5IYZA 5IJ0B 3CC7F 5JVDA 1YHQF 2LBWA 3LWPC 3ZO8A 1E7KA 5JH7A 2ZAUA 2YXZA 3LYBA 2LBXA 1VQ8F 5LOVA 5GIPC 3PLAC 5GAPK 3WGLA 5LP6C 1COMA 4G88A 3CPQA 1XV2A 4I4TB 1NQ3A 4EB6B 4ERHA 4ZHQB 5CA0B 1Z5VA 5LXTA 3J81M 4O4JB 3VIUA 2CW4A 3IEQA 3RYIA 4I55B 4ZHVA 4HNAB 1FSZA 1KC8H 2PHNA 4X1YB 5JQGB 3OONA 1W42A 3P0ZA 3JALB 3HTNA 5LYJA 1K9MH 1CLIA 3F0FA 3WXMB 1W5BA 1R1MA 4TV9B 1SA0B 1XBIA 1KQSF 4TV8B 1W41A 4X1KA 5LA6A 3JASB 3CPWF 1IV2A 4RQOA 4O4IA 1QU9A 1VQLF 1ODEA 2UYNB 3I7TA 3J7AR 2OZBA 2DYYA 3V7EA 3LDTA 2H8EA 5KX5A 2ALEA 1M1KH 5HP7A 1KNKA 2IG8A 4IHJA 4B62A 1FNKA 4U3JA 1RQ2A 5GONA 3LWRC 2VGNA 1VQ7F 2RHOA 3N2GB 3K12A 3MDOA 3S06A 2B33A 1GX1A 1PXWA 1W40A 4X20A 3VYSC 3CMAF 3SIUA 2H6LA 1IV4A 2QA4F 2VAWA 4ZOLB 3P10A 5EWRA 3ZOPA 5MN6A 2G9IA 1TVKB 2V9YA 2RHHA 5EB0A 4C4WC 2ZVYA 3GTZA 4G4WA 5EZYB 4O4HB 1U3LA 4DXDA 1VK3A 2Z1EA 3MBMA 5EIBD 5HXUA 5LP6A 5IJ9A 5J2TB 1YIJF 2OTLF 2EWCA 3NVIB 4C82A 2AIFA 3TD3A 3VYUC 3CC2F 3LMEA 1W2BF 3M84A 5IT9M 1TUBB 5HP8A 4TUYA 2IAFA 3HKCB 3ON1A 4BT7A 5EYPB 3QUWA 3Q8HA 1W3EX 5HY1A 3FBAA 3QHDA 4DRXB 1QVFF 3OW2F 5BMVB 2HRUA 4YJ3A 5MN4A 1X7PA 3NVKE 5B8FA 1GO0A 3WJRA 3VCZA 3CCJF 3D54A 1W57A 3OBWA 3WJPA 1T0KB 1JD1A 5GANK 3G71F 3E22B 4KWEA 2CZWA 3JAWB 3TD5A 3I55F 3CCLF 4LCKA 1Q7YH 1NJIH 5KMGA 4LNUA 2CSLA 3CCMF 5CB4A 3KJKA 4YJ2A 1T0AA 3C9TA 3F0GA 1VQVA 3CCRF 1Z5WA 3TD4A 4BW0B 3UT5B 4F6RA 1QAHA 4ZI7B 1UI9A 2BTQB 4BVSA 4O2AB 1JFFA 4WBNA 1PF5A 3RYCA 3S0WA 2R6R1 3B6NA 3HKDA 1NMUB 2LBTA 4B46A 1H48A 4G4VA 1OAPA 3VI6A 3D01A 2BTUA 1CK2A 3N2KA 5CA1A 2P6YA 3JATB 3EORA 3HKBA 1DT9A 5G4VC 4IIJB 3SIVA 2GLZA 5FNVA 3JAKA 4O2BB 3NK7A 5A2QM 3KJJA 3HKEB 1SDSA 3PAFA 5GINC 2Z1UA 1YQNA 3VMFB 1CN7A 3RA5A 3CCSF 1FFXB 3HWUA 3S03A 1IV1A 3ZP4A 2N48A 3IKFA 3BYQA 3MCQA 1YGYA 3WPWA 3I56F 3E1YA 3CC4F 3AGKA 1N8RH 1RLGA 2ZODA 3C8LA 3FFMA 5MN5A 3CYPB 1VQNF 3RYFA 5ITZB 1VQPF 1VQ9F 1JY8A 3R0PA 1YJ9F 2KTVA 1U3PA 5JCOC 4BVTA 4O4LB 4NQ3A 2CHSA 5J2UB 2UYPA 3K2XA 4FFBA 1XHOA 3VOAA 2VXYA 1QVGF 2QI2A 2HS0A 1VQMF 3JARA 2RHLA 5C8YA 3RYHA 4X1IA 5IYZB 3IR9A 4NWOB 5JVDB 1M90H 5IJ0A 1SZQA 3G6EF 5JH7B 3GHZA 3S02A 5LOVB 2KTUA 1YITF 1VQ4F 1KD1H 2KG4A 3VO8A 1H47A 4NUTA 3KHNA 4I4TA 4ZHQA 4EB6A 5LXTB 5CA0A 3JCMM 2QEXF 3RYIB 4BVQA 3V7QA 4O4JA 5AVMA 3IKEA 4I55A 2QTPA 4HNAA 4U39A 2PMPA 1ONIA 4G4YA 1YJWF 4X1YA 2ZVZA 2KGWA 5JQGA 1U40A 5LYJB 1X52A 3JAMM 1ZWZA 3JALA 3WGMA 2BO1A 4BT3A 2CHTA 3CG6A 4EI7A 2FGYA 2HX0A 3CD6F 3S0HA 4TV9A 4X1KB 5LA6B 4C81A 1SA0A 3F0EA 3CCEF 2ZOVA 4TV8A 2RHJA 3DDNA 4I50B 3C9UA 4O4IB 2H8CA 3ZP7A 3JASA 3VOBA 1W5AA 4ZHYB 2LCAA 4PWTA 3KIZA 3F0DA 1W59A 2UYNA 5KX5B 3NMUC 1U43A 2VAMA 5JCOA 3WGKA 3GYQA 4IHJB 3NK6A 1GZ0A 2Z01A 4U3JB 3WGJA 3CCUF 5GONB 3V4DA 2OHWA 3IEWA 5FLXM 3LWQC 1X7OA 4X20B 3ERNA 4E6EA 5EIBC 3N2GA 1IPAA 4B5CA 3G4SF 2UYKA 2OTMA 1VQ5F 3KE1A 3D00A 4ZOLA 3RE3A 3FD6A 2HS4A 1TVKA 4RHAA 2YYEA 3WPXA 2W8BC 3M4SA 5DCVA 5HY2A 4EI8A 4G4XA 2IQQA 2UZHA 1OFUA 1H7MA 3DC2A 5EZYA 4O4HA 4X3LA 5LP6B 1VH8A 3JVHA 3N4ZA 3P4EA 5IJ9B 5J2TA 2I6RA 4R40B 5EAZA 2I6DA 1Q81H 3CB2A 3RA6A 4BT4A 2HS3A 1Q8RA 4TUYB 1RLUA 5HWEA 1TUBA 4B45A 3HKCA 2GZLA 3WGNA 3C9RA 1RQ7A 5EYPA 2Q1YA 4DRXA 2GVIA 4C8GA 3VYTC 2CVLA 4BT6A 4BY9D 1YJNF 4YJ3B 3CCQF 1Q86H 5FJ4C 2DT4A 2FC3A 5EO3A 3FPIA 5BMVA 4BT5A 5HY4A 1GO1A 3FD5A 3J80M 2AMTA 3LWVC 1Q82H 2HP0B 3S0YA 4C8EA 2UYJA 3E22A 1J7HA 3JAWA 5KMGB 4LNUB 4I50A 2Z1TA 3ESJA 1KNJA 5CB4B 3IMPA 4YJ2B 1W5EA 3I3FA 3U0OA 3MCAB 2Q1XA 1VQOF 2AIZP 3ELCA 3F6MA 2Z1FA 4F6RB 3VTIC 3T80A 1XRGA 3UT5A 5HY0A 5G4UC 3C9SA 4ZI7A 2NMUA 2HRYA 1JFFB 3CYQA 4WBNB 4O2AA 1DBFA 4X3MA 2VGMA 3LFOA 3RYCB 3QTYA 3HKDB 3WJQA 2ZF8A 3E20B 1UFYA 3OBYA 5GIOC 4EI9A 3N2KB 4BT2A 2HQSC 1QD9A 5CA1B 2R751 3HKBB 3JATA 2L26A 1K8AH 5FNVB 3LWOC 2VAPA 3JAKB 4IIJA 4ZHWA 3HAXD 2HP3A 4O2BA 1X25A 3HKEA 4XCQA 1FNJA 2BTOA 1JJ2F 2RB9A 3CCVF 2CWJA 1K73H 1W55A 5EB1B 3L7QA 1S72F 1VQ6F 3O85A 2OTJF 1YI2F 1FFXA 3HJWC 2JNBA 3V3TA 1VHAA
chains in the Genus database with same CATH topology
1ONIA 3ZO8A 5HP7A 2IG8A 1XRGA 1QAHA 1FNKA 1UI9A 3R0PA 3LYBA 3V4DA 3KJJA 3VCZA 2CHTA 4ZK7A 1X25A 3K12A 1FNJA 1DBFA 2EWCA 2B33A 2CHSA 1PF5A 1JD1A 1COMA 3MQWA 2UYKA 2OTMA 3LMEA 3K0TA 3M1XA 1NQ3A 2UYPA 2UYJA 1XHOA 2CWJA 1J7HA 5HP8A 3L7QA 2CW4A 3ZOPA 3ZP4A 1UFYA 2CSLA 3ZP7A 3QUWA 1QU9A 1ODEA 3D01A 3GTZA 3KJKA 3M4SA 2UYNB 3I7TA 1QD9A 3I3FA 2UYNA 2DYYA 4NWOB 2CVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONI A;  3ZO8 A;  5HP7 A;  2IG8 A;  1XRG A;  1QAH A;  1FNK A;  1UI9 A;  3R0P A;  3LYB A;  3V4D A;  3KJJ A;  3VCZ A;  2CHT A;  4ZK7 A;  1X25 A;  3K12 A;  1FNJ A;  1DBF A;  2EWC A;  2B33 A;  2CHS A;  1PF5 A;  1JD1 A;  1COM A;  3MQW A;  2UYK A;  2OTM A;  3LME A;  3K0T A;  3M1X A;  1NQ3 A;  2UYP A;  2UYJ A;  1XHO A;  2CWJ A;  1J7H A;  5HP8 A;  3L7Q A;  2CW4 A;  3ZOP A;  3ZP4 A;  1UFY A;  2CSL A;  3ZP7 A;  3QUW A;  1QU9 A;  1ODE A;  3D01 A;  3GTZ A;  3KJK A;  3M4S A;  2UYN B;  3I7T A;  1QD9 A;  3I3F A;  2UYN A;  2DYY A;  4NWO B;  2CVL A; 
#chains in the Genus database with same CATH topology
 5HXZ A;  3RYF B;  1RA4 A;  1VQK F;  3CME F;  5ITZ A;  2HVY D;  4TZZ A;  3K14 A;  1JN1 A;  2MQE A;  4ZK7 A;  4O4L A;  1IV3 A;  3MQW A;  4G4Z A;  2HP0 A;  3N4Y A;  5J2U A;  3K0T A;  1W58 1;  3M1X A;  4FFB B;  4C8I A;  4BVR A;  2K1S A;  3JAR B;  5C8Y B;  4M8I A;  3RYH B;  3CXC F;  4X1I B;  2F9Z C;  2WAL A;  1W5F A;  5IYZ A;  5IJ0 B;  3CC7 F;  5JVD A;  1YHQ F;  2LBW A;  3LWP C;  3ZO8 A;  1E7K A;  5JH7 A;  2ZAU A;  2YXZ A;  3LYB A;  2LBX A;  1VQ8 F;  5LOV A;  5GIP C;  3PLA C;  5GAP K;  3WGL A;  5LP6 C;  1COM A;  4G88 A;  3CPQ A;  1XV2 A;  4I4T B;  1NQ3 A;  4EB6 B;  4ERH A;  4ZHQ B;  5CA0 B;  1Z5V A;  5LXT A;  3J81 M;  4O4J B;  3VIU A;  2CW4 A;  3IEQ A;  3RYI A;  4I55 B;  4ZHV A;  4HNA B;  1FSZ A;  1KC8 H;  2PHN A;  4X1Y B;  5JQG B;  3OON A;  1W42 A;  3P0Z A;  3JAL B;  3HTN A;  5LYJ A;  1K9M H;  1CLI A;  3F0F A;  3WXM B;  1W5B A;  1R1M A;  4TV9 B;  1SA0 B;  1XBI A;  1KQS F;  4TV8 B;  1W41 A;  4X1K A;  5LA6 A;  3JAS B;  3CPW F;  1IV2 A;  4RQO A;  4O4I A;  1QU9 A;  1VQL F;  1ODE A;  2UYN B;  3I7T A;  3J7A R;  2OZB A;  2DYY A;  3V7E A;  3LDT A;  2H8E A;  5KX5 A;  2ALE A;  1M1K H;  5HP7 A;  1KNK A;  2IG8 A;  4IHJ A;  4B62 A;  1FNK A;  4U3J A;  1RQ2 A;  5GON A;  3LWR C;  2VGN A;  1VQ7 F;  2RHO A;  3N2G B;  3K12 A;  3MDO A;  3S06 A;  2B33 A;  1GX1 A;  1PXW A;  1W40 A;  4X20 A;  3VYS C;  3CMA F;  3SIU A;  2H6L A;  1IV4 A;  2QA4 F;  2VAW A;  4ZOL B;  3P10 A;  5EWR A;  3ZOP A;  5MN6 A;  2G9I A;  1TVK B;  2V9Y A;  2RHH A;  5EB0 A;  4C4W C;  2ZVY A;  3GTZ A;  4G4W A;  5EZY B;  4O4H B;  1U3L A;  4DXD A;  1VK3 A;  2Z1E A;  3MBM A;  5EIB D;  5HXU A;  5LP6 A;  5IJ9 A;  5J2T B;  1YIJ F;  2OTL F;  2EWC A;  3NVI B;  4C82 A;  2AIF A;  3TD3 A;  3VYU C;  3CC2 F;  3LME A;  1W2B F;  3M84 A;  5IT9 M;  1TUB B;  5HP8 A;  4TUY A;  2IAF A;  3HKC B;  3ON1 A;  4BT7 A;  5EYP B;  3QUW A;  3Q8H A;  1W3E X;  5HY1 A;  3FBA A;  3QHD A;  4DRX B;  1QVF F;  3OW2 F;  5BMV B;  2HRU A;  4YJ3 A;  5MN4 A;  1X7P A;  3NVK E;  5B8F A;  1GO0 A;  3WJR A;  3VCZ A;  3CCJ F;  3D54 A;  1W57 A;  3OBW A;  3WJP A;  1T0K B;  1JD1 A;  5GAN K;  3G71 F;  3E22 B;  4KWE A;  2CZW A;  3JAW B;  3TD5 A;  3I55 F;  3CCL F;  4LCK A;  1Q7Y H;  1NJI H;  5KMG A;  4LNU A;  2CSL A;  3CCM F;  5CB4 A;  3KJK A;  4YJ2 A;  1T0A A;  3C9T A;  3F0G A;  1VQV A;  3CCR F;  1Z5W A;  3TD4 A;  4BW0 B;  3UT5 B;  4F6R A;  1QAH A;  4ZI7 B;  1UI9 A;  2BTQ B;  4BVS A;  4O2A B;  1JFF A;  4WBN A;  1PF5 A;  3RYC A;  3S0W A;  2R6R 1;  3B6N A;  3HKD A;  1NMU B;  2LBT A;  4B46 A;  1H48 A;  4G4V A;  1OAP A;  3VI6 A;  3D01 A;  2BTU A;  1CK2 A;  3N2K A;  5CA1 A;  2P6Y A;  3JAT B;  3EOR A;  3HKB A;  1DT9 A;  5G4V C;  4IIJ B;  3SIV A;  2GLZ A;  5FNV A;  3JAK A;  4O2B B;  3NK7 A;  5A2Q M;  3KJJ A;  3HKE B;  1SDS A;  3PAF A;  5GIN C;  2Z1U A;  1YQN A;  3VMF B;  1CN7 A;  3RA5 A;  3CCS F;  1FFX B;  3HWU A;  3S03 A;  1IV1 A;  3ZP4 A;  2N48 A;  3IKF A;  3BYQ A;  3MCQ A;  1YGY A;  3WPW A;  3I56 F;  3E1Y A;  3CC4 F;  3AGK A;  1N8R H;  1RLG A;  2ZOD A;  3C8L A;  3FFM A;  5MN5 A;  3CYP B;  1VQN F;  3RYF A;  5ITZ B;  1VQP F;  1VQ9 F;  1JY8 A;  3R0P A;  1YJ9 F;  2KTV A;  1U3P A;  5JCO C;  4BVT A;  4O4L B;  4NQ3 A;  2CHS A;  5J2U B;  2UYP A;  3K2X A;  4FFB A;  1XHO A;  3VOA A;  2VXY A;  1QVG F;  2QI2 A;  2HS0 A;  1VQM F;  3JAR A;  2RHL A;  5C8Y A;  3RYH A;  4X1I A;  5IYZ B;  3IR9 A;  4NWO B;  5JVD B;  1M90 H;  5IJ0 A;  1SZQ A;  3G6E F;  5JH7 B;  3GHZ A;  3S02 A;  5LOV B;  2KTU A;  1YIT F;  1VQ4 F;  1KD1 H;  2KG4 A;  3VO8 A;  1H47 A;  4NUT A;  3KHN A;  4I4T A;  4ZHQ A;  4EB6 A;  5LXT B;  5CA0 A;  3JCM M;  2QEX F;  3RYI B;  4BVQ A;  3V7Q A;  4O4J A;  5AVM A;  3IKE A;  4I55 A;  2QTP A;  4HNA A;  4U39 A;  2PMP A;  1ONI A;  4G4Y A;  1YJW F;  4X1Y A;  2ZVZ A;  2KGW A;  5JQG A;  1U40 A;  5LYJ B;  1X52 A;  3JAM M;  1ZWZ A;  3JAL A;  3WGM A;  2BO1 A;  4BT3 A;  2CHT A;  3CG6 A;  4EI7 A;  2FGY A;  2HX0 A;  3CD6 F;  3S0H A;  4TV9 A;  4X1K B;  5LA6 B;  4C81 A;  1SA0 A;  3F0E A;  3CCE F;  2ZOV A;  4TV8 A;  2RHJ A;  3DDN A;  4I50 B;  3C9U A;  4O4I B;  2H8C A;  3ZP7 A;  3JAS A;  3VOB A;  1W5A A;  4ZHY B;  2LCA A;  4PWT A;  3KIZ A;  3F0D A;  1W59 A;  2UYN A;  5KX5 B;  3NMU C;  1U43 A;  2VAM A;  5JCO A;  3WGK A;  3GYQ A;  4IHJ B;  3NK6 A;  1GZ0 A;  2Z01 A;  4U3J B;  3WGJ A;  3CCU F;  5GON B;  3V4D A;  2OHW A;  3IEW A;  5FLX M;  3LWQ C;  1X7O A;  4X20 B;  3ERN A;  4E6E A;  5EIB C;  3N2G A;  1IPA A;  4B5C A;  3G4S F;  2UYK A;  2OTM A;  1VQ5 F;  3KE1 A;  3D00 A;  4ZOL A;  3RE3 A;  3FD6 A;  2HS4 A;  1TVK A;  4RHA A;  2YYE A;  3WPX A;  2W8B C;  3M4S A;  5DCV A;  5HY2 A;  4EI8 A;  4G4X A;  2IQQ A;  2UZH A;  1OFU A;  1H7M A;  3DC2 A;  5EZY A;  4O4H A;  4X3L A;  5LP6 B;  1VH8 A;  3JVH A;  3N4Z A;  3P4E A;  5IJ9 B;  5J2T A;  2I6R A;  4R40 B;  5EAZ A;  2I6D A;  1Q81 H;  3CB2 A;  3RA6 A;  4BT4 A;  2HS3 A;  1Q8R A;  4TUY B;  1RLU A;  5HWE A;  1TUB A;  4B45 A;  3HKC A;  2GZL A;  3WGN A;  3C9R A;  1RQ7 A;  5EYP A;  2Q1Y A;  4DRX A;  2GVI A;  4C8G A;  3VYT C;  2CVL A;  4BT6 A;  4BY9 D;  1YJN F;  4YJ3 B;  3CCQ F;  1Q86 H;  5FJ4 C;  2DT4 A;  2FC3 A;  5EO3 A;  3FPI A;  5BMV A;  4BT5 A;  5HY4 A;  1GO1 A;  3FD5 A;  3J80 M;  2AMT A;  3LWV C;  1Q82 H;  2HP0 B;  3S0Y A;  4C8E A;  2UYJ A;  3E22 A;  1J7H A;  3JAW A;  5KMG B;  4LNU B;  4I50 A;  2Z1T A;  3ESJ A;  1KNJ A;  5CB4 B;  3IMP A;  4YJ2 B;  1W5E A;  3I3F A;  3U0O A;  3MCA B;  2Q1X A;  1VQO F;  2AIZ P;  3ELC A;  3F6M A;  2Z1F A;  4F6R B;  3VTI C;  3T80 A;  1XRG A;  3UT5 A;  5HY0 A;  5G4U C;  3C9S A;  4ZI7 A;  2NMU A;  2HRY A;  1JFF B;  3CYQ A;  4WBN B;  4O2A A;  1DBF A;  4X3M A;  2VGM A;  3LFO A;  3RYC B;  3QTY A;  3HKD B;  3WJQ A;  2ZF8 A;  3E20 B;  1UFY A;  3OBY A;  5GIO C;  4EI9 A;  3N2K B;  4BT2 A;  2HQS C;  1QD9 A;  5CA1 B;  2R75 1;  3HKB B;  3JAT A;  2L26 A;  1K8A H;  5FNV B;  3LWO C;  2VAP A;  3JAK B;  4IIJ A;  4ZHW A;  3HAX D;  2HP3 A;  4O2B A;  1X25 A;  3HKE A;  4XCQ A;  1FNJ A;  2BTO A;  1JJ2 F;  2RB9 A;  3CCV F;  2CWJ A;  1K73 H;  1W55 A;  5EB1 B;  3L7Q A;  1S72 F;  1VQ6 F;  3O85 A;  2OTJ F;  1YI2 F;  1FFX A;  3HJW C;  2JNB A;  3V3T A;  1VHA A; 
#chains in the Genus database with same CATH homology
 1ONI A;  3ZO8 A;  5HP7 A;  2IG8 A;  1XRG A;  1QAH A;  1FNK A;  1UI9 A;  3R0P A;  3LYB A;  3V4D A;  3KJJ A;  3VCZ A;  2CHT A;  4ZK7 A;  1X25 A;  3K12 A;  1FNJ A;  1DBF A;  2EWC A;  2B33 A;  2CHS A;  1PF5 A;  1JD1 A;  1COM A;  3MQW A;  2UYK A;  2OTM A;  3LME A;  3K0T A;  3M1X A;  1NQ3 A;  2UYP A;  2UYJ A;  1XHO A;  2CWJ A;  1J7H A;  5HP8 A;  3L7Q A;  2CW4 A;  3ZOP A;  3ZP4 A;  1UFY A;  2CSL A;  3ZP7 A;  3QUW A;  1QU9 A;  1ODE A;  3D01 A;  3GTZ A;  3KJK A;  3M4S A;  2UYN B;  3I7T A;  1QD9 A;  3I3F A;  2UYN A;  2DYY A;  4NWO B;  2CVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...