3MQWA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
132
Chain Sequence
b'QTQGPMSKLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 35
structure length 132
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3mqwA00
1QAHA 3K0TA 1JD1A 2CSLA 1XHOA 2CWJA 2CW4A 1UFYA 1XRGA 1DBFA 2IG8A 1J7HA 1PF5A 3ZP7A 1ODEA 2DYYA 3GTZA 1QU9A 1FNKA 1COMA 3R0PA 2EWCA 3K12A 2UYNA 5HP7A 3KJKA 2UYKA 3QUWA 1X25A 2UYNB 1ONIA 3D01A 2B33A 3KJJA 2CHSA 1UI9A 3VCZA 2UYPA 4NWOB 1NQ3A 3ZP4A 3LMEA 3I3FA 3M1XA 3ZO8A 2UYJA 3L7QA 3V4DA 2CVLA 3LYBA 1QD9A 1FNJA 2OTMA 3M4SA 3MQWA 5HP8A 4ZK7A 3I7TA 3ZOPA 2CHTA
chains in the Genus database with same CATH superfamily
1RQ7A 3K0TA 2OZBA 1XHOA 4O4JB 1VQPF 2VAPA 2H8CA 1YIJF 4ZI7A 2DYYA 3IKFA 5IJ0B 3CCRF 5LP6A 3JAMM 3QUWA 4YJ2A 2YXZA 4EI9A 2YYEA 3HKBA 5FLXM 1YJNF 4BVTA 3UT5A 1IV1A 4BW0B 1M90H 1QD9A 2LBTA 4EB6B 2IAFA 3CCVF 2ZVYA 3CPQA 3CG6A 1Q8RA 4O4IB 3T80A 5HXUA 1SDSA 1VQ9F 3ZP7A 3CCMF 5CA1A 1TUBB 3R0PA 4R40B 3JARB 3RYHA 4BVQA 1VQLF 2RHHA 3F0EA 3MCQA 3VI6A 4B5CA 4O2BA 1RLGA 4BY9D 5LOVA 3TD3A 3VOAA 4NWOB 2HQSC 1KD1H 5LYJB 5GINC 3HKCA 4X3LA 3LWPC 1JFFB 1U43A 5EYPB 3CCLF 3I7TA 1YJWF 2PHNA 4F6RA 3RYCB 2ZOVA 5J2TA 3VYUC 3NK7A 4X20B 2UYKA 5FNVB 3WPXA 4ZHQA 3N2GB 5ITZB 1Z5VA 4ZHVA 1H48A 2CZWA 4X1KB 3NVKE 2Z1UA 3MDOA 2GVIA 4FFBB 4YJ3A 4HNAA 1JY8A 2L26A 4X3MA 1W5AA 2CHTA 5KX5A 4KWEA 2LBWA 3I55F 3CPWF 1JN1A 1QU9A 5JQGA 2R6R1 3NK6A 4ZI7B 2RHJA 3K12A 2UYNA 5HP7A 5LP6B 3IEWA 2QEXF 2H6LA 3WGNA 4I4TA 5KMGA 1NMUB 1VQKF 1W5EA 2CHSA 2FGYA 3TD4A 3FBAA 1VQVA 5G4UC 1W42A 2ZAUA 3Q8HA 1W57A 5A2QM 2BTUA 4BVRA 4BT6A 4U3JA 3PAFA 2WALA 3MQWA 2Z1FA 1JD1A 2CSLA 1J7HA 3D00A 4BVSA 3G6EF 5HY1A 1CN7A 2FC3A 1S72F 2EWCA 3JVHA 1H7MA 4G4ZA 4O2AB 3RYHB 4WBNA 5GIOC 3I56F 2ALEA 2HRUA 1ONIA 3RYIA 4O2BB 1K9MH 2UZHA 4I50B 4IIJA 3GHZA 3CCJF 2QI2A 4M8IA 3BYQA 3CXCF 3N4YA 1W5BA 4IHJA 4LCKA 1IV3A 1IV4A 2VAWA 2KGWA 3HKCB 3C8LA 3VOBA 2Q1YA 5EIBD 3S03A 4G88A 3CMEF 2N48A 3ZP4A 4LNUB 1NJIH 5MN5A 1UFYA 5LA6A 1VQ6F 3WGJA 5EIBC 4F6RB 5J2TB 5HY0A 3IEQA 2AIFA 3WJPA 1SA0B 1U3LA 3GYQA 5CA0B 5J2UA 3LWRC 3OBYA 1FFXA 3CCSF 4ZHQB 3ERNA 2BO1A 3VYSC 5CB4A 1NQ3A 4BT4A 5EB1B 1Q82H 1YITF 4I55A 5GAPK 4BT5A 4O4LA 4G4VA 3VO8A 3CCQF 2LBXA 1RQ2A 1W3EX 4YJ3B 4HNAB 5GIPC 3IKEA 3JATB 3HKEA 5EWRA 2KTVA 3VYTC 4B46A 5KX5B 4TV8B 4XCQA 3HKDB 1FNKA 4TUYB 1COMA 2VXYA 5GONA 5C8YA 3U0OA 5IT9M 4E6EA 3CCUF 4BT7A 3KJKA 3P4EA 4ZHYB 4RQOA 3OONA 3AGKA 2QA4F 1UI9A 1YI2F 1VQ7F 2VGNA 1W59A 5AVMA 1T0KB 3LYBA 3G71F 2AIZP 2VAMA 5HY2A 4U3JB 1CLIA 3B6NA 3CYQA 2R751 2HX0A 1XRGA 3JALA 2IQQA 1ODEA 4C8GA 1IPAA 3LWOC 1QVFF 2LCAA 1Q7YH 1GZ0A 2B33A 3RYIB 2I6DA 4IIJB 3C9TA 3M1XA 1FSZA 4PWTA 2RHOA 5B8FA 3SIVA 1DT9A 4BT3A 3M4SA 2ZF8A 3ON1A 4O4JA 5BMVB 3CC4F 1Q86H 3J80M 2Z1TA 2I6RA 3JAKA 1VK3A 2H8EA 3CB2A 2BTQB 2GLZA 3MCAB 1YGYA 2HP0A 3ESJA 3FD5A 3SIUA 1GX1A 3VTIC 3CD6F 3VIUA 4O4HA 1VQOF 4YJ2B 5J2UB 3VCZA 1FFXB 3HWUA 1GO1A 3HKBB 1VQ4F 2GZLA 2K1SA 3C9SA 4EB6A 3ZO8A 5CB4B 3C9UA 4EI8A 2UYJA 2W8BC 2CVLA 4X1YA 4I55B 3UT5B 4C8EA 3S0WA 5GANK 3FFMA 1VQ8F 5G4VC 3QHDA 5IYZA 1KC8H 1QVGF 4ERHA 3K2XA 5EZYA 3HKEB 1TUBA 2KG4A 3V7QA 3HAXD 3RYFA 3RA5A 1X7PA 5FJ4C 3LWQC 1H47A 5GONB 5CA1B 1PXWA 3CC7F 2HS0A 3KJJA 5HXZA 5LYJA 4C81A 4U39A 3WJQA 5LOVB 3D54A 3L7QA 5HY4A 3F0GA 1W2BF 3LWVC 1TVKA 1X7OA 5IJ9A 3WGLA 3RYCA 2VGMA 3JALB 1RLUA 1SZQA 4X1IA 4G4WA 4ZHWA 3LFOA 5FNVA 4TV9A 3FPIA 5EAZA 1OAPA 4BT2A 3WPWA 2MQEA 4X1KA 2UYPA 1W55A 5LP6C 3E22A 1YHQF 3J81M 3IMPA 1RA4A 1E7KA 3JCMM 4DRXA 3E1YA 3RE3A 1M1KH 1XBIA 3JASA 5HP8A 1QAHA 3KHNA 4EI7A 3NMUC 1DBFA 1VQ5F 5JH7A 3C9RA 3JAKB 2QTPA 5JVDA 3EORA 3J7AR 2HP0B 5JQGB 3F6MA 2HVYD 3K14A 2UYNB 1VQNF 2DT4A 3N2KA 4I4TB 4O4HB 5KMGB 3OBWA 3LMEA 4ZOLA 5LXTA 2ZODA 4NUTA 4C82A 3OW2F 1FNJA 4X1YB 2G9IA 3RA6A 1K8AH 3HTNA 3V7EA 1VHAA 3F0DA 3S02A 1T0AA 2CWJA 3P0ZA 4C4WC 5IYZB 2AMTA 5EZYB 4O2AA 3WGMA 1JJ2F 3E20B 3RYFB 4NQ3A 3JAWA 1N8RH 1X25A 4I50A 4WBNB 2PMPA 1Z5WA 3G4SF 2ZVZA 3WXMB 2HRYA 4G4XA 3MBMA 3VMFB 3V4DA 3P10A 4LNUA 4IHJB 5JCOC 1VH8A 2Z01A 2Z1EA 3PLAC 2CW4A 1TVKB 5IJ9B 1YQNA 3WGKA 1U40A 5IJ0A 3GTZA 3N4ZA 5LA6B 1GO0A 1W5FA 2HS4A 4X1IB 1SA0A 4TZZA 5CA0A 2OTLF 4TV9B 5JCOA 5MN4A 2RHLA 2V9YA 1W581 2Q1XA 1OFUA 3KE1A 3E22B 2RB9A 2HP3A 3KIZA 3FD6A 3DDNA 1W40A 3JATA 4O4IA 2OTMA 2OTJF 4O4LB 4DRXB 4ZK7A 1XV2A 3S0HA 4TV8A 3JASB 3ELCA 3CMAF 1KQSF 3QTYA 3HKDA 3V3TA 4TUYA 3NVIB 5JH7B 3JARA 4C8IA 5JVDB 2OHWA 3HJWC 3F0FA 3CYPB 3CC2F 5C8YB 3O85A 1Q81H 4DXDA 5HWEA 1YJ9F 2JNBA 3N2KB 5EB0A 3I3FA 3IR9A 1JFFA 4ZOLB 1CK2A 5LXTB 5EYPA 2KTUA 4G4YA 4RHAA 3LDTA 2IG8A 3TD5A 1PF5A 1KNJA 3S0YA 1KNKA 5EO3A 4X20A 3DC2A 3CCEF 1IV2A 4B45A 1ZWZA 3JAWB 3N2GA 1K73H 3D01A 5ITZA 1VQMF 4B62A 2NMUA 5DCVA 1W41A 2F9ZC 4FFBA 3WJRA 2HS3A 2BTOA 5BMVA 1X52A 1U3PA 2P6YA 3S06A 3M84A 5MN6A 1R1MA 3ZOPA
chains in the Genus database with same CATH topology
1QAHA 3K0TA 1JD1A 2CSLA 1XHOA 2CWJA 2CW4A 1UFYA 1XRGA 1DBFA 2IG8A 1J7HA 1PF5A 3ZP7A 1ODEA 2DYYA 3GTZA 1QU9A 1FNKA 1COMA 3R0PA 2EWCA 3K12A 2UYNA 5HP7A 3KJKA 2UYKA 3QUWA 1X25A 2UYNB 1ONIA 3D01A 2B33A 3KJJA 2CHSA 1UI9A 3VCZA 2UYPA 4NWOB 1NQ3A 3ZP4A 3LMEA 3I3FA 3M1XA 3ZO8A 2UYJA 3L7QA 3V4DA 2CVLA 3LYBA 1QD9A 1FNJA 2OTMA 3M4SA 3MQWA 5HP8A 4ZK7A 3I7TA 3ZOPA 2CHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAH A;  3K0T A;  1JD1 A;  2CSL A;  1XHO A;  2CWJ A;  2CW4 A;  1UFY A;  1XRG A;  1DBF A;  2IG8 A;  1J7H A;  1PF5 A;  3ZP7 A;  1ODE A;  2DYY A;  3GTZ A;  1QU9 A;  1FNK A;  1COM A;  3R0P A;  2EWC A;  3K12 A;  2UYN A;  5HP7 A;  3KJK A;  2UYK A;  3QUW A;  1X25 A;  2UYN B;  1ONI A;  3D01 A;  2B33 A;  3KJJ A;  2CHS A;  1UI9 A;  3VCZ A;  2UYP A;  4NWO B;  1NQ3 A;  3ZP4 A;  3LME A;  3I3F A;  3M1X A;  3ZO8 A;  2UYJ A;  3L7Q A;  3V4D A;  2CVL A;  3LYB A;  1QD9 A;  1FNJ A;  2OTM A;  3M4S A;  3MQW A;  5HP8 A;  4ZK7 A;  3I7T A;  3ZOP A;  2CHT A; 
#chains in the Genus database with same CATH topology
 1RQ7 A;  3K0T A;  2OZB A;  1XHO A;  4O4J B;  1VQP F;  2VAP A;  2H8C A;  1YIJ F;  4ZI7 A;  2DYY A;  3IKF A;  5IJ0 B;  3CCR F;  5LP6 A;  3JAM M;  3QUW A;  4YJ2 A;  2YXZ A;  4EI9 A;  2YYE A;  3HKB A;  5FLX M;  1YJN F;  4BVT A;  3UT5 A;  1IV1 A;  4BW0 B;  1M90 H;  1QD9 A;  2LBT A;  4EB6 B;  2IAF A;  3CCV F;  2ZVY A;  3CPQ A;  3CG6 A;  1Q8R A;  4O4I B;  3T80 A;  5HXU A;  1SDS A;  1VQ9 F;  3ZP7 A;  3CCM F;  5CA1 A;  1TUB B;  3R0P A;  4R40 B;  3JAR B;  3RYH A;  4BVQ A;  1VQL F;  2RHH A;  3F0E A;  3MCQ A;  3VI6 A;  4B5C A;  4O2B A;  1RLG A;  4BY9 D;  5LOV A;  3TD3 A;  3VOA A;  4NWO B;  2HQS C;  1KD1 H;  5LYJ B;  5GIN C;  3HKC A;  4X3L A;  3LWP C;  1JFF B;  1U43 A;  5EYP B;  3CCL F;  3I7T A;  1YJW F;  2PHN A;  4F6R A;  3RYC B;  2ZOV A;  5J2T A;  3VYU C;  3NK7 A;  4X20 B;  2UYK A;  5FNV B;  3WPX A;  4ZHQ A;  3N2G B;  5ITZ B;  1Z5V A;  4ZHV A;  1H48 A;  2CZW A;  4X1K B;  3NVK E;  2Z1U A;  3MDO A;  2GVI A;  4FFB B;  4YJ3 A;  4HNA A;  1JY8 A;  2L26 A;  4X3M A;  1W5A A;  2CHT A;  5KX5 A;  4KWE A;  2LBW A;  3I55 F;  3CPW F;  1JN1 A;  1QU9 A;  5JQG A;  2R6R 1;  3NK6 A;  4ZI7 B;  2RHJ A;  3K12 A;  2UYN A;  5HP7 A;  5LP6 B;  3IEW A;  2QEX F;  2H6L A;  3WGN A;  4I4T A;  5KMG A;  1NMU B;  1VQK F;  1W5E A;  2CHS A;  2FGY A;  3TD4 A;  3FBA A;  1VQV A;  5G4U C;  1W42 A;  2ZAU A;  3Q8H A;  1W57 A;  5A2Q M;  2BTU A;  4BVR A;  4BT6 A;  4U3J A;  3PAF A;  2WAL A;  3MQW A;  2Z1F A;  1JD1 A;  2CSL A;  1J7H A;  3D00 A;  4BVS A;  3G6E F;  5HY1 A;  1CN7 A;  2FC3 A;  1S72 F;  2EWC A;  3JVH A;  1H7M A;  4G4Z A;  4O2A B;  3RYH B;  4WBN A;  5GIO C;  3I56 F;  2ALE A;  2HRU A;  1ONI A;  3RYI A;  4O2B B;  1K9M H;  2UZH A;  4I50 B;  4IIJ A;  3GHZ A;  3CCJ F;  2QI2 A;  4M8I A;  3BYQ A;  3CXC F;  3N4Y A;  1W5B A;  4IHJ A;  4LCK A;  1IV3 A;  1IV4 A;  2VAW A;  2KGW A;  3HKC B;  3C8L A;  3VOB A;  2Q1Y A;  5EIB D;  3S03 A;  4G88 A;  3CME F;  2N48 A;  3ZP4 A;  4LNU B;  1NJI H;  5MN5 A;  1UFY A;  5LA6 A;  1VQ6 F;  3WGJ A;  5EIB C;  4F6R B;  5J2T B;  5HY0 A;  3IEQ A;  2AIF A;  3WJP A;  1SA0 B;  1U3L A;  3GYQ A;  5CA0 B;  5J2U A;  3LWR C;  3OBY A;  1FFX A;  3CCS F;  4ZHQ B;  3ERN A;  2BO1 A;  3VYS C;  5CB4 A;  1NQ3 A;  4BT4 A;  5EB1 B;  1Q82 H;  1YIT F;  4I55 A;  5GAP K;  4BT5 A;  4O4L A;  4G4V A;  3VO8 A;  3CCQ F;  2LBX A;  1RQ2 A;  1W3E X;  4YJ3 B;  4HNA B;  5GIP C;  3IKE A;  3JAT B;  3HKE A;  5EWR A;  2KTV A;  3VYT C;  4B46 A;  5KX5 B;  4TV8 B;  4XCQ A;  3HKD B;  1FNK A;  4TUY B;  1COM A;  2VXY A;  5GON A;  5C8Y A;  3U0O A;  5IT9 M;  4E6E A;  3CCU F;  4BT7 A;  3KJK A;  3P4E A;  4ZHY B;  4RQO A;  3OON A;  3AGK A;  2QA4 F;  1UI9 A;  1YI2 F;  1VQ7 F;  2VGN A;  1W59 A;  5AVM A;  1T0K B;  3LYB A;  3G71 F;  2AIZ P;  2VAM A;  5HY2 A;  4U3J B;  1CLI A;  3B6N A;  3CYQ A;  2R75 1;  2HX0 A;  1XRG A;  3JAL A;  2IQQ A;  1ODE A;  4C8G A;  1IPA A;  3LWO C;  1QVF F;  2LCA A;  1Q7Y H;  1GZ0 A;  2B33 A;  3RYI B;  2I6D A;  4IIJ B;  3C9T A;  3M1X A;  1FSZ A;  4PWT A;  2RHO A;  5B8F A;  3SIV A;  1DT9 A;  4BT3 A;  3M4S A;  2ZF8 A;  3ON1 A;  4O4J A;  5BMV B;  3CC4 F;  1Q86 H;  3J80 M;  2Z1T A;  2I6R A;  3JAK A;  1VK3 A;  2H8E A;  3CB2 A;  2BTQ B;  2GLZ A;  3MCA B;  1YGY A;  2HP0 A;  3ESJ A;  3FD5 A;  3SIU A;  1GX1 A;  3VTI C;  3CD6 F;  3VIU A;  4O4H A;  1VQO F;  4YJ2 B;  5J2U B;  3VCZ A;  1FFX B;  3HWU A;  1GO1 A;  3HKB B;  1VQ4 F;  2GZL A;  2K1S A;  3C9S A;  4EB6 A;  3ZO8 A;  5CB4 B;  3C9U A;  4EI8 A;  2UYJ A;  2W8B C;  2CVL A;  4X1Y A;  4I55 B;  3UT5 B;  4C8E A;  3S0W A;  5GAN K;  3FFM A;  1VQ8 F;  5G4V C;  3QHD A;  5IYZ A;  1KC8 H;  1QVG F;  4ERH A;  3K2X A;  5EZY A;  3HKE B;  1TUB A;  2KG4 A;  3V7Q A;  3HAX D;  3RYF A;  3RA5 A;  1X7P A;  5FJ4 C;  3LWQ C;  1H47 A;  5GON B;  5CA1 B;  1PXW A;  3CC7 F;  2HS0 A;  3KJJ A;  5HXZ A;  5LYJ A;  4C81 A;  4U39 A;  3WJQ A;  5LOV B;  3D54 A;  3L7Q A;  5HY4 A;  3F0G A;  1W2B F;  3LWV C;  1TVK A;  1X7O A;  5IJ9 A;  3WGL A;  3RYC A;  2VGM A;  3JAL B;  1RLU A;  1SZQ A;  4X1I A;  4G4W A;  4ZHW A;  3LFO A;  5FNV A;  4TV9 A;  3FPI A;  5EAZ A;  1OAP A;  4BT2 A;  3WPW A;  2MQE A;  4X1K A;  2UYP A;  1W55 A;  5LP6 C;  3E22 A;  1YHQ F;  3J81 M;  3IMP A;  1RA4 A;  1E7K A;  3JCM M;  4DRX A;  3E1Y A;  3RE3 A;  1M1K H;  1XBI A;  3JAS A;  5HP8 A;  1QAH A;  3KHN A;  4EI7 A;  3NMU C;  1DBF A;  1VQ5 F;  5JH7 A;  3C9R A;  3JAK B;  2QTP A;  5JVD A;  3EOR A;  3J7A R;  2HP0 B;  5JQG B;  3F6M A;  2HVY D;  3K14 A;  2UYN B;  1VQN F;  2DT4 A;  3N2K A;  4I4T B;  4O4H B;  5KMG B;  3OBW A;  3LME A;  4ZOL A;  5LXT A;  2ZOD A;  4NUT A;  4C82 A;  3OW2 F;  1FNJ A;  4X1Y B;  2G9I A;  3RA6 A;  1K8A H;  3HTN A;  3V7E A;  1VHA A;  3F0D A;  3S02 A;  1T0A A;  2CWJ A;  3P0Z A;  4C4W C;  5IYZ B;  2AMT A;  5EZY B;  4O2A A;  3WGM A;  1JJ2 F;  3E20 B;  3RYF B;  4NQ3 A;  3JAW A;  1N8R H;  1X25 A;  4I50 A;  4WBN B;  2PMP A;  1Z5W A;  3G4S F;  2ZVZ A;  3WXM B;  2HRY A;  4G4X A;  3MBM A;  3VMF B;  3V4D A;  3P10 A;  4LNU A;  4IHJ B;  5JCO C;  1VH8 A;  2Z01 A;  2Z1E A;  3PLA C;  2CW4 A;  1TVK B;  5IJ9 B;  1YQN A;  3WGK A;  1U40 A;  5IJ0 A;  3GTZ A;  3N4Z A;  5LA6 B;  1GO0 A;  1W5F A;  2HS4 A;  4X1I B;  1SA0 A;  4TZZ A;  5CA0 A;  2OTL F;  4TV9 B;  5JCO A;  5MN4 A;  2RHL A;  2V9Y A;  1W58 1;  2Q1X A;  1OFU A;  3KE1 A;  3E22 B;  2RB9 A;  2HP3 A;  3KIZ A;  3FD6 A;  3DDN A;  1W40 A;  3JAT A;  4O4I A;  2OTM A;  2OTJ F;  4O4L B;  4DRX B;  4ZK7 A;  1XV2 A;  3S0H A;  4TV8 A;  3JAS B;  3ELC A;  3CMA F;  1KQS F;  3QTY A;  3HKD A;  3V3T A;  4TUY A;  3NVI B;  5JH7 B;  3JAR A;  4C8I A;  5JVD B;  2OHW A;  3HJW C;  3F0F A;  3CYP B;  3CC2 F;  5C8Y B;  3O85 A;  1Q81 H;  4DXD A;  5HWE A;  1YJ9 F;  2JNB A;  3N2K B;  5EB0 A;  3I3F A;  3IR9 A;  1JFF A;  4ZOL B;  1CK2 A;  5LXT B;  5EYP A;  2KTU A;  4G4Y A;  4RHA A;  3LDT A;  2IG8 A;  3TD5 A;  1PF5 A;  1KNJ A;  3S0Y A;  1KNK A;  5EO3 A;  4X20 A;  3DC2 A;  3CCE F;  1IV2 A;  4B45 A;  1ZWZ A;  3JAW B;  3N2G A;  1K73 H;  3D01 A;  5ITZ A;  1VQM F;  4B62 A;  2NMU A;  5DCV A;  1W41 A;  2F9Z C;  4FFB A;  3WJR A;  2HS3 A;  2BTO A;  5BMV A;  1X52 A;  1U3P A;  2P6Y A;  3S06 A;  3M84 A;  5MN6 A;  1R1M A;  3ZOP A; 
#chains in the Genus database with same CATH homology
 1QAH A;  3K0T A;  1JD1 A;  2CSL A;  1XHO A;  2CWJ A;  2CW4 A;  1UFY A;  1XRG A;  1DBF A;  2IG8 A;  1J7H A;  1PF5 A;  3ZP7 A;  1ODE A;  2DYY A;  3GTZ A;  1QU9 A;  1FNK A;  1COM A;  3R0P A;  2EWC A;  3K12 A;  2UYN A;  5HP7 A;  3KJK A;  2UYK A;  3QUW A;  1X25 A;  2UYN B;  1ONI A;  3D01 A;  2B33 A;  3KJJ A;  2CHS A;  1UI9 A;  3VCZ A;  2UYP A;  4NWO B;  1NQ3 A;  3ZP4 A;  3LME A;  3I3F A;  3M1X A;  3ZO8 A;  2UYJ A;  3L7Q A;  3V4D A;  2CVL A;  3LYB A;  1QD9 A;  1FNJ A;  2OTM A;  3M4S A;  3MQW A;  5HP8 A;  4ZK7 A;  3I7T A;  3ZOP A;  2CHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...