3MQWA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
132
Chain Sequence
QTQGPMSKLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
molecule keywords putative Endoribonuclease L-PSP
total genus 35
structure length 132
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3mqwA00
3I7TA 3K0TA 5HP8A 2UYNA 3ZO8A 3LYBA 3GTZA 3ZP7A 5HP7A 2B33A 1QD9A 3V4DA 1J7HA 1JD1A 3R0PA 3K12A 1ONIA 1X25A 2CHTA 2UYNB 2IG8A 1NQ3A 3LMEA 2OTMA 4NWOB 3ZOPA 4ZK7A 2EWCA 3VCZA 1XRGA 1QU9A 2UYKA 3M1XA 2CVLA 1PF5A 3D01A 1ODEA 3I3FA 3QUWA 1UFYA 1XHOA 2CWJA 2CW4A 1FNJA 3KJKA 2DYYA 2CSLA 3M4SA 3ZP4A 2UYPA 1UI9A 3KJJA 1COMA 1DBFA 1FNKA 2CHSA 3MQWA 2UYJA 1QAHA 3L7QA
chains in the Genus database with same CATH superfamily
2QEXF 3CPWF 1TVKA 4G4YA 1RA4A 2ZVYA 4TV8A 2B33A 2HRUA 1VH8A 2ZODA 1FFXB 2QA4F 4FFBA 3CCRF 5GIOC 1VQLF 1SA0A 5JQGB 4G4XA 2BO1A 2VGMA 5EIBC 4ZI7B 3WJPA 3G4SF 5IJ0B 3LMEA 3CCLF 1CN7A 3D54A 4IIJA 3JASA 3RYFB 4O4HA 5IJ0A 2Q1XA 3C9UA 5HY1A 4O2BB 1GO0A 2K1SA 2VAWA 3IKFA 1FFXA 3P10A 3S02A 1GO1A 4NQ3A 1YQNA 1NMUB 1FNKA 1YJWF 3JCMM 4G4WA 3CPQA 1ZWZA 1KQSF 3VIUA 1S72F 1R1MA 1X52A 3S03A 2Z1FA 3LWRC 2BTUA 2Q1YA 4ZOLB 1Z5VA 3BYQA 5JCOA 5FJ4C 1W3EX 5HY0A 3RYCB 3P4EA 2YYEA 2KG4A 5C8YB 4ZHQA 4ZI7A 1T0AA 1SA0B 4B45A 2FC3A 3HWUA 1U3LA 4TV9A 3FD5A 1K8AH 3N4ZA 2CSLA 4DXDA 3ON1A 4TV9B 1YIJF 4TUYB 3MCAB 1YHQF 4C8IA 2HS4A 1SDSA 5LXTA 3F0FA 1VK3A 4C8GA 2LBWA 4BT2A 3J7AR 3CCJF 4BW0B 5EWRA 3RE3A 2HS3A 1VQ7F 3K14A 3JATA 2QI2A 3RYHB 3QUWA 3FPIA 4WBNB 1XHOA 3NMUC 3RYIA 5JVDA 2N48A 3HJWC 1COMA 1DBFA 1JFFA 3ESJA 3FFMA 5J2UB 3VYSC 1QAHA 3ERNA 5EO3A 5ITZA 2QTPA 3IEWA 4IHJA 3E20B 5MN4A 1W5EA 3LWOC 5LP6A 3PLAC 1Z5WA 4ZOLA 3SIVA 5LOVB 1VQ4F 4RQOA 3N4YA 1VQ8F 1KNKA 3JARB 5JQGA 3CCQF 1VQ6F 4B5CA 5KX5A 1JD1A 3DC2A 2JNBA 1W581 5MN6A 3JAMM 2OZBA 2IG8A 1NQ3A 2ALEA 5EB0A 4TZZA 4O2AA 1VQNF 3G6EF 3D00A 1VQ5F 3JAWB 1JFFB 3C9RA 3RYIB 1FSZA 4X1KA 3JALB 1VQOF 3CB2A 1IV4A 1TUBB 1QD9A 1NJIH 3F0GA 1J7HA 3MBMA 2UZHA 2GZLA 3VOBA 4B62A 3FD6A 2G9IA 3CCEF 4I4TB 4X20A 3IR9A 5CA0B 3M1XA 4X1IA 3D01A 3O85A 3KJKA 3CMAF 3LWVC 5G4UC 5J2TB 2ZF8A 4B46A 3LWQC 1W59A 4I55B 3J80M 1H47A 2R751 3NK6A 2HP0B 3HAXD 4O4JA 1E7KA 4LNUB 2HRYA 4YJ3A 1Q81H 1IV1A 1VQMF 1ONIA 2AIZP 1XBIA 2RHOA 4O2AB 1SZQA 2NMUA 4BVSA 5HXZA 3VCZA 1PF5A 5IYZA 1M1KH 1FNJA 2HP3A 4X1YA 2KTUA 5EB1B 1RQ2A 3C9SA 1TVKB 3PAFA 5KMGB 2LCAA 1OFUA 2Z1EA 3K0TA 3RYFA 2VAMA 4ZHWA 1K73H 3QTYA 1X7PA 3RA5A 3TD5A 4YJ3B 3WPWA 3HKDA 3VMFB 2PMPA 5MN5A 1W41A 2CHTA 3N2GA 4TV8B 2Z1UA 3CCSF 3JARA 4C81A 3IMPA 2VAPA 1IPAA 5LP6C 4BT7A 2DYYA 3M4SA 3LDTA 3HTNA 3HKBA 1GX1A 5CB4B 1RLGA 4TUYA 2CZWA 3VI6A 3M84A 4G88A 3ZO8A 3LYBA 5GANK 3HKEA 3C8LA 2HP0A 1U3PA 4C82A 1K9MH 3UT5A 1VQ9F 4DRXA 1XV2A 1KC8H 2HS0A 4C8EA 4U3JA 4O4LA 3UT5B 1DT9A 1PXWA 3ELCA 3V7QA 3HKEB 1JN1A 1T0KB 1Q8RA 3F0EA 3I3FA 1RQ7A 3Q8HA 2CW4A 3OBYA 5JH7A 3RYCA 4PWTA 3ZP4A 2RHJA 5LYJB 2ZAUA 4BVRA 2UYJA 3TD3A 3T80A 3S0HA 3WGKA 1VQVA 4BT4A 5LA6B 1H48A 5KX5B 2FGYA 4M8IA 3VTIC 3HKDB 1YJNF 5FNVB 5BMVA 1H7MA 2RHHA 4IIJB 5EZYB 3TD4A 3CCMF 1YITF 1X7OA 2I6DA 2OTLF 3QHDA 2Z1TA 3NK7A 4G4VA 3IEQA 2UYNA 3GTZA 3ZP7A 3JVHA 4EI9A 1QVGF 1N8RH 3E1YA 5LYJA 2W8BC 2H8EA 2AIFA 2OHWA 3VOAA 5CA1B 1W5AA 3OBWA 5J2UA 3I56F 5KMGA 1U40A 2OTJF 5HXUA 4ZHYB 4ZK7A 3S0WA 3VYTC 3KHNA 3RA6A 2BTQB 4EB6B 2CWJA 4DRXB 1UI9A 1IV2A 3I7TA 3HKCB 4I4TA 4X20B 5GONA 3CCVF 4LNUA 2DT4A 5DCVA 1YI2F 4O4JB 4BT3A 5C8YA 1YGYA 5CA1A 4KWEA 1VQPF 2LBXA 2HQSC 3KIZA 2UYNB 5GIPC 3CMEF 3EORA 2H8CA 5J2TA 2KGWA 4HNAB 5EYPA 4BY9D 3N2GB 1RLUA 2CVLA 1W55A 3JAKB 2BTOA 2AMTA 2YXZA 4F6RB 4I50B 3WGNA 3SIUA 1GZ0A 5FLXM 1W42A 2ZOVA 4O4IB 1JY8A 5HP7A 2VXYA 3E22B 4ZHVA 5JVDB 3F6MA 3JALA 1VQKF 3MDOA 1X25A 5GAPK 3V3TA 2EWCA 5AVMA 5B8FA 3U0OA 2UYKA 3WPXA 1W57A 3OW2F 1ODEA 5LP6B 3JASB 3S06A 3VYUC 3C9TA 4U39A 4F6RA 2UYPA 4I50A 2VGNA 5BMVB 3JAKA 3WGMA 4BVTA 4BT5A 4EI8A 4I55A 5IYZB 3E22A 4X3LA 3LFOA 4BT6A 4ERHA 4O4IA 3FBAA 2WALA 3WGJA 3G71F 5ITZB 3CG6A 3WJQA 1IV3A 4NWOB 2RHLA 3WJRA 5CB4A 5IT9M 1XRGA 5HY4A 4WBNA 1M90H 3CD6F 3HKCA 5GONB 1UFYA 2IAFA 5IJ9A 2I6RA 1TUBA 3V7EA 3CXCF 4R40B 5IJ9B 4X1KB 2P6YA 4RHAA 1KNJA 3IKEA 4ZHQB 5A2QM 1JJ2F 3R0PA 1CK2A 3K12A 3CC2F 4NUTA 3I55F 3K2XA 5JCOC 4EI7A 4G4ZA 3AGKA 3N2KB 4YJ2A 2F9ZC 5GINC 5G4VC 4X1YB 1Q7YH 1CLIA 4YJ2B 3S0YA 2CHSA 3MQWA 2LBTA 3JAWA 3B6NA 4O2BA 3OONA 3VO8A 2PHNA 5HWEA 5EZYA 2IQQA 2Z01A 5JH7B 2HVYD 3CYPB 1W5FA 5FNVA 5EAZA 3MCQA 3F0DA 4FFBB 4X3MA 1YJ9F 2OTMA 2ZVZA 4HNAA 5EYPB 5LA6A 3ZOPA 1Q82H 3KE1A 3N2KA 3P0ZA 5EIBD 3NVKE 3NVIB 1W2BF 5LOVA 4O4HB 2R6R1 4BVQA 1U43A 5LXTB 4IHJB 2KTVA 3GYQA 1KD1H 3L7QA 3GHZA 5HP8A 3WXMB 5HY2A 4LCKA 2GLZA 2RB9A 3LWPC 3JATB 3RYHA 1W5BA 1VHAA 4XCQA 3V4DA 2HX0A 4E6EA 4C4WC 1Q86H 4O4LB 3J81M 4EB6A 3CC7F 3CYQA 4U3JB 2L26A 2MQEA 2GVIA 1W40A 4X1IB 1QU9A 5CA0A 2V9YA 3DDNA 1QVFF 2H6LA 1OAPA 3WGLA 3KJJA 3HKBB 3CCUF 3CC4F
chains in the Genus database with same CATH topology
3I7TA 3K0TA 5HP8A 2UYNA 3ZO8A 3LYBA 3GTZA 3ZP7A 5HP7A 2B33A 1QD9A 3V4DA 1J7HA 1JD1A 3R0PA 3K12A 1ONIA 1X25A 2CHTA 2UYNB 2IG8A 1NQ3A 3LMEA 2OTMA 4NWOB 3ZOPA 4ZK7A 2EWCA 3VCZA 1XRGA 1QU9A 2UYKA 3M1XA 2CVLA 1PF5A 3D01A 1ODEA 3I3FA 3QUWA 1UFYA 1XHOA 2CWJA 2CW4A 1FNJA 3KJKA 2DYYA 2CSLA 3M4SA 3ZP4A 2UYPA 1UI9A 3KJJA 1COMA 1DBFA 1FNKA 2CHSA 3MQWA 2UYJA 1QAHA 3L7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7T A;  3K0T A;  5HP8 A;  2UYN A;  3ZO8 A;  3LYB A;  3GTZ A;  3ZP7 A;  5HP7 A;  2B33 A;  1QD9 A;  3V4D A;  1J7H A;  1JD1 A;  3R0P A;  3K12 A;  1ONI A;  1X25 A;  2CHT A;  2UYN B;  2IG8 A;  1NQ3 A;  3LME A;  2OTM A;  4NWO B;  3ZOP A;  4ZK7 A;  2EWC A;  3VCZ A;  1XRG A;  1QU9 A;  2UYK A;  3M1X A;  2CVL A;  1PF5 A;  3D01 A;  1ODE A;  3I3F A;  3QUW A;  1UFY A;  1XHO A;  2CWJ A;  2CW4 A;  1FNJ A;  3KJK A;  2DYY A;  2CSL A;  3M4S A;  3ZP4 A;  2UYP A;  1UI9 A;  3KJJ A;  1COM A;  1DBF A;  1FNK A;  2CHS A;  3MQW A;  2UYJ A;  1QAH A;  3L7Q A; 
#chains in the Genus database with same CATH topology
 2QEX F;  3CPW F;  1TVK A;  4G4Y A;  1RA4 A;  2ZVY A;  4TV8 A;  2B33 A;  2HRU A;  1VH8 A;  2ZOD A;  1FFX B;  2QA4 F;  4FFB A;  3CCR F;  5GIO C;  1VQL F;  1SA0 A;  5JQG B;  4G4X A;  2BO1 A;  2VGM A;  5EIB C;  4ZI7 B;  3WJP A;  3G4S F;  5IJ0 B;  3LME A;  3CCL F;  1CN7 A;  3D54 A;  4IIJ A;  3JAS A;  3RYF B;  4O4H A;  5IJ0 A;  2Q1X A;  3C9U A;  5HY1 A;  4O2B B;  1GO0 A;  2K1S A;  2VAW A;  3IKF A;  1FFX A;  3P10 A;  3S02 A;  1GO1 A;  4NQ3 A;  1YQN A;  1NMU B;  1FNK A;  1YJW F;  3JCM M;  4G4W A;  3CPQ A;  1ZWZ A;  1KQS F;  3VIU A;  1S72 F;  1R1M A;  1X52 A;  3S03 A;  2Z1F A;  3LWR C;  2BTU A;  2Q1Y A;  4ZOL B;  1Z5V A;  3BYQ A;  5JCO A;  5FJ4 C;  1W3E X;  5HY0 A;  3RYC B;  3P4E A;  2YYE A;  2KG4 A;  5C8Y B;  4ZHQ A;  4ZI7 A;  1T0A A;  1SA0 B;  4B45 A;  2FC3 A;  3HWU A;  1U3L A;  4TV9 A;  3FD5 A;  1K8A H;  3N4Z A;  2CSL A;  4DXD A;  3ON1 A;  4TV9 B;  1YIJ F;  4TUY B;  3MCA B;  1YHQ F;  4C8I A;  2HS4 A;  1SDS A;  5LXT A;  3F0F A;  1VK3 A;  4C8G A;  2LBW A;  4BT2 A;  3J7A R;  3CCJ F;  4BW0 B;  5EWR A;  3RE3 A;  2HS3 A;  1VQ7 F;  3K14 A;  3JAT A;  2QI2 A;  3RYH B;  3QUW A;  3FPI A;  4WBN B;  1XHO A;  3NMU C;  3RYI A;  5JVD A;  2N48 A;  3HJW C;  1COM A;  1DBF A;  1JFF A;  3ESJ A;  3FFM A;  5J2U B;  3VYS C;  1QAH A;  3ERN A;  5EO3 A;  5ITZ A;  2QTP A;  3IEW A;  4IHJ A;  3E20 B;  5MN4 A;  1W5E A;  3LWO C;  5LP6 A;  3PLA C;  1Z5W A;  4ZOL A;  3SIV A;  5LOV B;  1VQ4 F;  4RQO A;  3N4Y A;  1VQ8 F;  1KNK A;  3JAR B;  5JQG A;  3CCQ F;  1VQ6 F;  4B5C A;  5KX5 A;  1JD1 A;  3DC2 A;  2JNB A;  1W58 1;  5MN6 A;  3JAM M;  2OZB A;  2IG8 A;  1NQ3 A;  2ALE A;  5EB0 A;  4TZZ A;  4O2A A;  1VQN F;  3G6E F;  3D00 A;  1VQ5 F;  3JAW B;  1JFF B;  3C9R A;  3RYI B;  1FSZ A;  4X1K A;  3JAL B;  1VQO F;  3CB2 A;  1IV4 A;  1TUB B;  1QD9 A;  1NJI H;  3F0G A;  1J7H A;  3MBM A;  2UZH A;  2GZL A;  3VOB A;  4B62 A;  3FD6 A;  2G9I A;  3CCE F;  4I4T B;  4X20 A;  3IR9 A;  5CA0 B;  3M1X A;  4X1I A;  3D01 A;  3O85 A;  3KJK A;  3CMA F;  3LWV C;  5G4U C;  5J2T B;  2ZF8 A;  4B46 A;  3LWQ C;  1W59 A;  4I55 B;  3J80 M;  1H47 A;  2R75 1;  3NK6 A;  2HP0 B;  3HAX D;  4O4J A;  1E7K A;  4LNU B;  2HRY A;  4YJ3 A;  1Q81 H;  1IV1 A;  1VQM F;  1ONI A;  2AIZ P;  1XBI A;  2RHO A;  4O2A B;  1SZQ A;  2NMU A;  4BVS A;  5HXZ A;  3VCZ A;  1PF5 A;  5IYZ A;  1M1K H;  1FNJ A;  2HP3 A;  4X1Y A;  2KTU A;  5EB1 B;  1RQ2 A;  3C9S A;  1TVK B;  3PAF A;  5KMG B;  2LCA A;  1OFU A;  2Z1E A;  3K0T A;  3RYF A;  2VAM A;  4ZHW A;  1K73 H;  3QTY A;  1X7P A;  3RA5 A;  3TD5 A;  4YJ3 B;  3WPW A;  3HKD A;  3VMF B;  2PMP A;  5MN5 A;  1W41 A;  2CHT A;  3N2G A;  4TV8 B;  2Z1U A;  3CCS F;  3JAR A;  4C81 A;  3IMP A;  2VAP A;  1IPA A;  5LP6 C;  4BT7 A;  2DYY A;  3M4S A;  3LDT A;  3HTN A;  3HKB A;  1GX1 A;  5CB4 B;  1RLG A;  4TUY A;  2CZW A;  3VI6 A;  3M84 A;  4G88 A;  3ZO8 A;  3LYB A;  5GAN K;  3HKE A;  3C8L A;  2HP0 A;  1U3P A;  4C82 A;  1K9M H;  3UT5 A;  1VQ9 F;  4DRX A;  1XV2 A;  1KC8 H;  2HS0 A;  4C8E A;  4U3J A;  4O4L A;  3UT5 B;  1DT9 A;  1PXW A;  3ELC A;  3V7Q A;  3HKE B;  1JN1 A;  1T0K B;  1Q8R A;  3F0E A;  3I3F A;  1RQ7 A;  3Q8H A;  2CW4 A;  3OBY A;  5JH7 A;  3RYC A;  4PWT A;  3ZP4 A;  2RHJ A;  5LYJ B;  2ZAU A;  4BVR A;  2UYJ A;  3TD3 A;  3T80 A;  3S0H A;  3WGK A;  1VQV A;  4BT4 A;  5LA6 B;  1H48 A;  5KX5 B;  2FGY A;  4M8I A;  3VTI C;  3HKD B;  1YJN F;  5FNV B;  5BMV A;  1H7M A;  2RHH A;  4IIJ B;  5EZY B;  3TD4 A;  3CCM F;  1YIT F;  1X7O A;  2I6D A;  2OTL F;  3QHD A;  2Z1T A;  3NK7 A;  4G4V A;  3IEQ A;  2UYN A;  3GTZ A;  3ZP7 A;  3JVH A;  4EI9 A;  1QVG F;  1N8R H;  3E1Y A;  5LYJ A;  2W8B C;  2H8E A;  2AIF A;  2OHW A;  3VOA A;  5CA1 B;  1W5A A;  3OBW A;  5J2U A;  3I56 F;  5KMG A;  1U40 A;  2OTJ F;  5HXU A;  4ZHY B;  4ZK7 A;  3S0W A;  3VYT C;  3KHN A;  3RA6 A;  2BTQ B;  4EB6 B;  2CWJ A;  4DRX B;  1UI9 A;  1IV2 A;  3I7T A;  3HKC B;  4I4T A;  4X20 B;  5GON A;  3CCV F;  4LNU A;  2DT4 A;  5DCV A;  1YI2 F;  4O4J B;  4BT3 A;  5C8Y A;  1YGY A;  5CA1 A;  4KWE A;  1VQP F;  2LBX A;  2HQS C;  3KIZ A;  2UYN B;  5GIP C;  3CME F;  3EOR A;  2H8C A;  5J2T A;  2KGW A;  4HNA B;  5EYP A;  4BY9 D;  3N2G B;  1RLU A;  2CVL A;  1W55 A;  3JAK B;  2BTO A;  2AMT A;  2YXZ A;  4F6R B;  4I50 B;  3WGN A;  3SIU A;  1GZ0 A;  5FLX M;  1W42 A;  2ZOV A;  4O4I B;  1JY8 A;  5HP7 A;  2VXY A;  3E22 B;  4ZHV A;  5JVD B;  3F6M A;  3JAL A;  1VQK F;  3MDO A;  1X25 A;  5GAP K;  3V3T A;  2EWC A;  5AVM A;  5B8F A;  3U0O A;  2UYK A;  3WPX A;  1W57 A;  3OW2 F;  1ODE A;  5LP6 B;  3JAS B;  3S06 A;  3VYU C;  3C9T A;  4U39 A;  4F6R A;  2UYP A;  4I50 A;  2VGN A;  5BMV B;  3JAK A;  3WGM A;  4BVT A;  4BT5 A;  4EI8 A;  4I55 A;  5IYZ B;  3E22 A;  4X3L A;  3LFO A;  4BT6 A;  4ERH A;  4O4I A;  3FBA A;  2WAL A;  3WGJ A;  3G71 F;  5ITZ B;  3CG6 A;  3WJQ A;  1IV3 A;  4NWO B;  2RHL A;  3WJR A;  5CB4 A;  5IT9 M;  1XRG A;  5HY4 A;  4WBN A;  1M90 H;  3CD6 F;  3HKC A;  5GON B;  1UFY A;  2IAF A;  5IJ9 A;  2I6R A;  1TUB A;  3V7E A;  3CXC F;  4R40 B;  5IJ9 B;  4X1K B;  2P6Y A;  4RHA A;  1KNJ A;  3IKE A;  4ZHQ B;  5A2Q M;  1JJ2 F;  3R0P A;  1CK2 A;  3K12 A;  3CC2 F;  4NUT A;  3I55 F;  3K2X A;  5JCO C;  4EI7 A;  4G4Z A;  3AGK A;  3N2K B;  4YJ2 A;  2F9Z C;  5GIN C;  5G4V C;  4X1Y B;  1Q7Y H;  1CLI A;  4YJ2 B;  3S0Y A;  2CHS A;  3MQW A;  2LBT A;  3JAW A;  3B6N A;  4O2B A;  3OON A;  3VO8 A;  2PHN A;  5HWE A;  5EZY A;  2IQQ A;  2Z01 A;  5JH7 B;  2HVY D;  3CYP B;  1W5F A;  5FNV A;  5EAZ A;  3MCQ A;  3F0D A;  4FFB B;  4X3M A;  1YJ9 F;  2OTM A;  2ZVZ A;  4HNA A;  5EYP B;  5LA6 A;  3ZOP A;  1Q82 H;  3KE1 A;  3N2K A;  3P0Z A;  5EIB D;  3NVK E;  3NVI B;  1W2B F;  5LOV A;  4O4H B;  2R6R 1;  4BVQ A;  1U43 A;  5LXT B;  4IHJ B;  2KTV A;  3GYQ A;  1KD1 H;  3L7Q A;  3GHZ A;  5HP8 A;  3WXM B;  5HY2 A;  4LCK A;  2GLZ A;  2RB9 A;  3LWP C;  3JAT B;  3RYH A;  1W5B A;  1VHA A;  4XCQ A;  3V4D A;  2HX0 A;  4E6E A;  4C4W C;  1Q86 H;  4O4L B;  3J81 M;  4EB6 A;  3CC7 F;  3CYQ A;  4U3J B;  2L26 A;  2MQE A;  2GVI A;  1W40 A;  4X1I B;  1QU9 A;  5CA0 A;  2V9Y A;  3DDN A;  1QVF F;  2H6L A;  1OAP A;  3WGL A;  3KJJ A;  3HKB B;  3CCU F;  3CC4 F; 
#chains in the Genus database with same CATH homology
 3I7T A;  3K0T A;  5HP8 A;  2UYN A;  3ZO8 A;  3LYB A;  3GTZ A;  3ZP7 A;  5HP7 A;  2B33 A;  1QD9 A;  3V4D A;  1J7H A;  1JD1 A;  3R0P A;  3K12 A;  1ONI A;  1X25 A;  2CHT A;  2UYN B;  2IG8 A;  1NQ3 A;  3LME A;  2OTM A;  4NWO B;  3ZOP A;  4ZK7 A;  2EWC A;  3VCZ A;  1XRG A;  1QU9 A;  2UYK A;  3M1X A;  2CVL A;  1PF5 A;  3D01 A;  1ODE A;  3I3F A;  3QUW A;  1UFY A;  1XHO A;  2CWJ A;  2CW4 A;  1FNJ A;  3KJK A;  2DYY A;  2CSL A;  3M4S A;  3ZP4 A;  2UYP A;  1UI9 A;  3KJJ A;  1COM A;  1DBF A;  1FNK A;  2CHS A;  3MQW A;  2UYJ A;  1QAH A;  3L7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...